Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K02959g2.530ON46446424020.0
NDAI0H014202.530ON44848810511e-139
NCAS0F009302.530ON42247010321e-137
TDEL0A030502.530ON35538110121e-135
YHR004C (NEM1)2.530ON44635210191e-134
Suva_8.582.530ON45236510191e-134
SAKL0A09416g2.530ON3853929991e-132
KAFR0A018302.530ON44234810001e-132
Skud_8.492.530ON4474799901e-130
KNAG0C058502.530ON4434699811e-129
Kwal_26.80012.530ON4134179731e-128
Smik_8.532.530ON4463539761e-128
KLTH0D06776g2.530ON4093729651e-127
Kpol_348.82.530ON4225009361e-122
TPHA0G035002.530ON3923449081e-118
Ecym_72572.530ON3523378501e-110
ZYRO0B01958g2.530ON3363268421e-109
TBLA0I014602.530ON3933588321e-107
AGL070W2.530ON3433408131e-105
KLLA0E18613g2.530ON3743546712e-83
Smik_12.825.202ON3921722748e-26
SAKL0G12870g5.202ON3991722741e-25
YLR019W (PSR2)5.202ON3971722642e-24
NCAS0D027405.202ON3981762642e-24
Kpol_2002.1005.202ON4771652644e-24
NDAI0I021705.202ON3911742614e-24
Skud_12.875.202ON3921722599e-24
TBLA0C060905.202ON4841722601e-23
Suva_10.995.202ON3851722562e-23
NDAI0D018605.202ON5141722592e-23
Smik_12.535.202ON4141822554e-23
KLLA0F15620g5.202ON4141732545e-23
YLL010C (PSR1)5.202ON4271822521e-22
Kpol_478.165.202ON3502152491e-22
CAGL0D05610g5.202ON4471632512e-22
Kwal_33.151405.202ON4101612492e-22
Skud_12.575.202ON4151722483e-22
KLTH0B03388g5.202ON4091722483e-22
ZYRO0B10428g5.202ON4821722493e-22
TPHA0E030705.202ON4941722504e-22
TDEL0E042705.202ON4531722485e-22
TBLA0H019905.202ON6881842506e-22
KAFR0J009905.202ON4831622486e-22
KNAG0M017405.202ON4811722476e-22
Ecym_71045.202ON4921752478e-22
CAGL0D03234g5.202ON4101722458e-22
Suva_10.655.202ON4151612404e-21
AAL158W5.202ON4781732381e-20
TPHA0N006705.202ON4521612325e-20
NCAS0A068005.202ON4731612291e-19
YPL063W (TIM50)8.527ON4761571685e-12
TDEL0B031908.527ON4771571581e-10
SAKL0H10296g8.527ON4781511562e-10
Smik_16.1728.527ON4771571552e-10
Suva_16.2498.527ON4801571543e-10
Skud_16.2188.527ON4801571534e-10
ZYRO0F09130g8.527ON4891121518e-10
NDAI0E029108.527ON4411571491e-09
TBLA0A005408.527ON4851511491e-09
KLLA0E23101g8.527ON4801511472e-09
NCAS0C022108.527ON4911511472e-09
Kwal_27.119908.527ON4741061463e-09
Kpol_457.58.527ON4891511454e-09
CAGL0H05159g8.527ON4851511437e-09
KLTH0E12254g8.527ON4761511437e-09
TPHA0I020008.527ON4781511357e-08
Ecym_11778.527ON4901061312e-07
KNAG0A020608.527ON4501571284e-07
ADR045W8.527ON4761051251e-06
KAFR0E010208.527ON4481511223e-06
CAGL0M02959g8.839ON758326900.022
TPHA0I002408.839ON732139880.037
NCAS0C004208.839ON725258840.12
NDAI0K004208.839ON778137830.15
YOL138C (RTC1)3.22ON134162790.47
KLLA0F16709gna 1ON53181760.86
TPHA0A011508.604ON81855760.95
Smik_15.163.22ON132662761.1
Skud_15.163.22ON133262761.1
TBLA0A103305.286ON29546731.6
TPHA0J028105.480ON32167722.4
Suva_3.351.425ON28377722.4
ADL136C5.103ON55544722.7
NCAS0A065605.286ON29650695.4
Smik_8.1155.286ON29580687.7
Kpol_1053.243.84ON62054688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K02959g
         (464 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   929   0.0  
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    409   e-139
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   402   e-137
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   394   e-135
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   397   e-134
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   397   e-134
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   389   e-132
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   389   e-132
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   385   e-130
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   382   e-129
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   379   e-128
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   380   e-128
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   376   e-127
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   365   e-122
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   354   e-118
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   332   e-110
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   328   e-109
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   325   e-107
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   317   e-105
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   263   2e-83
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...   110   8e-26
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   110   1e-25
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   106   2e-24
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...   106   2e-24
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   106   4e-24
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202    105   4e-24
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...   104   9e-24
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...   104   1e-23
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...   103   2e-23
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202    104   2e-23
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...   102   4e-23
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...   102   5e-23
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...   101   1e-22
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...   100   1e-22
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...   101   2e-22
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...   100   2e-22
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...   100   3e-22
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...   100   3e-22
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...   100   3e-22
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   100   4e-22
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...   100   5e-22
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...   100   6e-22
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...   100   6e-22
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....   100   6e-22
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...   100   8e-22
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    99   8e-22
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    97   4e-21
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    96   1e-20
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    94   5e-20
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    93   1e-19
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    69   5e-12
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    65   1e-10
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    65   2e-10
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    64   2e-10
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    64   3e-10
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   4e-10
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    63   8e-10
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    62   1e-09
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    62   1e-09
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    61   2e-09
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     61   2e-09
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    61   3e-09
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    60   4e-09
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    60   7e-09
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    60   7e-09
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    57   7e-08
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    55   2e-07
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    54   4e-07
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    53   1e-06
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    52   3e-06
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...    39   0.022
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    39   0.037
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    37   0.12 
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...    37   0.15 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    35   0.47 
KLLA0F16709g Chr6 (1539612..1541207) [1596 bp, 531 aa] {ON} some...    34   0.86 
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    34   0.95 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    34   1.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   1.1  
TBLA0A10330 Chr1 complement(2544678..2545565) [888 bp, 295 aa] {...    33   1.6  
TPHA0J02810 Chr10 (626194..627159) [966 bp, 321 aa] {ON} Anc_5.4...    32   2.4  
Suva_3.35 Chr3 complement(46009..46860) [852 bp, 283 aa] {ON} YC...    32   2.4  
ADL136C Chr4 complement(452272..453939) [1668 bp, 555 aa] {ON} S...    32   2.7  
NCAS0A06560 Chr1 complement(1298997..1299887) [891 bp, 296 aa] {...    31   5.4  
Smik_8.115 Chr8 complement(177032..177919) [888 bp, 295 aa] {ON}...    31   7.7  
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    31   8.8  

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/464 (97%), Positives = 453/464 (97%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV
Sbjct: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60

Query: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120
           NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK
Sbjct: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180
           FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD
Sbjct: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180

Query: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240
           NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS
Sbjct: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240

Query: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300
           HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI
Sbjct: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300

Query: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360
           IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS
Sbjct: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360

Query: 361 FTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQV 420
           FTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQV
Sbjct: 361 FTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQV 420

Query: 421 EGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           EGWISDPTDTE           RYTTDVRNVLALKNSEKAFQLS
Sbjct: 421 EGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  409 bits (1051), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 237/488 (48%), Positives = 307/488 (62%), Gaps = 71/488 (14%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MNALSYV + LVLP+  FK KK++K    D+++V++ +      TE N   L      R+
Sbjct: 1   MNALSYVSDSLVLPLQLFK-KKDKK----DARNVIEKKVAAGAATEIN---LEQPYVDRI 52

Query: 61  NDDSVLK-----LRKVNPLIQ--DKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDG 113
                 K     L+K  P ++  D +   ++    + NV++++     V+          
Sbjct: 53  GKQVGTKKAEESLKKPTPGLEFTDNNFIVEEEGHSSLNVTDDRKTKNNVTS--------- 103

Query: 114 QMSRGLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQ 173
                     ++WS + FFP  ++IKP LF+W+ILTFPLSLIE   + R +       SQ
Sbjct: 104 ----------ILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRP-----FSQ 148

Query: 174 SPATNKDNSPSK----------------RLNVIEEAIEDDLISGEVMELQKDALKGSLLP 217
           S    KD+SP K                +L+ I E  EDDL+SG+ + LQ+D +KGSLL 
Sbjct: 149 S----KDSSPEKDETLVHNNSFLPEEPSKLDAINELTEDDLVSGDGIYLQRDNVKGSLL- 203

Query: 218 TNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVID 277
             K SS       R  KT  + ++TS    +K MG+F FPKKLIP+SI  +E++K LV+D
Sbjct: 204 --KASSVRQPSLSRSMKTMVS-NNTS--FSSKRMGKFLFPKKLIPKSITQTERRKKLVLD 258

Query: 278 LDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLII 337
           LDETLIHS+SRGTTH+N SQ HI+EV+F+ SGVS LYYVHKRPYCD FLSKVCKWY+LII
Sbjct: 259 LDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLII 318

Query: 338 FTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIP- 396
           FTASMKEYADPVIDWLE+SF G+FT+R YR  CI RDGVGYIKDL  IKD    N ++P 
Sbjct: 319 FTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYIKDLTIIKD--DSNVSVPQ 376

Query: 397 ---LTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLA 453
              L++V+I+DNSP+SYAM+ DNAIQVEGWISDPTDT            RYTTDVR++LA
Sbjct: 377 TSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILA 436

Query: 454 LKNSEKAF 461
           LKN E+AF
Sbjct: 437 LKNGERAF 444

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  402 bits (1032), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/470 (47%), Positives = 293/470 (62%), Gaps = 54/470 (11%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MNALSY+  +L  PI + K    +KE  +    V   +E TN     N++ + + ++   
Sbjct: 1   MNALSYISSHLASPIHYLK----KKEPTI----VPVEQEPTN-----NNEKIKSHSKATT 47

Query: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120
           N+D              +D +    DS + N     I +   SD            R L+
Sbjct: 48  NND--------------EDYSTPMADSSSSNTIEKSIAVYG-SD------------RALR 80

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180
           F ++ W+ + FFP ++++KP LF+WFI+TFPL L+E  ++ R        L ++   N +
Sbjct: 81  FSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMKHR--TLLKNKLDENSQKNAE 138

Query: 181 NSP--SKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTST 238
             P  S  L VI+E  EDDL  G+ + LQ+D +KGSLL         S+++    KT  +
Sbjct: 139 RVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLL------KATSAKQLSSSKTVKS 192

Query: 239 PSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQA 298
            S  +    +K MG+F FPKKLIPRSI+ + ++K LV+DLDETLIHS+SRGTTHSNSSQ 
Sbjct: 193 ISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQG 252

Query: 299 HIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFS 358
           HI+EV+F++SGVSTLYYVHKRPYCD FLSKV KWY+LIIFTASMKEYADPVIDWLE S  
Sbjct: 253 HIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLP 312

Query: 359 GSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS-KN-ATIP--LTDVVIIDNSPVSYAMHV 414
             F+QR+YR  CI RDGVGYIKDL  I +    KN + +P  L +++IIDNSP+SYAM+V
Sbjct: 313 DKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNV 372

Query: 415 DNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           +NAIQVEGWISDPTD             R+TTDVRNVLALKN EKAF  S
Sbjct: 373 ENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVRNVLALKNGEKAFYTS 422

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  394 bits (1012), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 266/381 (69%), Gaps = 39/381 (10%)

Query: 81  AQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITFFPNYILIKP 140
           +++D++ KT +V +       V+ +  EK +     R  KF    W++I FFP +++IKP
Sbjct: 12  SKRDKNGKTEDVEDK------VAVQKREKIV----RRRSKFTSYAWAVILFFPQWLIIKP 61

Query: 141 TLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIEEAIEDDLIS 200
           T  +W+I++ PL LIE+ ++ R          Q  +T +       L  I E  EDDL  
Sbjct: 62  TQLIWWIISLPLLLIEYGLKSR---------LQRKSTKRSTGT---LQSISELEEDDLAG 109

Query: 201 GEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKL 260
           G+ + LQ+DA+KGSL P             + +++ S    ++ +LGTK MGRF FPKKL
Sbjct: 110 GDEIFLQRDAVKGSLAPA------------KYRRSRSGSRSSTVMLGTKRMGRFLFPKKL 157

Query: 261 IPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRP 320
           IPRS+L++EK+K LV+DLDETLIHS SR T+HSNS+Q H++E+RFAISGVSTLYYVHKRP
Sbjct: 158 IPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRP 217

Query: 321 YCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIK 380
           +CDLFLSKV KWY+L++FTASM+EYADPVIDWLE SFSG F++R+YRN+CI RDGVGYIK
Sbjct: 218 HCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIK 277

Query: 381 DLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXX 440
           DL  +  P     T+ L +V+++DNSP+SYAM+VDNAIQVEGWISDP+DT+         
Sbjct: 278 DLSIVCGP-----TVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLE 332

Query: 441 XXRYTTDVRNVLALKNSEKAF 461
             RYTTDVR++LALKNSE+AF
Sbjct: 333 ALRYTTDVRDILALKNSEQAF 353

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 202/352 (57%), Positives = 255/352 (72%), Gaps = 13/352 (3%)

Query: 124 VVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSV-----RRRGK-ATENEHLSQSPAT 177
           ++W+++ F P Y++IKP + +WF+ TFPLS+IE  V     R RG  A+ENE    S   
Sbjct: 95  ILWALLLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNI 154

Query: 178 N----KDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGK 233
           N    K N  +  LN I EA+EDDL + + + LQ+D +KGSLL      S+  S   + +
Sbjct: 155 NDSSEKTNPKNCNLNTIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSY-SKSE 213

Query: 234 KTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHS 293
            + S  S ++ + GTK MGRF FPKKLIP+S+L ++KKK LVIDLDETLIHS SR TTHS
Sbjct: 214 LSLSNHSSSNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHS 273

Query: 294 NSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWL 353
           NSSQ H++EV+F +SG+ TLY++HKRPYCDLFL+KV KWY+LIIFTASMKEYADPVIDWL
Sbjct: 274 NSSQGHLVEVKFGLSGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWL 333

Query: 354 ESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPY--SKNATIPLTDVVIIDNSPVSYA 411
           ESSF  SF++R YR+ C+ RDGVGYIKDL  +KD     K ++  L DV+IIDNSPVSYA
Sbjct: 334 ESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYA 393

Query: 412 MHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQL 463
           M+VDNAIQVEGWISDPTDT+           RY+TDVRN+LALK+ EKAF +
Sbjct: 394 MNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNI 445

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  397 bits (1019), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 259/365 (70%), Gaps = 26/365 (7%)

Query: 120 KFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEH-----LSQS 174
           K   ++W+I+ F P Y++IKP + +WF+ TFPL++IE    RR K T+  H         
Sbjct: 92  KIVSILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIE----RRVKHTDKRHKESGDSGHE 147

Query: 175 PATN---------KDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQN 225
           P+T+         K ++ ++ LN I E +EDDL + + + LQ+D +KGSLL    D   +
Sbjct: 148 PSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQA-ADGVHS 206

Query: 226 SSQKDR--GKKTTSTPSHTS--NILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDET 281
           +  K R   K   S  +H++   + GTK MGRF FPKKLIP+SIL ++KKK LVIDLDET
Sbjct: 207 AKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDET 266

Query: 282 LIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTAS 341
           LIHS SRGTTHSNSSQ H++EV+F ISG+STLY++HKRPYCDLFL+K  KWY+LIIFTAS
Sbjct: 267 LIHSASRGTTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTAS 326

Query: 342 MKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIK--DPYSKNATI-PLT 398
           MKEYADPVIDWLE SF+ SF++R YR+ C+ RDGVGYIKDL  +K  +   K +++  L 
Sbjct: 327 MKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSSLD 386

Query: 399 DVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSE 458
           DV+IIDNSPVSYAM+VDNAIQVEGWISDPTDT+           RY+TDVRN+LALK+ E
Sbjct: 387 DVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGE 446

Query: 459 KAFQL 463
           KAF +
Sbjct: 447 KAFNM 451

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  389 bits (999), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 207/392 (52%), Positives = 272/392 (69%), Gaps = 21/392 (5%)

Query: 73  PLIQDKDGAQKDR-DSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITF 131
           P   + +  +KD+ D++     +   +  P  DED+      Q  +  K  ++ WSII F
Sbjct: 14  PKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDK-----NQTKKATKLSLL-WSIILF 67

Query: 132 FPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIE 191
            PN+ +IKP LF W+I+TFPL+LIEHS        E+E   +   +  D   +  +N+I 
Sbjct: 68  LPNFFIIKPVLFFWYIITFPLNLIEHS----PADDEDERNGEEGNSTGDEEKTPSINIIV 123

Query: 192 EAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSM 251
           E  E+DL   E++ LQ DA+KGSL  T  +S Q  + K   + +  + S T   LG++ M
Sbjct: 124 EEDEEDLAGDEII-LQTDAVKGSL-STISESQQVKTIKASTRSSIRSGS-TGTALGSRRM 180

Query: 252 GRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVS 311
           GRF FPKKLIP+S+L +EKKK LV+DLDETLIHS+SRGT+ SNSSQ H++EV+FA+SG+S
Sbjct: 181 GRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGIS 240

Query: 312 TLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCI 371
           +LY+VHKRPYCDLFLSKV KWY L++FTASMKEYADPVIDWLESSFSGSF+QR+YR  CI
Sbjct: 241 SLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCI 300

Query: 372 ARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
            RDGVGYIKDL  I    SK +   L +++I+DNSP+SYAM+VDNAIQVEGWISDPTDT+
Sbjct: 301 LRDGVGYIKDLSLI----SKKS---LNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTD 353

Query: 432 XXXXXXXXXXXRYTTDVRNVLALKNSEKAFQL 463
                      R+TTD+RNVL+LK+ E+AF +
Sbjct: 354 LLNLLPLLEALRFTTDIRNVLSLKSGEQAFNI 385

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  389 bits (1000), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 247/348 (70%), Gaps = 11/348 (3%)

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180
            F ++ +II F P Y+ + P ++VWFILT PL+L+E  ++ R +  + E L  +   + +
Sbjct: 98  LFSLLANIILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAE-LRGNFGESSE 156

Query: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240
            SP   L  I E  E+DL + +   LQ+D +KGSLL  + D      Q+ +        +
Sbjct: 157 LSP---LRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPP-VFQRYKSTIKQDHEA 212

Query: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300
             +NI GTK MGRF FPKKLIPRSIL +E+KKTLV+DLDETLIHSVSRGTTH NSSQ H+
Sbjct: 213 MNTNIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL 272

Query: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360
           +EV+F+I+G+STLYYVHKRP+CDLFLSKV KWYN++IFTASMKEYADPVIDWLE SF G+
Sbjct: 273 VEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGN 332

Query: 361 FTQRMYRNHCIARDGVGYIKDLG---NIKDPYSKNATIP---LTDVVIIDNSPVSYAMHV 414
           F +R+YR++C+ RDGVGYIKDL    N          +P   L +V+IIDNSPVSYA++V
Sbjct: 333 FAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNV 392

Query: 415 DNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQ 462
           DNAIQVEGWISDPTDT+           RYTTDVRNVLALKN EK F+
Sbjct: 393 DNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMFE 440

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  385 bits (990), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 224/479 (46%), Positives = 302/479 (63%), Gaps = 47/479 (9%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MNAL Y   +L   I   K KK    +L  S+ +V+    T++          T A+   
Sbjct: 1   MNALKYFSNHL---ITTKKPKKTINVELTKSQDLVNASNETSK----------TGAR-HT 46

Query: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120
            +D +    + N    + +G++++ D+      N  + IKP       K +   + R  K
Sbjct: 47  ENDIIGGNHQHNHSTDNLEGSKQNEDN------NQSVYIKP-------KALRSILRR--K 91

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIE----HSVRRRGKATENEHLSQSPA 176
              ++W+I+ F P Y++IKP + +WF+ TFPLS+IE    H+ +R  +   + ++S + +
Sbjct: 92  IASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPGNSGNVSSTSS 151

Query: 177 TNKDNSPSK------RLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKD 230
            N ++S  K       LN I E ++DDL + + + LQ+D +KGSLL   K  S  S  + 
Sbjct: 152 GNGNDSNEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLL---KAQSVKSRSRS 208

Query: 231 RGKKTTSTPSH--TSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSR 288
             K   S  +H  T+ + GTK MGRF FPKKLIP+SIL ++KKK LVIDLDETLIHS SR
Sbjct: 209 YSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASR 268

Query: 289 GTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADP 348
            TTHSNSSQ H++EV+F ISG+ TLY++HKRPYCD FL+KV +WY+LIIFTASMKEYADP
Sbjct: 269 STTHSNSSQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADP 328

Query: 349 VIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN-ATIP--LTDVVIIDN 405
           VIDWLESSF  +F++R YR+ C+ RDGVGYIKDL  IK        + P  L DV+IIDN
Sbjct: 329 VIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDN 388

Query: 406 SPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           SPVSYAM+VDNAIQVEGWISDPTDT+           RY+TDVRN+LALK+ EKAF ++
Sbjct: 389 SPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 447

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  382 bits (981), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/469 (48%), Positives = 298/469 (63%), Gaps = 33/469 (7%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MN +SY+ ++L+ P+   + K    E       V D    T  D    D  L T A +  
Sbjct: 1   MNTISYITQHLIYPL-RPRAKSLHNEVKSGEGKVDDGVGVTENDVA--DGKLKTTANVEK 57

Query: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120
            ++S LK       + D+ G+  ++ SK   V N             + DI  +     K
Sbjct: 58  QENSTLKEE-----LLDRQGSDAEKASKPIIVIN-------------DGDILNENILHQK 99

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKA-TENEHLSQSPATNK 179
            + V+  +I F P Y++ KP L +WF++T PL+L+E  ++ R +   + E +S+   ++ 
Sbjct: 100 VWNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSD- 158

Query: 180 DNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLL--PTNKDSSQNSSQKDRGKKTTS 237
              PSK L  I E +E+DL +G+   LQ+D +KGSLL   TNK  +   S+K+  +    
Sbjct: 159 ---PSK-LGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHG 214

Query: 238 TPSH-TSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSS 296
             +H  S + GTK MGRF FPKKLIP+SIL  EKKKTLV+DLDETLIHSVSRGTTH NSS
Sbjct: 215 NETHPNSTVFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSS 274

Query: 297 QAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESS 356
           Q HI+EV+F+ISGVSTLYYV KRPYCDLFL+KV KWY+++IFTASMKEYADPVIDWLESS
Sbjct: 275 QGHIVEVKFSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESS 334

Query: 357 FSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIP--LTDVVIIDNSPVSYAMHV 414
           F+G F++R+YRN CI RDGVGYIKDL  +    S   T P  L DV+I+DNSPVSYA++V
Sbjct: 335 FAGKFSRRLYRNDCILRDGVGYIKDLKMVTRG-SNLGTSPDRLEDVIIVDNSPVSYALNV 393

Query: 415 DNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQL 463
           DNAIQVEGWI+DPTDT+             TTDVRN+L+LKN EKAF +
Sbjct: 394 DNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNI 442

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  379 bits (973), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 266/417 (63%), Gaps = 60/417 (14%)

Query: 92  VSNNKIEIKPVSDEDEEKDIDG--------------------QMSRGLKFFIVVWSIITF 131
           ++NN +  KP       ++I+G                    + SRG+++   +WSI+ F
Sbjct: 7   LTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRW-AFLWSILVF 65

Query: 132 FPNYILIKPTLFVWFILTFPLSLIEHS------------VRRRGKATENEHLSQSPATNK 179
            PN +++KP LFVWF++TFPLSLIE S            ++R G    +E +S    T  
Sbjct: 66  LPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVS----TTS 121

Query: 180 DNSPSK-RLNVIEEAIEDDLISGEVMELQKDALKGSLLPTN-------------KDSSQN 225
           D+  SK R+N I+E  EDD + G+ + LQ D +KGSL  TN             +  S+ 
Sbjct: 122 DSVGSKPRINTIQE--EDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKG 179

Query: 226 SSQKDRGKKTTSTPSHTSNI-LGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIH 284
           S Q  +     S  S ++   LG++ MGRF FPKKLIP+S+L   K +TLV+DLDETLIH
Sbjct: 180 SRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIH 239

Query: 285 SVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKE 344
           S+SRGT+ SNSSQ H++EV+FAISG+STLY+VHKRPYCDLFL+ +  WY L++FTASMKE
Sbjct: 240 SMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKE 299

Query: 345 YADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIID 404
           YADPVIDWLESSF G F++R+YR  CI RDGVGYIKDL  +           L+D+ IID
Sbjct: 300 YADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVA------PNTLLSDIFIID 353

Query: 405 NSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAF 461
           NSPVSYAMHVDNAIQVEGWISDPTDT+           R+TTDVRN+LALK+ E AF
Sbjct: 354 NSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  380 bits (976), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 196/353 (55%), Positives = 258/353 (73%), Gaps = 13/353 (3%)

Query: 124 VVWSIITFFPNYILIKPTLFVWFILTFPLSLIE----HSVRRRGKATENEHLSQSPAT-- 177
           ++W+++ F P Y++IKP + +W++ TFPLS+IE    H+ +R  ++++NE+ S + ++  
Sbjct: 95  ILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSA 154

Query: 178 ----NKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGK 233
                K NS +  LN I E +EDDL + + + LQ+D +KGSLL   +     S    + +
Sbjct: 155 GDSSEKINSKNCNLNTISETVEDDLNASDEIILQRDNVKGSLLRA-QSVKLRSRSYSKSE 213

Query: 234 KTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHS 293
            + +  S T+ + GTK MGRF FPKKLIP+S+L ++KKK LVIDLDETLIHS SR TTHS
Sbjct: 214 VSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHS 273

Query: 294 NSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWL 353
           NSSQ H++EV+F ISG+ TLY++HKRPYCDLFL+KV KWY LIIFTASMKEYADPVIDWL
Sbjct: 274 NSSQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWL 333

Query: 354 ESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPY--SKNATIPLTDVVIIDNSPVSYA 411
           ESSF  SF++R YR+ C+ RDGVGYIKDL  IK+     K ++  L DV+IIDNSPVSYA
Sbjct: 334 ESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYA 393

Query: 412 MHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           M+VDNAIQVEGWISDPTDT+           RY+TDVRN+LALK+ EKAF ++
Sbjct: 394 MNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  376 bits (965), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 200/372 (53%), Positives = 254/372 (68%), Gaps = 48/372 (12%)

Query: 122 FIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHL--------SQ 173
           + ++WS++ F PN I++KP LFVWF++TFPLSLIE     R  ++EN+ +        S+
Sbjct: 51  WTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIE-----RASSSENQGMGFDNAEGDSK 105

Query: 174 SPATNKDNSP--SKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDR 231
           S A+    SP  S R++ I E  E+D ++GE M LQ D +KGSL  T   S      +D+
Sbjct: 106 SEASAGTISPKNSSRISTITE--EEDDLAGEEMILQADTVKGSLTVT---SGAKERPQDK 160

Query: 232 GKKT----------TSTPS------------HTSNILGTKSMGRFQFPKKLIPRSILYSE 269
           G++           TS  S                 LG++ MGRF FPKKLIP+S+L   
Sbjct: 161 GRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRR 220

Query: 270 KKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKV 329
           K++TLV+DLDETLIHS+SRGT+ SNSSQ H++EV+FA SG+STLY+VHKRPYCDLFL+K+
Sbjct: 221 KRRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKI 280

Query: 330 CKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPY 389
            KWY L++FTASMKEYADPVIDWLESSF G F++R+YR  CI RDGVGYIKDL  +    
Sbjct: 281 AKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV---- 336

Query: 390 SKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVR 449
             NA+  L+D+ IIDNSPVSYAMHVDNAIQVEGWISDPTDT+           R+TTD+R
Sbjct: 337 VPNAS--LSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIR 394

Query: 450 NVLALKNSEKAF 461
           NVLALK+ E AF
Sbjct: 395 NVLALKSGEHAF 406

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  365 bits (936), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/500 (43%), Positives = 290/500 (58%), Gaps = 115/500 (23%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           MNALSY+   L+ PI+        +E+L       D + +TN   + +D C++++ QI  
Sbjct: 1   MNALSYISSNLITPIE--------EEELPSGSQSEDVQTYTN---DVSDTCVSSQTQII- 48

Query: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120
                                     SK  +V N          ED ++           
Sbjct: 49  --------------------------SKVEDVLN----------EDNQRS---------- 62

Query: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180
               +  ++ FFP Y+L+KP  F+WF++TFP++L E          +N+ L +S A    
Sbjct: 63  ---TLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQ---------KNKKLPKSSANLDT 110

Query: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240
            S SK LN++   +E+DL  G  + LQ+D L GSLL + + + Q+S Q    K ++S+  
Sbjct: 111 MSKSKNLNIL---VEEDLSGGGEIILQRDTLNGSLLKS-RANQQHSHQSRHAKSSSSSVG 166

Query: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300
                L +K +GRF FPKKLIPRSIL+S +KK LV+DLDETLIHS+SR T +SN++QAH+
Sbjct: 167 -----LISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHL 221

Query: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360
           +EV+F ISG+STLYYVHKRPYCDLFLSKVC+WY+LIIFTASMKEYADPVIDWLE+SF GS
Sbjct: 222 VEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGS 281

Query: 361 FTQRMYRNHCIARDGVGYIKDLGNIKD-PYSKNATIP----------------------- 396
           F++R YRN CI RDGVGYIKDL  +   P S  A+                         
Sbjct: 282 FSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNND 341

Query: 397 ------------LTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRY 444
                       L++V++IDNSPVSYAM+VDNAIQV+GWISDPTD +           R 
Sbjct: 342 TNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRN 401

Query: 445 TTDVRNVLALKNSEKAFQLS 464
           TTDVRN+L+LKN E+AF ++
Sbjct: 402 TTDVRNILSLKNGERAFNVN 421

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  354 bits (908), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 188/344 (54%), Positives = 246/344 (71%), Gaps = 20/344 (5%)

Query: 139 KPTLFVWFILTFPLSLIEHSVRRRGKATENE---HLSQSPATNKDNS--------PSKRL 187
           KP LF W++LTFPL+L E +    G++ +++    LS + +   +N+         +++L
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 188 NVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNI-L 246
             ++  +EDD+  GE M LQ+D +KGSLL  + +  +       GK  ++  S +S++  
Sbjct: 111 QNLDSVLEDDMKGGE-MILQRDTVKGSLLNAS-NLYKVPGAAGSGKNNSAVKSMSSSVAF 168

Query: 247 GTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFA 306
           GTK MGRF FPKKLIPRSIL+S +KK LV+DLDETLIHS+SR  ++SN++QAH++EV+F 
Sbjct: 169 GTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQ 228

Query: 307 ISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMY 366
           ISG+STLYYVHKRPYCDLFLS V KWY+LIIFTASMKEYADPVIDWLESSF G+F++R Y
Sbjct: 229 ISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYY 288

Query: 367 RNHCIARDGVGYIKDLGNIKDPYSKN------ATIPLTDVVIIDNSPVSYAMHVDNAIQV 420
           RNHCI RDGVGYIKDL  I D    +      A   L ++++IDNSPVSYAM+VDNAIQV
Sbjct: 289 RNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQV 348

Query: 421 EGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           EGWISDPTD +           RYTTDVRN+L+LKN E+AF ++
Sbjct: 349 EGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  332 bits (850), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 227/337 (67%), Gaps = 41/337 (12%)

Query: 125 VWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPS 184
           VW ++ F P +++IKP   +WF+LTFPL+LIEH+  + G   E E +     TN   S  
Sbjct: 56  VWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDGSVEEEEVI----PTNSQGSGG 111

Query: 185 KRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSN 244
                  E IEDD + GE M L +D++K                       +S PS + +
Sbjct: 112 G------EVIEDDDLVGESMVLHEDSIK-----------------------SSRPSTSRS 142

Query: 245 ILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVR 304
              +  +G+F FPKKLIP+SIL +++KK LV+DLDETLIHS+SR T+ SN+SQ H++EV 
Sbjct: 143 SYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVT 202

Query: 305 FAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQR 364
           F++SGVS+LYYVHKRPYCDLFLS+VCKWY+L+IFTASM+EYADPVIDWLES  S  FT+R
Sbjct: 203 FSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKR 262

Query: 365 MYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWI 424
            YR+ CI RDG+GY+KDL  I    SKN    L D +I+DNSPVSYAM+VDNAIQVEGWI
Sbjct: 263 KYRSDCILRDGIGYVKDLTMI----SKN----LQDTIIVDNSPVSYAMNVDNAIQVEGWI 314

Query: 425 SDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAF 461
           SDPTDT            R+TTD RN+L+LKN E AF
Sbjct: 315 SDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  328 bits (842), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 214/326 (65%), Gaps = 49/326 (15%)

Query: 136 ILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIEEAIE 195
           I +KP   +WF++T PL LIE+ ++ + K                 S S++  +I +   
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKV---------------ESTSRKGEIIRKKEV 103

Query: 196 DDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQ 255
           DD ++ + M LQ+D +KG L               RGK             GTK MGRF 
Sbjct: 104 DDDLAEDEMFLQRDTVKGGL---------------RGKA-----------FGTKKMGRFL 137

Query: 256 FPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYY 315
           FPKKL+P+SIL++E+KK LV+DLDETLIHS +R  +HSNS+Q H++EVRF  S +STLYY
Sbjct: 138 FPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYY 197

Query: 316 VHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDG 375
           VHKRP+CDLFLSKV KWY+LIIFTASMKEYADPVIDWLESSF+G F +R+YR++C+ R+G
Sbjct: 198 VHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREG 257

Query: 376 VGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTEXXXX 435
           VGYIKDL  +        T  L +VV+IDNSP SYA + DNAIQVEGWISDP+DT+    
Sbjct: 258 VGYIKDLSVV--------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNL 309

Query: 436 XXXXXXXRYTTDVRNVLALKNSEKAF 461
                  RY TDVR++L LKN EKA 
Sbjct: 310 LPLLEALRYVTDVRSILGLKNGEKAL 335

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  325 bits (832), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 230/358 (64%), Gaps = 50/358 (13%)

Query: 136 ILIKPTLFVWFILTFPLSLIEHSVRRRGKATE---NEHLSQSPATNKDNSPSKRLNVIEE 192
           ILIKP +F+W+I TFPL LIE    R+ K T    +  ++ S AT+ D            
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDLD------------ 104

Query: 193 AIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTP------------- 239
               DL S + + LQ D++KGSLL   K++S  ++       T+ +P             
Sbjct: 105 ----DLNSNDEIILQTDSIKGSLL-EKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSV 159

Query: 240 -SHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQA 298
            S TSN +G+K+MGRF FPKKLIP SIL + K+K L++DLDETLIHS+SR  + S  S  
Sbjct: 160 YSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNY 219

Query: 299 HIIEVRFAISG------------VSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYA 346
           H+IEV+F                +S+LYYV+KRPYCD FL+ V  WY+LIIFTASMKEYA
Sbjct: 220 HLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYA 279

Query: 347 DPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNS 406
           DPVIDWLE SF+G+F +R+YRNHCI RDG+GYIKDL  +    + N +  L ++++IDNS
Sbjct: 280 DPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLN---TDNQST-LNELILIDNS 335

Query: 407 PVSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAFQLS 464
           P+S+AM+VDNAIQV+GWISDPTDTE           R+TTDVRN+LALKN E+AF  +
Sbjct: 336 PISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAFHFA 393

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  317 bits (813), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/340 (51%), Positives = 227/340 (66%), Gaps = 50/340 (14%)

Query: 125 VWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPS 184
           VW ++ F P ++++KP + VWF+LTFPLSLIE                Q+ +   D +P 
Sbjct: 50  VWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIE----------------QTSSKEADGAPG 93

Query: 185 ---KRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSH 241
                   + EA+EDD ++GE M LQ+D++K                       +S PS 
Sbjct: 94  PEAAEEEQLAEAVEDDDLAGESMVLQEDSVK-----------------------SSRPST 130

Query: 242 TSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHII 301
           + +   +  +G+F FPKKLIP+SIL +++KK LV+DLDETLIHS+SR T+  ++SQ H++
Sbjct: 131 SRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMV 190

Query: 302 EVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSF 361
           EV FA SGVSTLYYVHKRPYCDLFLS+V KWY+L+IFTASMKEYADPVIDWLES  S  F
Sbjct: 191 EVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRF 250

Query: 362 TQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVE 421
           +QR YR+ C+ RDGVGY+KDL  I    SKN    L D++I+DNSP+SYAM+VDNAIQVE
Sbjct: 251 SQRRYRSDCLLRDGVGYVKDLSII----SKN----LQDIIIVDNSPISYAMNVDNAIQVE 302

Query: 422 GWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAF 461
           GWISDPTDT            R+TTD RN+L+LKN E+AF
Sbjct: 303 GWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  263 bits (671), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 206/354 (58%), Gaps = 52/354 (14%)

Query: 117 RGLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPA 176
           R   F   +W I+ F PNY+LIKP + +W+++TFPL+L+E + +       N+ L Q   
Sbjct: 62  RNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ------GNKGLIQ--V 113

Query: 177 TNKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTT 236
            ++ +S +++L+  +  +E+DL   + + + +D +K   +                    
Sbjct: 114 GSETDSRTEKLS--KYVVEEDLSPTDEIIINQDKMKPRPI-------------------- 151

Query: 237 STPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSS 296
                      T+ +G+F FPKKL+P+S+L S  +K LV+DLDETLIHS+S   +  N +
Sbjct: 152 -----------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPT 200

Query: 297 ---------QAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYAD 347
                      H++EVRF  + +STLY V KRPYCD+FL +  +WY++ IFTASMKEYAD
Sbjct: 201 DKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYAD 260

Query: 348 PVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSP 407
           PVIDWL+ + S  F  R YR  C  R GVGY+KD+G +      +    L+ ++IIDNSP
Sbjct: 261 PVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRD--LSQMIIIDNSP 318

Query: 408 VSYAMHVDNAIQVEGWISDPTDTEXXXXXXXXXXXRYTTDVRNVLALKNSEKAF 461
           +SYAMH+DNAIQV GWI+DP+D+E           R+ TD R +LALK+   + 
Sbjct: 319 ISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASI 372

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  110 bits (274), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (57%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P  +   ++KK L++DLDETL+HS S    H+ +     +E+   +  V    YV KR
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHS-SFKYMHT-ADFVLPVEIDDQVHNV----YVIKR 264

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FLS+VC+ Y +++FTAS+  YA+P++D L+   +G+   R++R  C   +G  YI
Sbjct: 265 PGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL++ +I+DNSP SY  H  +A+ +  W SD  D E
Sbjct: 322 KNLSQIGR--------PLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 365

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  110 bits (274), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 95/172 (55%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P      E KK LV+DLDETL+HS  +    ++      +E+   +  V    YV KR
Sbjct: 218 LLPPKDPVFEGKKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKR 271

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V K Y +++FTAS+  Y DP++D L+    G+   R++R+ C   DG  YI
Sbjct: 272 PGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYI 328

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L+D++I+DNSP SY +H  +AI +  W SD  D E
Sbjct: 329 KNLSQIGRP--------LSDLIILDNSPASYILHPQHAIPISSWFSDAHDNE 372

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 98/172 (56%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P  +   ++KK L++DLDETL+HS S    HS +     +E+   +  V    YV KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHS-SFKYMHS-ADFVLPVEIDDQVHNV----YVIKR 269

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL++V + Y +++FTAS+  YA+P++D L+   +G+   R++R  C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 326

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL++ +I+DNSP SY  H  +A+ +  W SD  D E
Sbjct: 327 KNLSQIGR--------PLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 370

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 95/176 (53%), Gaps = 18/176 (10%)

Query: 256 FPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYY 315
           F   L PR   +S  KK LV+DLDETL+HS  +    ++      +E+   I  V    Y
Sbjct: 214 FKTLLSPRKPEFS-NKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----Y 266

Query: 316 VHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDG 375
           V KRP  D FL +V + Y +++FTAS+  Y DP+++ L+ S   S   R++R  C   +G
Sbjct: 267 VIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG 324

Query: 376 VGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
             YIK+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 325 -NYIKNLAQIGRP--------LSDIIILDNSPASYMFHPQHAIPISSWFSDTHDNE 371

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 25/165 (15%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRF----AISGVSTLYYVHKRPYCDLFL 326
           KK LV+DLDETL+HS          S  +I    F     I   +   YV KRP  D FL
Sbjct: 307 KKCLVLDLDETLVHS----------SFKYIDTADFVLPVTIDDQTHQVYVIKRPGVDEFL 356

Query: 327 SKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIK 386
            +V K + +++FTAS+  Y DP++D L+S  S S   R++R  C   DG  Y+K+L  I 
Sbjct: 357 KRVGKIFEVVVFTASVSRYGDPLLDILDS--SKSIHHRLFRESCYIYDG-NYVKNLSQIG 413

Query: 387 DPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                    PL+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 414 R--------PLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 450

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score =  105 bits (261), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 95/174 (54%), Gaps = 17/174 (9%)

Query: 258 KKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVH 317
           + L+P        KK LV+DLDETL+HS S    H+ +     +++   I  V    YV 
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHS-SFKYLHT-ADFVLPVDIDDQIHNV----YVI 261

Query: 318 KRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVG 377
           KRP  D FL +V + Y +++FTAS+  Y DP++D L+S  S S   R++R  C   +G  
Sbjct: 262 KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDS--SNSIHHRLFREACYNYEG-N 318

Query: 378 YIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           Y+K+L  I          PL+++VI+DNSP SY  H  +AI +  W SD  D E
Sbjct: 319 YVKNLAQIGR--------PLSEIVILDNSPASYMFHPQHAIPISSWFSDTHDNE 364

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  104 bits (259), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P  +   ++KK L++DLDETL+HS  +    ++      +E+   +  V    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V + Y +++FTAS+  YA+P++D L+   +G+   R++R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDP--NGTIHHRLFREACYNYEG-NYI 321

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL++ +I+DNSP SY  H  +A+ +  W SD  D E
Sbjct: 322 KNLSQIGR--------PLSETIILDNSPASYIFHPQHAVPISSWFSDSHDNE 365

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 93/172 (54%), Gaps = 15/172 (8%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P      + KK L++DLDETL+HS  +   + +     I+ +      +  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V KWY ++IFTAS+  YA+P++D L+   +     R++R+ C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHN-LINHRLFRDACYNYEN-NFI 413

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 414 KNLSQI--------GRPLHDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 457

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 97/172 (56%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P  +L  ++KK L++DLDETL+HS S    H+ +     +E+   +  V    YV KR
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHS-SFKYLHT-ADFVLPVEIDDQVHNV----YVIKR 257

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V + Y +++FTAS+  YA+P++D L+   + +   R++R  C   +G  YI
Sbjct: 258 PGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP--NRTIHHRLFREACYNYEG-NYI 314

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL++ +I+DNSP SY  H  +A+ +  W SD  D E
Sbjct: 315 KNLSQIGR--------PLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 358

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 94/172 (54%), Gaps = 16/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L P+  +  + KK LV+DLDETL+HS  +   +++ +    + +   I  V    YV KR
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLPNADFNLP--VNIDDQIHNV----YVIKR 385

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL KV K + ++IFTAS+  Y DP++D L+     S   R++R  C   +G  YI
Sbjct: 386 PGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK-GKSIHHRLFREACYNYEG-NYI 443

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  +          PL++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 444 KNLSQMGR--------PLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNE 487

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 98/182 (53%), Gaps = 19/182 (10%)

Query: 252 GRFQFP--KKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISG 309
           G++  P  K L+P     ++ KK L++DLDETL+HS  +    ++      +E+   +  
Sbjct: 223 GQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHN 280

Query: 310 VSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNH 369
           V    YV KRP  + FL +V K + +++FTAS+  Y DP++D L++        R++R  
Sbjct: 281 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD--KVIHHRLFREA 334

Query: 370 CIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
           C   +G  YIK+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D
Sbjct: 335 CYNYEG-NYIKNLSQIGRP--------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 385

Query: 430 TE 431
            E
Sbjct: 386 NE 387

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score =  102 bits (254), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 20/173 (11%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI-IEVRFAISGVSTLYYVHK 318
           L+P++ ++ + KK LV+DLDETL+HS  +   +  ++   I +E+   +  V    YV K
Sbjct: 234 LLPKADMF-KGKKCLVLDLDETLVHSSFK---YLRTADFVIPVEIDNQVHNV----YVIK 285

Query: 319 RPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGY 378
           RP  D FL ++ + Y +++FTAS+  Y DP++D L+     +   R++R+ C   +G  Y
Sbjct: 286 RPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NY 342

Query: 379 IKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           IK+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 343 IKNLSQIGRP--------LSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNE 387

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 98/182 (53%), Gaps = 19/182 (10%)

Query: 252 GRFQFP--KKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISG 309
           G++  P    L+P     ++ KK L++DLDETL+HS  +    ++   +  +E+   +  
Sbjct: 236 GQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQVHN 293

Query: 310 VSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNH 369
           V    YV KRP  + FL +V K + +++FTAS+  Y DP++D L++        R++R  
Sbjct: 294 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREA 347

Query: 370 CIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
           C   +G  YIK+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D
Sbjct: 348 CYNYEG-NYIKNLSQIGRP--------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHD 398

Query: 430 TE 431
            E
Sbjct: 399 NE 400

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 112/215 (52%), Gaps = 23/215 (10%)

Query: 219 NKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFP--KKLIPRSILYSEKKKTLVI 276
           N++   + S  D  +   ST S++S         +F  P    L+P      + +K LV+
Sbjct: 130 NEELQDHQSTADSVQDNFSTISYSS-----LQKNQFHAPGCNTLLPPIQQSLQNRKCLVL 184

Query: 277 DLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLI 336
           DLDETL+HS  +  + ++      I+ +F         YV KRP  D FL    K + ++
Sbjct: 185 DLDETLVHSSFKYVSTADFVLPVDIDDQFQN------VYVIKRPGVDAFLQYTSKLFEVV 238

Query: 337 IFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIP 396
           IFTAS+++Y +P++D L+S+ +     R++R+ C   +G  YIK+L  +  P        
Sbjct: 239 IFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYIKNLAQLGRP-------- 288

Query: 397 LTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           L+D++I+DNSP SY  H ++AI +  W SD  D E
Sbjct: 289 LSDIIILDNSPTSYLFHPNHAIPISSWFSDAHDNE 323

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 88/163 (53%), Gaps = 21/163 (12%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLY--YVHKRPYCDLFLSK 328
           KK LV+DLDETL+HS  +          H  +    +     ++  YV KRP  D FL +
Sbjct: 277 KKCLVLDLDETLVHSSFK--------YLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQR 328

Query: 329 VCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDP 388
           V + Y +++FTAS+  Y DP++D L+   S +   R++R+ C   +G  YIK+L  I   
Sbjct: 329 VGELYEVVVFTASVSRYGDPLLDVLDK--SNNIHHRLFRDACYTYEG-NYIKNLSQI--- 382

Query: 389 YSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                  PL++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 383 -----GRPLSEIIILDNSPPSYIFHPQHAIPISSWFSDSHDNE 420

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 88/161 (54%), Gaps = 17/161 (10%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVC 330
           KK LV+DLDETL+HS  +    ++      +E+   I  V    YV KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 331 KWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS 390
           + Y +++FTAS+  Y DP++D L+ +       R++R+ C   DG  YIK+L  I  P  
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQIGRP-- 348

Query: 391 KNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                 L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 349 ------LSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNE 383

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 94/172 (54%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P     ++ KK L++DLDETL+HS  +    ++      +E+   +  V    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  + FL +V K + +++FTAS+  Y DP++D L+++       R++R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 345 KNLSQIGRP--------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 388

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score =  100 bits (248), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 90/172 (52%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P        KK LV+DLDETL+HS  +    ++     +I V   I       YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTAD----FVIPVE--IDNQVHNVYVIKR 281

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL  V + Y +++FTAS+  Y DP++D L+ +       R++R+ C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYI 338

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 339 KNLSQIGRP--------LSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNE 382

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 91/172 (52%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P    +   KK LV+DLDETL+HS  +    ++      +++   I  V    YV KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADF--VLPVDIDDQIHNV----YVMKR 354

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL KV   + ++IFTAS+  Y DP++D L+     S   R++R  C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYEG-NYI 411

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 412 KNLSQIGRP--------LSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 455

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  100 bits (250), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 92/172 (53%), Gaps = 16/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L P+ I    +KK L++DLDETL+HS  +       S   +I V   I   +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYV----DSADFVIPV--TIDNQTHHVYVIKR 365

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V + Y +++FTAS+  Y DP+++ L+ + +     R++R  C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPA-NTIIHHRLFRESCYTYEG-NYV 423

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  +  P        L +++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 424 KNLSQLGRP--------LNEIIILDNSPASYIFHPQHAIPISSWFSDIHDNE 467

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 93/172 (54%), Gaps = 18/172 (10%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L PR+  ++  KK LV+DLDETL+HS  +    ++      +++   I  V    YV KR
Sbjct: 273 LPPRAPAFN-GKKCLVLDLDETLVHSSFKYLRTADFVLP--VDIDDQIHNV----YVIKR 325

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V   Y +++FTAS+  Y DP++D L+     +   R++R  C   +G  YI
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYEG-NYI 382

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 383 KNLSQIGRP--------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 426

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score =  100 bits (250), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 97/184 (52%), Gaps = 25/184 (13%)

Query: 250 SMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRF--AI 307
           +MG   F   L P++ ++S  KK L++DLDETL+HS  +  T    S   +I V     I
Sbjct: 501 AMG---FNTLLPPQNQIFS-GKKCLILDLDETLVHSSFKYLT----SADFVIPVDIDEQI 552

Query: 308 SGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYR 367
             V    YV KRP  D FL  V K + +++FTAS+  Y DP++D L+         R++R
Sbjct: 553 HNV----YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKH--RCIHHRLFR 606

Query: 368 NHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDP 427
             C   +G  YIK+L  I  P        L++++I+DNSP SY  H  +AI +  W SD 
Sbjct: 607 EACYDYEG-NYIKNLSQIGRP--------LSELIILDNSPASYIFHPQHAIPISSWFSDT 657

Query: 428 TDTE 431
            D E
Sbjct: 658 HDNE 661

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score =  100 bits (248), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 89/162 (54%), Gaps = 17/162 (10%)

Query: 270 KKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKV 329
           +KK LV+DLDETL+HS  +    ++      +++   I  V    YV KRP  D FL +V
Sbjct: 312 RKKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKRPGVDEFLKRV 365

Query: 330 CKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPY 389
            + + +++FTAS+  Y DP++D L+     S   R++R  C   +G  YIK+L  +  P 
Sbjct: 366 GEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NYIKNLSQLGRP- 421

Query: 390 SKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                  L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 422 -------LSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 456

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 91/172 (52%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P        +K LV+DLDETL+HS  +    ++      +++   I  V    YV KR
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLP--VDIDDQIHNV----YVIKR 353

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V K Y +++FTAS+  Y DP++D L+     S   R++R  C   +G  YI
Sbjct: 354 PGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDK--DKSIHHRLFREACYNYEG-NYI 410

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I          PL++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 411 KNLSQIGR--------PLSNIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 454

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 96/175 (54%), Gaps = 19/175 (10%)

Query: 258 KKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI-IEVRFAISGVSTLYYV 316
           + L+P       ++K LV+DLDETL+HS  +   + +++   I +E+   +  V    YV
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YV 361

Query: 317 HKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGV 376
            KRP  D FL +V + Y +++FTAS+  Y DP++D L+         R++R+ C   +G 
Sbjct: 362 IKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKH--NVVHHRLFRDSCYNYEG- 418

Query: 377 GYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
            YIK+L  I  P        L+D++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 419 NYIKNLSQIGRP--------LSDLIILDNSPASYIFHPHHAIPISSWFSDAHDNE 465

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 91/172 (52%), Gaps = 17/172 (9%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKR 319
           L+P      + KK LV+DLDETL+HS  +    ++      + +   +  V    YV KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLP--VNIDDQVHNV----YVIKR 282

Query: 320 PYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYI 379
           P  D FL +V + Y +++FTAS+  Y DP++D L+     S   R++R  C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYEG-NYI 339

Query: 380 KDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           K+L  I  P        L++++I+DNSP SY  H  +AI V  W SD  D E
Sbjct: 340 KNLSQIGRP--------LSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNE 383

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 88/161 (54%), Gaps = 17/161 (10%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVC 330
           KK L++DLDETL+HS  +    ++      +E+   +  V    YV KRP  + FL +V 
Sbjct: 245 KKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKRPGVEEFLERVG 298

Query: 331 KWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS 390
           K + +++FTAS+  Y DP++D L++        R++R  C   +G  YIK+L  I  P  
Sbjct: 299 KLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREACYNYEG-NYIKNLSQIGRP-- 353

Query: 391 KNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                 L++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 354 ------LSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 388

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 95/173 (54%), Gaps = 19/173 (10%)

Query: 260 LIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI-IEVRFAISGVSTLYYVHK 318
           L+P        +K LV+DLDETL+HS  +   + +++   I +E+   +  V    YV K
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YVIK 349

Query: 319 RPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGY 378
           RP  D FL +V + + +++FTAS+  Y DP++D L+     +   R++R+ C   +G  Y
Sbjct: 350 RPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQY--KAVHHRLFRDSCYNYEG-NY 406

Query: 379 IKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
           IK+L  I  P        L+D++I+DNSP SY  H  +A+ +  W SD  D E
Sbjct: 407 IKNLSQIGRP--------LSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNE 451

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 17/161 (10%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVC 330
           +K LV+DLDETL+HS  +    ++      +++   +  V    YV KRP  D FL  V 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADFVLP--VDIDNQVQNV----YVSKRPGVDEFLKIVG 335

Query: 331 KWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS 390
             Y +I+FTAS+  Y +P++D L+         R++R+ C   +G  Y+K+L  I  P  
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILDPH--KYIHHRLFRDSCYVYEG-NYVKNLSQIGRP-- 390

Query: 391 KNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                 L D++I+DNSP SY  H  +AI +  W SD  D+E
Sbjct: 391 ------LGDIIILDNSPASYIFHPQHAIPISSWFSDSHDSE 425

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 86/161 (53%), Gaps = 16/161 (9%)

Query: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVC 330
           KK LV+DLDETL+HS  +    ++      + +   I  V    YV KRP  + FL +V 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQTADFVLP--VNIDEQIHNV----YVIKRPGVEEFLKRVG 355

Query: 331 KWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYS 390
           + + +++FTAS+  Y DP++D L+         R++R  C   +G  YIK+L  +  P  
Sbjct: 356 ELFEVVVFTASVARYGDPLLDILDPG-RQLIHHRLFREACYNYEG-NYIKNLSQMGRP-- 411

Query: 391 KNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTE 431
                 L++++I+DNSP SY  H  +AI +  W SD  D E
Sbjct: 412 ------LSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNE 446

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 77/157 (49%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ H         G  T     KRP  D FL  + ++
Sbjct: 193 TLVITLEDFLVHS--------EWSQKH---------GWRTA----KRPGADYFLGYLSQY 231

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y+D + + L+       +  +++ HC+ +DGV +IKDL  +    SK 
Sbjct: 232 YEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV-HIKDLSKLNRDLSK- 288

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  V+IID  P SY +  +NAI +E W  +  D
Sbjct: 289 -------VIIIDTDPNSYKLQPENAIPMEPWNGEADD 318

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ +         G  T     KRP CD FL  + ++
Sbjct: 184 TLVITLEDFLVHS--------EWSQKY---------GWRT----AKRPGCDYFLGYLSQY 222

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   YA+ + + L+       +  +++ HC+ +DGV +IKD+  +     K 
Sbjct: 223 YEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDISKLNRDLGK- 279

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  VV ID  P +Y +  +NAI ++ W  +  D
Sbjct: 280 -------VVTIDTDPNTYKLQPENAIPMDPWTGEADD 309

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 73/151 (48%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ LIHS          SQ +         G  T     KRP  D FL  + ++
Sbjct: 192 TLVLTLEDFLIHS--------EWSQQY---------GWRT----AKRPGADYFLGYLSQY 230

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   YA+ V + ++       T  +Y+ HC+ +DGV +IKDL  +     K 
Sbjct: 231 YEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV-HIKDLSKLNRDLGK- 287

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                   +IID  P SY +  +NAI V+ W
Sbjct: 288 -------TMIIDTDPNSYKLQPENAIPVKPW 311

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ +         G  T     KRP  D FL  + ++
Sbjct: 193 TLVITLEDFLVHS--------EWSQKY---------GWRTA----KRPGADYFLGYLSQY 231

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           + +++F+++   Y+D + + L+       +  +++ HC+ +DGV +IKDL  +    SK 
Sbjct: 232 FEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV-HIKDLSKLNRDLSK- 288

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  V+IID  P SY +  +NAI ++ W  +  D
Sbjct: 289 -------VIIIDTEPNSYKLQPENAIPMDPWNGEADD 318

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ +         G  T     KRP  D FL  + ++
Sbjct: 198 TLVITLEDFLVHS--------EWSQKY---------GWRT----AKRPGADYFLGYLSQY 236

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           + +++F+++   Y++ + + L+       +  +++ HC+ +DGV +IKDL  +    SK 
Sbjct: 237 FEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV-HIKDLSKLNRDLSK- 293

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  V+IID  P SY +  +NAI +E W  +  D
Sbjct: 294 -------VIIIDTDPNSYKLQPENAIPMEPWNGEADD 323

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ +              +   KRP  + FL  + ++
Sbjct: 196 TLVITLEDFLVHS--------EWSQKYG-------------WRTAKRPGAEYFLGYLSQY 234

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y++   + L+       +  +++ HC+ +DGV +IKDL  +K   SK 
Sbjct: 235 YEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYKDGV-HIKDLSKLKRDLSK- 291

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  V+IID  P SY +  +NAI ++ W  +  D
Sbjct: 292 -------VIIIDTDPNSYKLQPENAIPMDPWNGEADD 321

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 58/112 (51%), Gaps = 10/112 (8%)

Query: 318 KRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVG 377
           KRP CD FL  + ++Y +++F+++   Y+D + + L+       +  +++ HC+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 378 YIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
           +IKD+  +     K        VV+ID  P  Y    +NAI  + W   P D
Sbjct: 279 HIKDISKMNRDVGK--------VVMIDTDPNCYKSQPENAIPAKPWDGTPDD 322

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS          SQ +         G  T     KRP  D FL  + ++
Sbjct: 212 TLVLTLEDLLVHS--------EWSQKY---------GWRT----AKRPGVDYFLGYLSQY 250

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y + + + L+       +  +++ HC+ +DGV +IKDL  +    +K 
Sbjct: 251 YEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV-HIKDLSKLNRDVNK- 307

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  V+IID  P +Y +  +NAI +E W  +  D
Sbjct: 308 -------VLIIDTDPNNYKLQPENAIPMEPWKGEADD 337

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 74/151 (49%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS          SQ H         G  T     KRP  D FL  + ++
Sbjct: 197 TLVLTLEDLLVHS--------EWSQKH---------GWRTA----KRPGVDYFLGYLSQY 235

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y+D + + L+       +  +++ HC+ +DGV +IKDL  +     K 
Sbjct: 236 YEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV-HIKDLSKLNRDEKK- 292

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+IID  P SY +  +NAI ++ W
Sbjct: 293 -------VLIIDVDPNSYKLQPENAIPMKPW 316

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS    T  S                    +   KRP  D FL  + ++
Sbjct: 196 TLVLSLEDLLVHS--EWTQQSG-------------------WRTAKRPGVDYFLGYLSQY 234

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   YA+ + + L+       T  +++ HC+ +DGV +IKDL  +     K 
Sbjct: 235 YEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV-HIKDLSKLNRDLGK- 291

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+IID    S+ +  +NAI +E W
Sbjct: 292 -------VLIIDTDENSFKLQPENAIYLEPW 315

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 74/151 (49%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS          SQ +         G  T     KRP  D FL  + ++
Sbjct: 204 TLVITLEDFLVHS--------EWSQKY---------GWRT----AKRPGVDYFLGYLSQY 242

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y + + + L+       +  +++ HC+ +DGV +IKDL  +    +K 
Sbjct: 243 YEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV-HIKDLSKLNRDVNK- 299

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+IID  P +Y +  +NAI V+ W
Sbjct: 300 -------VLIIDTEPNNYKLQPENAIPVKPW 323

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 10/106 (9%)

Query: 318 KRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVG 377
           KRP  D FL  + ++Y +++F+++   Y+D V + L+       T  +++ HC+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 378 YIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
           +IKDL  +     K         VIID  P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKLNRDLGK--------TVIIDCDPNAYKLQPENAIPMKPW 307

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 71/151 (47%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS     T  N                   +   KRP  D FL  + ++
Sbjct: 202 TLVVSLEDLLVHS---EWTQKNG------------------WRTAKRPGVDYFLGYLSQY 240

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y++ + + L+       +  +Y+ HC+ ++G  +IKDL  +     K 
Sbjct: 241 YEVVLFSSNYMMYSEKIAEKLDP-IHAFISYNLYKEHCVYKEG-DHIKDLSKLNRDLGK- 297

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+I+D  P SY +  +NAI ++ W
Sbjct: 298 -------VIIVDTDPASYKLQPENAIPMQPW 321

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 72/151 (47%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLVI L++ L+HS           Q H         G  T     KRP  D FL  + ++
Sbjct: 199 TLVITLEDFLVHS--------EWDQKH---------GWRTA----KRPGADYFLGYLSQY 237

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   YA+ + + ++       +  +++ HC+ +DGV +IKDL  +       
Sbjct: 238 YEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV-HIKDLSKL------- 288

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
               L  V+IID    SY +  +NAI ++ W
Sbjct: 289 -NRDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 72/151 (47%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS          ++ H         G  T     KRP  D FL  + ++
Sbjct: 189 TLVLSLEDLLVHS--------EWTKEH---------GWRTA----KRPGVDYFLGYLSQY 227

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y+D V + L+       T  +++ HC+ +DGV +IKDL  +     K 
Sbjct: 228 YEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV-HIKDLSKLNRDLGK- 284

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                   +I+D  P +Y +  +NAI +  W
Sbjct: 285 -------TIIVDCDPNAYKLQPENAIPMRPW 308

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS           Q H         G  T     KRP  D FL  + ++
Sbjct: 193 TLVLTLEDFLVHS--------EWDQKH---------GWRTA----KRPGTDYFLGYLSQY 231

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y++ + + L+       +  +Y+ HC+ ++G  +IKDL  +     K 
Sbjct: 232 YEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT-HIKDLSKLNRDLDK- 288

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+IID  P +Y    +NAI V+ W
Sbjct: 289 -------VLIIDCDPNNYKFQPENAIPVKPW 312

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 10/106 (9%)

Query: 318 KRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVG 377
           KRP  D FL  + ++Y +++F+++   +++ + + L+       T  +++ HC+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 378 YIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
           +IKDL ++     K         +IID    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHLNRDLGK--------TIIIDTDANAFKLQPENAIHAEPW 322

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 72/157 (45%), Gaps = 31/157 (19%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS          SQ              T +   KRP  D FL  + ++
Sbjct: 187 TLVLTLEDLLVHS--------EWSQ-------------KTGWRTAKRPGVDYFLGYLSQY 225

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y++ + + L+       +  +++ HC+ +D V +IKDL  +     K 
Sbjct: 226 YEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV-HIKDLSKLNRDVRK- 282

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTD 429
                  VVI+D    SY +  +NA+ +  W   P D
Sbjct: 283 -------VVIMDTDANSYKLQPENALPMAPWDGKPDD 312

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 10/105 (9%)

Query: 319 RPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGY 378
           RP  D  L  +  +Y  ++F ++   Y+  V++ L+       T  ++++HC+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDP-IRAFITYNLFKDHCVYKDGI-H 274

Query: 379 IKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
           IKDL ++     K         +IID  P S  + ++NAI  E W
Sbjct: 275 IKDLSHLNRDLGK--------TLIIDTDPNSVKLQMENAILAEPW 311

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 70/151 (46%), Gaps = 31/151 (20%)

Query: 273 TLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKW 332
           TLV+ L++ L+HS     T  N                   +   KRP  D FL  + ++
Sbjct: 167 TLVLSLEDLLVHS---EWTQKNG------------------WRTAKRPGVDYFLGYLSQY 205

Query: 333 YNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN 392
           Y +++F+++   Y++ + + L+       +  +++ HC+ + G  +IKDL  +    +K 
Sbjct: 206 YEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-KHIKDLSKLNRDVNK- 262

Query: 393 ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGW 423
                  V+IID    +Y +  +NAI ++ W
Sbjct: 263 -------VIIIDTDKNNYKLQPENAIPMKPW 286

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 119/326 (36%), Gaps = 77/326 (23%)

Query: 118 GLKFFIVVWSIITFFPNYILIKPTLFV---WFILTFPLSLIEHSVRRRGKATENEHLSQS 174
           GL + I V  ++    +Y+     LF    W+++    S  ++ +   G   E       
Sbjct: 10  GLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPEIEK------ 63

Query: 175 PATNKDNSPSKR-----LNVIEEAIEDDLISGEVMELQKDALKGSLL-------PTNKDS 222
                    SKR     +   E   E DL+S  V E  KD + G  +       P N D 
Sbjct: 64  ---------SKRKVRESIEFYEAPFEGDLLSWNVDE--KDEIAGPNMAVCEIKRPCNHDI 112

Query: 223 SQNSSQKDRGKKTTS--------TPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTL 274
                    GK+           T SHT   L           K++  R  L +EKK  L
Sbjct: 113 VYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTR--LKNEKKLVL 170

Query: 275 VIDLDETLIHSVSRGTTH------SNSSQAHIIEVR-FAISGVSTL-------------- 313
           V+DLD+T+IH     T        SN +   + +V+ F++     L              
Sbjct: 171 VVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTC 230

Query: 314 -YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYA---DPVIDWLESSFS---------GS 360
            YYV  RP    F  K+   Y + I+T + + YA     +ID  +S F          GS
Sbjct: 231 WYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 290

Query: 361 FTQR-MYRNHCIARDGVGYIKDLGNI 385
            TQ+ + R     +  V  I D G++
Sbjct: 291 LTQKSLTRLFPTDQSMVVVIDDRGDV 316

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 28/139 (20%)

Query: 263 RSILYSEKKKTLVIDLDETLIHSVSRGTTH------SNSSQAHIIEVR-FAISGVSTL-- 313
           +S L   KK  LV+DLD+T+IH     T        SN +   +  V+ F +   + L  
Sbjct: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218

Query: 314 -------------YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360
                        YYV  RP    F  KV   Y + I+T + + YA+ +   ++   S  
Sbjct: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS-- 276

Query: 361 FTQRMYRNHCIARDGVGYI 379
               ++ N  ++RD  G +
Sbjct: 277 ----LFGNRILSRDENGSL 291

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 97/258 (37%), Gaps = 31/258 (12%)

Query: 118 GLKFFIVVWSIITFFPNYILIKPTLFV---WFILTFPLSLIEHSVRR---RGKATENEHL 171
           GL + I +  +IT   + +     L     WF++    S  ++ V      GK +  E +
Sbjct: 10  GLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTAGKKSIRESI 69

Query: 172 SQSPATNKDNSPSKRLNVIEEAIEDDLISGEVME-LQKDALKGSLLPTNKDSSQNSSQKD 230
               +  K    S  +++ +E    + +  E++     D + G L     +         
Sbjct: 70  EFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGEEVDEDDNDA 129

Query: 231 RGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGT 290
            G     T SHT   L  K   R      L  R+ L  EKK  LV+DLD+T+IH     T
Sbjct: 130 SGSGANLTISHTDTNL--KISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVIHCGVDPT 187

Query: 291 THS------NSSQAHIIEVR-FAISGVSTL---------------YYVHKRPYCDLFLSK 328
                    N +   + +V+ F++     L               YYV  RP    FL K
Sbjct: 188 IGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPGLKEFLEK 247

Query: 329 VCKWYNLIIFTASMKEYA 346
           +   + + I+T + + YA
Sbjct: 248 IAPLFEMHIYTMATRAYA 265

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 55/137 (40%), Gaps = 30/137 (21%)

Query: 266 LYSEKKKTLVIDLDETLIHS--------VSRGTTHSNSSQAHIIEVRFAISGVSTL---- 313
           L  +KK  LV+DLD+T+IH           R  T+ N      ++  FA+     L    
Sbjct: 206 LRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTNPNFETLKDVK-EFALEEEPILPLMY 264

Query: 314 -----------YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFT 362
                      YYV  RP    F  KV   + + I+T + + YA  +   ++       T
Sbjct: 265 MGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIYTMATRAYASEIAKIIDP------T 318

Query: 363 QRMYRNHCIARDGVGYI 379
             ++ N  ++RD  G +
Sbjct: 319 GDLFGNRILSRDENGSL 335

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
           RTC1Subunit of the SEA (Seh1-associated) complex, a
           coatomer-related complex that associates dynamically
           with the vacuole; null mutation suppresses cdc13-1
           temperature sensitivity; has N-terminal WD-40 repeats
           and a C-terminal RING motif
          Length = 1341

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 10/62 (16%)

Query: 239 PSHTSNI----LGTKSMGR------FQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSR 288
           P+++SNI    LG  SMG       +   +K IP+ +L SE     ++  DE LI ++ +
Sbjct: 451 PAYSSNIYNSLLGISSMGDEAEVRIYSLARKYIPKHVLLSETPSLGLVWWDENLIFNIDK 510

Query: 289 GT 290
           GT
Sbjct: 511 GT 512

>KLLA0F16709g Chr6 (1539612..1541207) [1596 bp, 531 aa] {ON} some
           similarities with uniprot|O00022 Saccharomyces
           cerevisiae YOR059C Hypothetical ORF
          Length = 531

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 16/81 (19%)

Query: 94  NNKIEIKPVSDE-----DE------EKDIDGQMSRGLKFF---IVVWSIITFFPNYILIK 139
           N+ + I PV+DE     DE      E +ID Q    L ++   ++ W  I  F N I+I 
Sbjct: 253 NSPLFIAPVADEMDSSYDELEELRKENEIDPQDYYFLNYWFSKMLRW--IAVFINLIIIT 310

Query: 140 PTLFVWFILTFPLSLIEHSVR 160
           P  F+WFI++  +   + +VR
Sbjct: 311 PLWFIWFIISGIMETCKSTVR 331

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
           Anc_8.604 YOR195W
          Length = 818

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 380 KDLGNIKDPYSKNATIPLT-DVVIIDNSPVSYAMHVDN--AIQVEGWISDPTDTE 431
           KD G  +D Y++  T+P   D+V + +SP  +++HVDN   I+++  I + T+ E
Sbjct: 175 KDYGEREDSYNEGNTLPKQIDMVDMIDSPNKFSLHVDNMKTIEIQKAIFETTNEE 229

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 239 PSHTSNI----LGTKSMGR------FQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSR 288
           P+++ NI    LG  SMG       +   +K IP+ IL SE     ++  DE LI ++ +
Sbjct: 451 PAYSKNIYNSLLGMSSMGDEAEVRVYSLARKYIPKHILLSETPSLGLVWWDENLIFNIDK 510

Query: 289 GT 290
           GT
Sbjct: 511 GT 512

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
           YOL138C (REAL)
          Length = 1332

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 239 PSHTSNI----LGTKSMGR------FQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSR 288
           P++ +NI    LG  SMG       +   +K IP+ IL SE     ++  DE LI ++ +
Sbjct: 452 PAYNNNIFNSLLGMSSMGDEAEVRIYSLARKYIPKHILLSEAPSLGLVWWDENLIFNIDK 511

Query: 289 GT 290
           GT
Sbjct: 512 GT 513

>TBLA0A10330 Chr1 complement(2544678..2545565) [888 bp, 295 aa] {ON}
           Anc_5.286 YHR046C
          Length = 295

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 66  LKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDI 111
           L L+KV P+I+ K G QK+ + KT    + K++I  V D+  EK I
Sbjct: 15  LALKKVGPIIKSKSGTQKNYNLKT---GSKKVDIVTVIDKQVEKLI 57

>TPHA0J02810 Chr10 (626194..627159) [966 bp, 321 aa] {ON} Anc_5.480
           YDR392W
          Length = 321

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60
           M+ L ++   +V  +    +K NR+EQL+ S+    N+   NQDT      LN K ++  
Sbjct: 219 MDILGFLTFEMVCSLTEAALKINRREQLIQSQK---NKSQVNQDTAFETTVLNRKKRLFD 275

Query: 61  NDDSVLK 67
             D+V++
Sbjct: 276 GPDNVVR 282

>Suva_3.35 Chr3 complement(46009..46860) [852 bp, 283 aa] {ON}
           YCR010C (REAL)
          Length = 283

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 92  VSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITFFPNYILIKPT-----LFVWF 146
           +S   I I      D  KD D  ++  L F+++ W+I TF      +K T     LF   
Sbjct: 160 LSFAAIYIPWFGILDAYKDSDNDLNNALGFYLLGWAIFTFGLAVCTMKSTIMFFALFFLL 219

Query: 147 ILTFPLSLIEHSVRRRG 163
            +TF L  I H V + G
Sbjct: 220 AITFLLLSIGHFVGKVG 236

>ADL136C Chr4 complement(452272..453939) [1668 bp, 555 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR150W
          Length = 555

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 118 GLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRR 161
           G    ++++S   F P  ++I P L+V F L  P  L  H +RR
Sbjct: 224 GTALSLILFSFACFNPMLVIILPMLYVLFGLMIPGYLHRHPLRR 267

>NCAS0A06560 Chr1 complement(1298997..1299887) [891 bp, 296 aa] {ON}
           Anc_5.286
          Length = 296

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 66  LKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQM 115
           L   KV P+I+ K G Q+  D KT    + K++I  V D+  EK I G++
Sbjct: 16  LATNKVGPIIKSKSGTQQTYDLKT---GSRKVDIVTVIDKQVEKLIWGEL 62

>Smik_8.115 Chr8 complement(177032..177919) [888 bp, 295 aa] {ON}
           YHR046C (REAL)
          Length = 295

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 18/80 (22%)

Query: 66  LKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVV 125
           L   KV P+I+ K G QKD D KT    + +++I    D+  EK              ++
Sbjct: 15  LATEKVGPIIKSKSGTQKDYDLKT---GSRRVDIVTAIDKQVEK--------------LI 57

Query: 126 W-SIITFFPNYILIKPTLFV 144
           W S+   +PN+  I    +V
Sbjct: 58  WESVRAQYPNFKFIGEESYV 77

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 84  DRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLKFFIVVWSIITFFPNYIL 137
           DR  K     N++I IKPV+DED    I    ++G+  FI++ + +T    ++ 
Sbjct: 81  DRSGKKSFEINDRIVIKPVNDEDNTSVII-NFNQGISPFIIILTFVTSISGFMF 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,558,172
Number of extensions: 2505226
Number of successful extensions: 13099
Number of sequences better than 10.0: 234
Number of HSP's gapped: 13631
Number of HSP's successfully gapped: 236
Length of query: 464
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 351
Effective length of database: 40,524,141
Effective search space: 14223973491
Effective search space used: 14223973491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)