Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K02981g2.532ON27827813300.0
NDAI0I022702.532ON2772054611e-55
NCAS0D026402.532ON2602654592e-55
TPHA0C041802.532ON2642703643e-41
KAFR0A018502.532ON2562793468e-39
TDEL0A030602.532ON2442173423e-38
SAKL0A09460g2.532ON2402713381e-37
KNAG0C058202.532ON2711933243e-35
Kpol_1018.342.532ON2921843122e-33
YMR069W (NAT4)2.532ON2852693104e-33
Smik_13.2482.532ON2551922972e-31
Skud_13.2252.532ON2541922762e-28
KLTH0D06820g2.532ON2601502379e-23
TBLA0G022202.532ON2782872292e-21
Suva_13.2442.532ON2571422151e-19
ZYRO0B01980g2.532ON1881512022e-18
Kwal_26.80162.532ON2402691912e-16
Ecym_72562.532ON2431761271e-07
KLLA0E18569g2.532ON2151571162e-06
NDAI0F027802.156ON55699750.64
Agos_YGOB_Anc_2.5322.532ON187143701.5
CAGL0L03982g2.156ON55486683.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K02981g
         (278 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   516   0.0  
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   182   1e-55
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   181   2e-55
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   144   3e-41
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   137   8e-39
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   136   3e-38
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   134   1e-37
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   129   3e-35
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   124   2e-33
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   124   4e-33
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   119   2e-31
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   110   2e-28
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    96   9e-23
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    93   2e-21
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    87   1e-19
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    82   2e-18
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    78   2e-16
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    54   1e-07
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    49   2e-06
NDAI0F02780 Chr6 complement(682561..684231) [1671 bp, 556 aa] {O...    33   0.64 
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    32   1.5  
CAGL0L03982g Chr12 complement(466897..468561) [1665 bp, 554 aa] ...    31   3.7  

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/278 (94%), Positives = 263/278 (94%)

Query: 1   MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA 60
           MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA
Sbjct: 1   MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA 60

Query: 61  LTNEVVLRSKHXXXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEG 120
           LTNEVVLRSKH               DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEG
Sbjct: 61  LTNEVVLRSKHIKESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEG 120

Query: 121 MIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQY 180
           MIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQY
Sbjct: 121 MIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQY 180

Query: 181 FLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLY 240
           FLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLY
Sbjct: 181 FLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLY 240

Query: 241 DQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPIL 278
           DQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPIL
Sbjct: 241 DQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPIL 278

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  182 bits (461), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 102/205 (49%), Positives = 131/205 (63%), Gaps = 18/205 (8%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D NLG KY   SK +Y N K WK NK+EEM + G+IYVSYW   D+++  PLLFLSFMLT
Sbjct: 75  DVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYW---DEKYQEPLLFLSFMLT 131

Query: 147 EEENLT-----------HNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLD 195
           E +              HND + SVI+LYEIQI  +LR QG+G   LS  L QC   L+ 
Sbjct: 132 EGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQCCSSLVT 191

Query: 196 NDSLN-LEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKI 254
               + L +P  GIELTVF+DN+ AIN Y+ +GM  TP+SP D +Y Q  +R+TRN R+I
Sbjct: 192 KYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVY-QIEKRQTRNLRRI 250

Query: 255 NNKN--ESPRILIKKPLYYMYWKPI 277
           NN    E  + +IKKP+YY+Y+ PI
Sbjct: 251 NNAGTREVTKQIIKKPVYYLYYLPI 275

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  181 bits (459), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 157/265 (59%), Gaps = 11/265 (4%)

Query: 13  DSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHX 72
           ++F H +L+ FP  +T +  L + ++   L+RK+L+I+ D+ C + K  + +VV      
Sbjct: 5   EAFSHMILEEFP--LTLEVTLQEQLK--CLKRKILIIEPDN-CTSGKN-SQDVVYMKCST 58

Query: 73  XXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDD 132
                         D NLG+KY   SK++Y N +PWK NK+EEM + G++YVSYW   D+
Sbjct: 59  DQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW---DE 115

Query: 133 EHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKR 192
           E   P+LFLSFMLTEE+  T +D + SV++LYEIQI   LR + LG   L+  L     R
Sbjct: 116 ESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 175

Query: 193 LLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSR 252
           L   +   LE+P  GIELTVF+DN  AI  Y+ +GM  TP+SP+D +     RRRTR   
Sbjct: 176 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLE-RRRTRGMA 234

Query: 253 KINNKNESPRILIKKPLYYMYWKPI 277
           + N      R +++KP+YY+++ P+
Sbjct: 235 Q-NISTSVGRTIVQKPIYYLFYLPL 258

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  144 bits (364), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 146/270 (54%), Gaps = 19/270 (7%)

Query: 15  FLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA--LTNEVVLRSKHX 72
           F+  V   +P  I    NL K      L +K++V+D +   + N A       +  S++ 
Sbjct: 7   FVKIVDSHYPDEIYVNKNLTK------LVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60

Query: 73  XXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDD 132
                         D NLG  Y I +K++YGN KPWKENKI+EM TEG+IYV Y   ++D
Sbjct: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVY--HLED 118

Query: 133 EHTVPLLFLSFMLTEEEN-LTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAK 191
           E     L+LSF LT+E   L   D  S VI+LYEIQ++ E+R  GLG   ++  L  C  
Sbjct: 119 EKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC-- 176

Query: 192 RLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD--VLYDQNTRRRTR 249
            L+D    N+     GIELTVF+DN  AI  Y+ +GM  TP+SP D  + Y    + R++
Sbjct: 177 -LVDVHE-NIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQ 234

Query: 250 NSRKINNKNESPRIL--IKKPLYYMYWKPI 277
           NS K  + ++ P  L  +KKP YY+Y+ P+
Sbjct: 235 NSSKKGSSSDKPTSLSVVKKPDYYLYYLPL 264

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  137 bits (346), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 143/279 (51%), Gaps = 25/279 (8%)

Query: 1   MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDY--CLAN 58
           M N E++     + FL  V D FPK + TK           L+RK+L I  +D     ++
Sbjct: 1   MENIEIF-----NGFLKIVSDEFPKELRTKGQ--------NLKRKILYIASEDEENKESD 47

Query: 59  KALTNEVVLRSKHXXXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNT 118
             +  +  L                   D NLG KYE  S+E+Y N   WK+NK+ EM +
Sbjct: 48  SVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKS 107

Query: 119 EGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLG 178
            G+IYVSYW K + E     LFLSFMLTEE+ +  +    SVI+LYEIQ+ ++ R   LG
Sbjct: 108 PGLIYVSYW-KEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLG 166

Query: 179 QYFLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDV 238
              +      C    +    +   FP  GI+LTVF+DN  AI  Y+++GM  T  SPKD 
Sbjct: 167 TRLIKGLSNVCQ---IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDE 223

Query: 239 LYDQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPI 277
           + D+   R+TR S  +N K      +++KP+YY+ + P+
Sbjct: 224 V-DKIESRKTRTS--VNRKTLK---VVRKPIYYLLYLPV 256

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  136 bits (342), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 117/217 (53%), Gaps = 17/217 (7%)

Query: 32  NLPKDI--EDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHXXXXXXXXXXXXXXXDQN 89
           N P  I    +QL RK+L ID ++Y +     T++ +                    D+N
Sbjct: 16  NFPTTINAAGIQLTRKLLAIDTEEYPVE----TDQCISYVHSPREAEKLLWQLLEILDEN 71

Query: 90  LGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSY-------WTKVDDEHTVPLLFLS 142
           LGQKY  SS+ +Y N +PW+ NK  EM T G++YV Y        T+  +    PLLFLS
Sbjct: 72  LGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFSPLLFLS 131

Query: 143 FMLTEEENLTHNDP--VSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLN 200
           FMLTEE+ L  +DP  V +V++LYE+Q+   +R+ GL    L + L QC ++L       
Sbjct: 132 FMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLCTRSRAG 191

Query: 201 L--EFPFAGIELTVFADNLPAINLYQKLGMTHTPESP 235
              +  F G+ELTVFADN PAI LY+ LGM    +SP
Sbjct: 192 RFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  134 bits (338), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 132/271 (48%), Gaps = 34/271 (12%)

Query: 7   YGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVV 66
           Y  NV    L +VLD FP  IT K       +     RKVLVID     +A    + +V 
Sbjct: 4   YPANV---LLPYVLDSFPTSITLK-------DGSLATRKVLVIDEPSSGIAP---SGQVC 50

Query: 67  LRSKHXXXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSY 126
             S                 D NLG KY   S  +YGN + W ENK+EEM T G++YV Y
Sbjct: 51  TWSGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGY 110

Query: 127 WTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCL 186
           +  V      PL+FLSF+LT+E +    DPV  V++LYEIQ+  E++ Q LG   L   L
Sbjct: 111 FQGVS-----PLMFLSFLLTDEPDFL-PDPV-KVVYLYEIQLLPEVQGQRLGTQMLQVYL 163

Query: 187 FQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRR 246
                 L   D L       GIELTVF+DN  A++LY  +GM   P SP D +    ++R
Sbjct: 164 KNTVHSLSRLDPL-----LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEI--ATSQR 216

Query: 247 RTRNSRKINNKNESPRILIKKPLYYMYWKPI 277
           RTR+S             + +P YY+ + P+
Sbjct: 217 RTRHSTTDLQT-------VSRPDYYLMFLPV 240

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  129 bits (324), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 113/193 (58%), Gaps = 16/193 (8%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D NLG  Y   S+++YGN K W+ENK  EM +  ++YVSYW   D E   P+L+ SFMLT
Sbjct: 91  DNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVS-DSE---PVLYTSFMLT 146

Query: 147 EEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEFP-F 205
           EE  ++  +    V++LYEIQ+ + +R+Q LGQ  +S  L +CA          LE P  
Sbjct: 147 EENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSY-LTECA----------LESPEV 195

Query: 206 AGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNKNESPRILI 265
           A + LTVF+DN  A+  Y++L  T+T +SP+D + ++  RR    +     ++   ++ I
Sbjct: 196 AAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAARTALDPARDSDVKVTI 255

Query: 266 KKPLYYMYWKPIL 278
           KKP YY+ +  ++
Sbjct: 256 KKPTYYLLYLEVV 268

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  124 bits (312), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 111/184 (60%), Gaps = 16/184 (8%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D NLG  Y   S ++Y N+KPWKENKI EM +EG++YV Y    DD    PLLF+SFM+T
Sbjct: 77  DNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYN---DDITKEPLLFMSFMIT 133

Query: 147 EEENL---THND------PVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDND 197
           ++ +L   T ND        ++VI+LYEIQ+ + +R Q LG   ++N L +  + L  + 
Sbjct: 134 DDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKDY 193

Query: 198 SLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNK 257
             N+      +ELTVF++N+ AIN Y+K+GM +TP+SP+D +     RR    +  + +K
Sbjct: 194 QKNI----IALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESK 249

Query: 258 NESP 261
           N  P
Sbjct: 250 NNEP 253

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  124 bits (310), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 130/269 (48%), Gaps = 34/269 (12%)

Query: 15  FLHHVLDCFPKVITTK-SNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHXX 73
           FL+  ++ FP+ I  K ++   +     L+R+++ I  DD    +   + + +    H  
Sbjct: 36  FLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKLHKS 95

Query: 74  XXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDE 133
                        D++LG KY  +S+ MYGN+KPWK NK+ EM + G++YV YW     +
Sbjct: 96  RGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW-----D 150

Query: 134 HTVPLLFLSFMLTEEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCLF-- 187
           + V   F SFMLTEE  L   D +      VI+LYE+ ++   R  G+G+  L + L   
Sbjct: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210

Query: 188 --QCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTR 245
             +  +R+ DN        F G+ LTVF+DN  A  LY+ LG    P SP        T 
Sbjct: 211 VARHTRRMCDN--------FFGVALTVFSDNTRARRLYEALGFYRAPGSPAPA---SPTI 259

Query: 246 RRTRNSRKINNKNESPRILIK-KPLYYMY 273
           R TR+           R+++   PLYY+Y
Sbjct: 260 RHTRHG--------GGRVVVPCDPLYYVY 280

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  119 bits (297), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 100/192 (52%), Gaps = 25/192 (13%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D++LG KY  +S+ MYGN+KPWK NK+ EM +  ++YVSYW     ++     F SFMLT
Sbjct: 79  DEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYW-----DNGALAAFASFMLT 133

Query: 147 EEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLE 202
           EE  L   D        VI+LYE+ ++   R  G+G+  L   L +   R +      L 
Sbjct: 134 EETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEGVARHVR----CLY 189

Query: 203 FPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNKNESPR 262
             F G+ LTVF+DN  A  LY+ LG    P SP        T R TR+  +        R
Sbjct: 190 EEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAA---GAPTTRPTRHGGE--------R 238

Query: 263 ILIKK-PLYYMY 273
           +++ + PLYY+Y
Sbjct: 239 VVVPRDPLYYVY 250

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  110 bits (276), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 97/192 (50%), Gaps = 25/192 (13%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D++LG KY  +S+ MYGN+ PWK NK+ EM + G++YVSYW            F SFMLT
Sbjct: 78  DEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN-----GALGAFASFMLT 132

Query: 147 EEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLE 202
           EE  L   D        VI+LYEI ++   R  GLG+  L   L +   R +     +  
Sbjct: 133 EETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGVARRVRRVRCD-- 190

Query: 203 FPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNKNESPR 262
             F G+ LTVF DN  A  LY+ +G    P SP          R TR+ RK        R
Sbjct: 191 --FFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPA---APALRPTRHGRK--------R 237

Query: 263 ILIKK-PLYYMY 273
           +++ + PLYY+Y
Sbjct: 238 VVVARDPLYYVY 249

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 95.9 bits (237), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 81/150 (54%), Gaps = 11/150 (7%)

Query: 89  NLGQKYEISSKEMYG-NKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTE 147
           NLG  Y   ++ +YG  ++ W   K  EM T G++YV Y     D H+ PL+F+S +LT+
Sbjct: 88  NLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVY----SDSHSQPLVFMSLLLTD 143

Query: 148 EENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEFPFAG 207
           E  L   +  + V++L+EI +S  +R QGLG + L +CL      L       L     G
Sbjct: 144 EPELG-QELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPSVL-----G 197

Query: 208 IELTVFADNLPAINLYQKLGMTHTPESPKD 237
            ELTVF++N  A+ LY  LGM     SP+D
Sbjct: 198 AELTVFSENQRALRLYLALGMHVAAWSPQD 227

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/287 (31%), Positives = 142/287 (49%), Gaps = 46/287 (16%)

Query: 19  VLDCFPKVITTKSNLPKDIEDVQLQRKVLVI-DGDDYCLA----NKALTNEVVL---RSK 70
           V + FPK I+TK       + + L+RK+ +I D ++  L     N +  +E+       K
Sbjct: 10  VDNAFPKSISTK-------QGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRK 62

Query: 71  HXXXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKV 130
           +               D+NLG+ Y+  SK++Y N   W  NK EEM T  MIY++YW   
Sbjct: 63  NPTVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYW--- 119

Query: 131 DDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCA 190
           D +     LFLS +  EE  +  N+    V++LYEI I+KE ++QG+G+  + + L +  
Sbjct: 120 DCKQNSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL 179

Query: 191 KRLL-----DNDSLNLEFPFAGIELTVFADNLPAINLY-QKLGMTHTPESPKDVLYDQNT 244
            + L     DN+       F G+ELTVF++N  A N Y  K+ M +T  SP+D + +   
Sbjct: 180 IKPLKIERQDNN-------FIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINV-M 231

Query: 245 RRRTRN----------SRKINNKNESPRIL----IKKPLYYMYWKPI 277
           +R TR+            K+ + N+  + L    I+KP YY+   P+
Sbjct: 232 KRITRSFDEKLGEHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 68/142 (47%), Gaps = 10/142 (7%)

Query: 87  DQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLT 146
           D++LG KY  +S+ MYGN+ PWK NK+ EM + G++YV YW            F SFMLT
Sbjct: 78  DEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASFMLT 137

Query: 147 EEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLE 202
           EE  L   D        VI+LYE+      R  G      + C    A+     D L   
Sbjct: 138 EETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGLGRRLLAKALCEGVAARVRRTCDDL--- 194

Query: 203 FPFAGIELTVFADNLPAINLYQ 224
               G+ LTVF DN  A  LY+
Sbjct: 195 ---FGVALTVFGDNTRARRLYE 213

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 82.4 bits (202), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 80/151 (52%), Gaps = 19/151 (12%)

Query: 89  NLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEE 148
           NLG  Y   +K +Y N K W+ NK +EM +E + +VSYW    +E    + F S M  EE
Sbjct: 31  NLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNEL---VCFCSIMPCEE 87

Query: 149 ENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQ--CAKRLLDNDSLNLEFPFA 206
             +     +S++I+LYEI ++ E R Q  G+  L N L +  C K  L           +
Sbjct: 88  SIVE--GEMSNIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPKAHL-----------S 133

Query: 207 GIELTVFADNLPAINLYQKLGMTHTPESPKD 237
           GIELTVF+ N  AIN Y+  G T + +SP D
Sbjct: 134 GIELTVFSSNERAINFYRNNGFTLSYDSPSD 164

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 121/269 (44%), Gaps = 43/269 (15%)

Query: 13  DSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHX 72
           D  + HV D FP  +T  S         ++QR V  +  D              +RS+  
Sbjct: 7   DYLVPHVTDSFPTTLTLASGQ-------RIQRAVYGVPMD-------------TVRSRAE 46

Query: 73  XXXXXXXXXXXXXXDQNLGQKYEISSKEMYGNK-KPWKENKIEEMNTEGMIYVSYWTKVD 131
                         D NLG  Y   +K +YG++   WKE K +EM T G++YV Y   VD
Sbjct: 47  IPDPCLLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVY-RAVD 105

Query: 132 DE---HTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQ 188
           +E     +PL FLS +LT+E  L      ++V++L EI ++  +R  GLG   L   +  
Sbjct: 106 EETGKEGLPLAFLSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAG 163

Query: 189 CAKRLLDNDSLNLEFPF-AGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRR 247
             +            PF  G ELTVF DN  A+ LY +LGM     SP+D   + +  RR
Sbjct: 164 TVR------GARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVH--RR 215

Query: 248 TRNSRKINNKNESPRILIKKPLYYMYWKP 276
           TR +R  + K       + +P YY+ + P
Sbjct: 216 TRATRYESRK-------VTRPTYYLLFWP 237

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 43/176 (24%)

Query: 87  DQNLGQKYEISSKEMY---GNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSF 143
           ++ LG  Y++ +  +Y      +PW+ +K  E+   G  +V Y  + ++       F+S 
Sbjct: 55  ERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLY--RKENPGGAIAGFVSL 112

Query: 144 MLTEEENL------------------------------THNDPVSSVIFLYEIQISKELR 173
           +  +E +                               T   P   V+++ EI +S   +
Sbjct: 113 LFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQ 172

Query: 174 KQGLGQYFLSNCLFQCAKRLLDNDSLNLEFP-FAGIELTVFADNLPAINLYQKLGM 228
            QGLG     +C+  CA++L+ +  +   FP   G+ELTVF  N  A+ LY++ G 
Sbjct: 173 NQGLG-----SCMLLCARQLVQH--MQPSFPQLKGLELTVFTGNRQALALYRRQGF 221

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 25/157 (15%)

Query: 88  QNLGQKYEISSKEMY---------GNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPL 138
           QNL   YE+    +Y         GN+K W   K +EM  + ++Y+  + +   + T  +
Sbjct: 58  QNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKR---DTTKIV 113

Query: 139 LFLSFMLTEEEN--LTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDN 196
            F S  L++  N  L H+      +FLYEI +  E + +GLG    +  L   A+     
Sbjct: 114 GFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLAR----- 168

Query: 197 DSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPE 233
              +L  P   IEL VF  N  A   Y++LG   T E
Sbjct: 169 ---DLTCP--SIELCVFTANDVACRWYKRLGFQLTVE 200

>NDAI0F02780 Chr6 complement(682561..684231) [1671 bp, 556 aa] {ON}
           Anc_2.156
          Length = 556

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 129 KVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIF---LYEIQISKELRKQGLGQYFLSNC 185
           KV D  T+ +    + +TE   L  N+P+S+ IF   LY    +++  + G G YF    
Sbjct: 168 KVQDSPTIIVRPRGWHMTENHLLVDNEPISASIFDFGLYFFHNAEKSVQLGKGPYFYLPK 227

Query: 186 LFQCAKRLLDNDSLNLEFPFAG-----IELTVFADNLPA 219
           +    +  L ND  N+   + G     I  TV  + LPA
Sbjct: 228 MEHHLEAKLWNDIFNVAQDYIGMSRGTIRATVLIETLPA 266

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 51/143 (35%), Gaps = 26/143 (18%)

Query: 88  QNLGQKYEISSKEMYG---NKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFM 144
             L   Y   ++ +Y    +   W   K  E+     +++ Y     D       F+S +
Sbjct: 50  AGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILY----RDPAGRLACFISLL 105

Query: 145 LTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEFP 204
           L          P   V+++ E+ ++   R++GL    L           L          
Sbjct: 106 LP--------GPADPVLYILELHVAAPFRRRGLAAALLDAATRTARAAGLTR-------- 149

Query: 205 FAGIELTVFADNLPAINLYQKLG 227
              +ELTVF  N PA+ LY + G
Sbjct: 150 ---LELTVFTANRPALALYARAG 169

>CAGL0L03982g Chr12 complement(466897..468561) [1665 bp, 554 aa]
           {ON} highly similar to uniprot|P30952 Saccharomyces
           cerevisiae YNL117w MLS1 malate synthase or
           uniprot|P21826 Saccharomyces cerevisiae YIR031c DAL7
          Length = 554

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 8/86 (9%)

Query: 142 SFMLTEEENLTHNDPVSSVIF---LYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDS 198
            + + E+     ++P+S+ IF   L+    +KEL K G G YF    +    +  L ND 
Sbjct: 180 GWHMVEKHLYVDDEPISASIFDFGLFFFHNAKELIKLGKGPYFYLPKMEHHLEAKLWNDI 239

Query: 199 LN-----LEFPFAGIELTVFADNLPA 219
            N     +  P   I  TV  + LPA
Sbjct: 240 FNVSQDYIAIPRGTIRATVLIETLPA 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,018,918
Number of extensions: 1444719
Number of successful extensions: 4069
Number of sequences better than 10.0: 32
Number of HSP's gapped: 4127
Number of HSP's successfully gapped: 32
Length of query: 278
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 170
Effective length of database: 41,097,471
Effective search space: 6986570070
Effective search space used: 6986570070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)