Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K01881g3.186ON50650623110.0
SAKL0C07964g3.186ON6232205562e-63
KAFR0A012203.186ON6472345442e-61
ZYRO0A04994g3.186ON6082675413e-61
Suva_4.2363.186ON6302645406e-61
Kwal_27.98243.186ON5852415332e-60
YDL013W (SLX5)3.186ON6192195327e-60
Skud_4.2403.186ON6192485231e-58
Smik_4.2213.186ON6192165213e-58
NCAS0I019103.186ON6132185152e-57
NDAI0A065103.186ON7122175192e-57
AER213C3.186ON5572175103e-57
TBLA0F007203.186ON6492465083e-56
TPHA0A043703.186ON6642405041e-55
KLLA0C04411g3.186ON6072164932e-54
KNAG0J012703.186ON5472294841e-53
TDEL0D043503.186ON5562454823e-53
Kpol_1036.523.186ON5912214792e-52
KLTH0E15884g3.186ON5862264755e-52
NCAS0A041202.411ON1137107810.27
KLTH0D14784g4.268ON66324810.31
Kwal_23.41394.268ON66824800.37
AAR049C6.332ON44329780.50
YLR032W (RAD5)2.411ON1169112761.3
KLLA0C08756g6.332ON42729741.5
SAKL0A01474g6.332ON46826741.6
CAGL0J06226g2.83ON50868741.9
KAFR0F028406.332ON44529732.0
Ecym_63311.286ON550119742.0
Skud_12.992.411ON117182732.9
NDAI0I004006.332ON48129722.9
Smik_14.3526.321ON13976684.1
Suva_10.1122.411ON116783705.4
TPHA0I010201.286ON54127689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K01881g
         (506 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   894   0.0  
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   218   2e-63
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   214   2e-61
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   213   3e-61
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   212   6e-61
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   209   2e-60
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   209   7e-60
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   206   1e-58
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   205   3e-58
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   202   2e-57
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   204   2e-57
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   201   3e-57
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   200   3e-56
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   198   1e-55
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   194   2e-54
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   191   1e-53
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   190   3e-53
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   189   2e-52
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   187   5e-52
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    36   0.27 
KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} simi...    36   0.31 
Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {O...    35   0.37 
AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON} S...    35   0.50 
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    34   1.3  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    33   1.5  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    33   1.6  
CAGL0J06226g Chr10 (589288..590814) [1527 bp, 508 aa] {ON} highl...    33   1.9  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   2.0  
Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}...    33   2.0  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    33   2.9  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    32   2.9  
Smik_14.352 Chr14 complement(627777..628196) [420 bp, 139 aa] {O...    31   4.1  
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    32   5.4  
TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.2...    31   9.0  

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/506 (87%), Positives = 443/506 (87%)

Query: 1   MKRDGEEDPVIVLDSDNEEPANSEHEGVRPLPAIVVDEEDNSGAPVEVTSVNAXXXXXXX 60
           MKRDGEEDPVIVLDSDNEEPANSEHEGVRPLPAIVVDEEDNSGAPVEVTSVNA       
Sbjct: 1   MKRDGEEDPVIVLDSDNEEPANSEHEGVRPLPAIVVDEEDNSGAPVEVTSVNADEGGDDD 60

Query: 61  XLTLLRQSNIRVPRRQISTPVAYINLXXXXXXXXXXXXIEFLGGNLVPNAGDNDEDAVTL 120
            LTLLRQSNIRVPRRQISTPVAYINL            IEFLGGNLVPNAGDNDEDAVTL
Sbjct: 61  ELTLLRQSNIRVPRRQISTPVAYINLDDEAAHHDASDDIEFLGGNLVPNAGDNDEDAVTL 120

Query: 121 LEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQNQRVQ 180
           LEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQNQRVQ
Sbjct: 121 LEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQNQRVQ 180

Query: 181 RNYRPVRNDGMFVPESDDSQDDEWETPDLSSGYQXXXXXXXXXXXXXLINDWXXXXXXXX 240
           RNYRPVRNDGMFVPESDDSQDDEWETPDLSSGYQ             LINDW        
Sbjct: 181 RNYRPVRNDGMFVPESDDSQDDEWETPDLSSGYQSSASNYPSRPSSALINDWAIARARNA 240

Query: 241 XXXXXXXMTESRISAALGQLAGLSGSDLVNGYINFPVLPQSMASYMHNHVYGTPITGSED 300
                  MTESRISAALGQLAGLSGSDLVNGYINFPVLPQSMASYMHNHVYGTPITGSED
Sbjct: 241 ARRRTRAMTESRISAALGQLAGLSGSDLVNGYINFPVLPQSMASYMHNHVYGTPITGSED 300

Query: 301 DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVI 360
           DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVI
Sbjct: 301 DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVI 360

Query: 361 RXXXXXXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPY 420
           R               MIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPY
Sbjct: 361 RENDDEDNSNNDDDEDMIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPY 420

Query: 421 QSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDN 480
           QSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDN
Sbjct: 421 QSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDN 480

Query: 481 FAPKVCPADNCKYQIRSKGKMREVYF 506
           FAPKVCPADNCKYQIRSKGKMREVYF
Sbjct: 481 FAPKVCPADNCKYQIRSKGKMREVYF 506

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  218 bits (556), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 105/220 (47%), Positives = 141/220 (64%), Gaps = 11/220 (5%)

Query: 297 GSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFAT 356
           G + DEE +TQ+II++IQ REE E+D R K Y   ++ Q++ F   A+ +P GYSASF T
Sbjct: 405 GQQADEEIETQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDT 464

Query: 357 PEVIRXXXX----------XXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALS 406
              ++                         +  C LCG+ELG+GIP+EF+GI+KED  +S
Sbjct: 465 APKMKIAMTRNGREEEVTVTDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVS 524

Query: 407 FAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAG 466
           F  L+ KYG  CPYQSL +PS  DRDLSKRTYV++CGH FCGRC+ R  NAR+  +    
Sbjct: 525 FESLVAKYGFHCPYQSLARPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKK 584

Query: 467 KSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
           K   ++ GASHPDN+ PK CPA+ C  Q+RSKG+M+EV+F
Sbjct: 585 KLAGLQ-GASHPDNYGPKTCPAEGCSMQLRSKGRMKEVFF 623

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 111 GDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
           G +  D + +LEER       LNLPGG  + ++    + PVR SF+
Sbjct: 150 GSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQ 195

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  214 bits (544), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 148/234 (63%), Gaps = 20/234 (8%)

Query: 285 YMHNHVYGTPITGSEDDEEAQ-TQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEA 343
           YM  H       G  +DEEAQ TQ+II++IQ+REE E D R K +   ++SQ++  +++A
Sbjct: 422 YMGEH-------GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKA 474

Query: 344 KQLPPGYSASF-ATPEVIRXXXXXXXXXXXXXXXMI----------VCNLCGVELGIGIP 392
           + LP GYSA+F +TP+ +                 +          +C LCG ELGIGIP
Sbjct: 475 RNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIP 534

Query: 393 EEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWR 452
           ++F GI +ED  LSF  L+ KY S CPYQSL KPSE+DR LSKRT+V+ CGHL+CGRC  
Sbjct: 535 DDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVA 594

Query: 453 RYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
           R  NA+   + K  K L   +G+SHP+N+ PK CPADNCK  +RS+GK+ EVYF
Sbjct: 595 RISNAKENSR-KPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%)

Query: 109 NAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
           N G+N++D + ++EER     V LNLPGG  + +NA++ + P   SFE
Sbjct: 141 NNGNNEDDGLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFE 188

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  213 bits (541), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 158/267 (59%), Gaps = 23/267 (8%)

Query: 252 RISAALGQLAGLSGSDLVNGYI--NFPVLPQSMASYMHNHVYGTPITGSEDDEEAQTQSI 309
           RI   +G   G  G  L N YI  N   +  + A++++N   G      + DEE  TQSI
Sbjct: 353 RIHMGVG---GGFGESLAN-YILMNANGMGSNDAAWLYNGYVG------DMDEEESTQSI 402

Query: 310 IDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVIR-------- 361
           + +IQ+REE E D R K+Y  K++ Q++ + + A +LP GYSASF T   I+        
Sbjct: 403 VSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGK 462

Query: 362 --XXXXXXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCP 419
                            + VC LCGVELG+GIP+EF GI+K D  +SF  L+ KY   CP
Sbjct: 463 EETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCP 522

Query: 420 YQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPD 479
           YQ+L +PS+LDRDLS+RT+V+ CGH +CGRC+ R  NAR   +    K   +K G++HPD
Sbjct: 523 YQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLK-GSAHPD 581

Query: 480 NFAPKVCPADNCKYQIRSKGKMREVYF 506
           N+ PK+CPA  CK  IR++GKMRE +F
Sbjct: 582 NYGPKICPAKGCKSPIRTRGKMREAFF 608

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 117 AVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
            + +++ER     V LNLPGG  + ++A+  + P R SFE
Sbjct: 137 GLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  212 bits (540), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 164/264 (62%), Gaps = 21/264 (7%)

Query: 262 GLSGSDLV-NGYINFPVLPQSMASYMH--------NHVYGTPITGSEDDEEAQTQSIIDI 312
            L G + V  G ++     +S++SY++          ++G P+  +E DEE  TQ+IID+
Sbjct: 369 ALEGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVL-NEADEERHTQNIIDM 427

Query: 313 IQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVIRXXXXXXXXX-- 370
           IQ+REE ERD  +K    K+++Q+ +F E A  LP GYSASF T   ++           
Sbjct: 428 IQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEET 487

Query: 371 --------XXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQS 422
                         + VC LCGVELG+GIP++F G+S++D  +SF  L+ +Y   CPYQ+
Sbjct: 488 ITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQT 547

Query: 423 LGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFA 482
           L +PS LDRDLSKRT+V++CGH +CGRC+ R  NA+   K+   K   +K G++HPDN+ 
Sbjct: 548 LARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELK-GSAHPDNYG 606

Query: 483 PKVCPADNCKYQIRSKGKMREVYF 506
           PK+CPAD+CK  IRS+G+++EVYF
Sbjct: 607 PKLCPADSCKKLIRSRGRLKEVYF 630

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 117 AVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
            +T++EER A   + LNLPGG R+ VNA   + P+R SFE
Sbjct: 160 GLTIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFE 199

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  209 bits (533), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 150/241 (62%), Gaps = 12/241 (4%)

Query: 276 PVLPQSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQ 335
           PVL +    Y     +G  +   E DEE QTQ+II +IQ+REE E + R ++Y   ++S+
Sbjct: 347 PVLGRMHMGY-DARTHGGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSK 405

Query: 336 KKKFYEEAKQLPPGYSASF-ATPEV---IRXXXXXXXXXXXXXXXMIV------CNLCGV 385
           +  + E+A +LP GYS+SF  TP++   I+                        C+LCGV
Sbjct: 406 QLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLCGV 465

Query: 386 ELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHL 445
           ELG+GIP+EF G+S +D  +SF  L  KY   CPYQ+L KPS +DRDLS+RTYV+ CGH 
Sbjct: 466 ELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHS 525

Query: 446 FCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVY 505
           FCGRC+ R  NARS  +    K  ++K GASHPDN+ PK CPA +C  Q+R++GKMREVY
Sbjct: 526 FCGRCFARIDNARSFNRASKQKLKDLK-GASHPDNYGPKKCPAKDCNNQLRNRGKMREVY 584

Query: 506 F 506
           F
Sbjct: 585 F 585

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 104 GNLVPNAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
           G   P A  ++ED V +LEER +     LNLPGG  + +N +  + PVR SF+
Sbjct: 106 GQRRPQAASSEEDLV-ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQ 157

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  209 bits (532), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 142/219 (64%), Gaps = 11/219 (5%)

Query: 298 SEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATP 357
           S+ DEE  TQ+IID+IQ+REE ERD  +K    K+ +Q+++F   A  LP GYSASF T 
Sbjct: 402 SDADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTT 461

Query: 358 EVIRXXXXXXXXX----------XXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSF 407
             ++                         + VC LCG ELG+GIP++FTGIS++D  +SF
Sbjct: 462 PKMKLDITKNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSF 521

Query: 408 AELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGK 467
             L+ KY   CPYQ+L +PS LDRDLSKRT++++CGH FCGRC+ R  NA+   K    K
Sbjct: 522 EGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKK 581

Query: 468 SLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
              +K G++HPDN+ PK+CPAD+CK  IRS+G+++EVYF
Sbjct: 582 LAQLK-GSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 99  IEFLGGNLVPNAGDND-EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFER 157
           ++   G L  N  +N+ +D +T++EER     V LNLPGG R+ V A   + P+R SFE 
Sbjct: 135 VDNTNGYLNDNGNNNESDDGLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFE- 193

Query: 158 LMRNNQLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEW 204
                   +   + A R+ Q ++R+    RN  +FV  SD++ D++W
Sbjct: 194 --------FQEDLGASRR-QLLRRSATRARN--LFVDRSDEN-DEDW 228

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  206 bits (523), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 158/248 (63%), Gaps = 17/248 (6%)

Query: 269 VNGYINFPVLPQSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEY 328
           +  Y+NF     S  +     ++G+P+  ++ DEE  TQ+IID+IQ+REE ERD  +K  
Sbjct: 379 ITNYLNF-----SGENGFLTRLWGSPVL-NDADEERHTQNIIDMIQEREERERDVVMKNL 432

Query: 329 TRKSESQKKKFYEEAKQLPPGYSASFATPEVIRXXXXXXXXXXXXXXX----------MI 378
             K+++Q+++F + A +LP GYSASF T   ++                         + 
Sbjct: 433 MSKTKAQQEEFEDRAARLPEGYSASFDTTPKMKLDIMKNDKEETITVTDDDLARTLEVIP 492

Query: 379 VCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTY 438
           VC LCGVELG+GIP++F G++++D  +SF  L+ KY   CPYQ+L +PS LDRDLS+RT+
Sbjct: 493 VCCLCGVELGVGIPDDFIGMNQKDRGISFEGLVSKYKFHCPYQTLARPSMLDRDLSRRTF 552

Query: 439 VSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSK 498
           ++ CGH +CGRC+ R  NA+   KT   K  +++ G++HPDN+ PK CPA++CK  IRS+
Sbjct: 553 IAACGHAYCGRCFARIDNAKKKSKTPKKKLASLR-GSAHPDNYGPKFCPAESCKKPIRSR 611

Query: 499 GKMREVYF 506
           G+++EVYF
Sbjct: 612 GRLKEVYF 619

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 13/88 (14%)

Query: 117 AVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQN 176
            +T++EER     V LNLPGG R+ VNA   + P+R SFE           +   A  + 
Sbjct: 154 GLTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSFE----------FQDDLAVSRR 203

Query: 177 QRVQRNYRPVRNDGMFVPESDDSQDDEW 204
           Q ++R+    R   +FV  SD++ D+EW
Sbjct: 204 QLLRRS--AARARTLFVDRSDEN-DEEW 228

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  205 bits (521), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 141/216 (65%), Gaps = 11/216 (5%)

Query: 301 DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVI 360
           DEE  TQ+IID+IQ+REE ERD  +K    K+++Q+++F   A  LP GYSASF T   +
Sbjct: 405 DEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTTPKM 464

Query: 361 RXXXXXXXXX----------XXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAEL 410
           +                         + VC LCG ELG+GIP++FTG+S+ D  +SF  L
Sbjct: 465 KLDIMKNGKEETIIVTDDDLAKTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGISFEGL 524

Query: 411 MDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLN 470
           + KY   CPYQ+L +PS LDRDLSKRT++++CGH +CGRC+ R  NA+   KT   K   
Sbjct: 525 VSKYKFHCPYQTLARPSVLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPKKKLAQ 584

Query: 471 VKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
           +K G++HPDN+ PK+CPA++CK  IRS+GK++EVYF
Sbjct: 585 LK-GSAHPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (54%), Gaps = 14/102 (13%)

Query: 104 GNLVPNAGDND-EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNN 162
           G L  +  DN+ +D +T++EER     + LNLPGG R+ VNA   + P+R SFE      
Sbjct: 140 GYLNDSHDDNENDDGLTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRSFE------ 193

Query: 163 QLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEW 204
              +   + A R+ Q ++R+    R   +FV  SD++ D++W
Sbjct: 194 ---FQEDLAASRR-QLLRRS--ATRARSLFVDRSDEN-DEDW 228

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  202 bits (515), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 137/218 (62%), Gaps = 11/218 (5%)

Query: 299 EDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPE 358
           +D+++ QTQ+II++IQ+REE E D R K +  +++ Q+  F + A +LP  YSA+F T  
Sbjct: 397 DDEDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKRANELPENYSANFNTEP 456

Query: 359 VIRXXXXXX----------XXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFA 408
            ++                         +  C LCGVELG+GIP++F GI+  D   SF 
Sbjct: 457 TMKLDIKKNGKEETIIVEDNDAAKNYIEVPACTLCGVELGVGIPKDFQGINDTDRGGSFE 516

Query: 409 ELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKS 468
            L+ KY   CPYQSL KPS+LD+DLS+R ++++CGH FCGRC+ R  NA+S  K    K+
Sbjct: 517 SLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMASCGHTFCGRCYARIDNAKSKSKL-PKKT 575

Query: 469 LNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
           L    G+SHPDN+ P+VCPAD+C+  +R K KMREV+F
Sbjct: 576 LKQLKGSSHPDNYGPRVCPADSCRSLLRVKTKMREVFF 613

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 14/94 (14%)

Query: 115 EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVP-AE 173
           +D + + +ER     V LNLPGG+ + V+A   +   RSSFE         +   +P A 
Sbjct: 142 DDDLVITQERTMRPTVTLNLPGGQTLQVDATPTDQLARSSFE---------WQENIPLAR 192

Query: 174 RQNQRVQRNYRPVRNDGMFVPESDDSQDDEWETP 207
           RQ  R   N    R + +F  +  +S +D    P
Sbjct: 193 RQLLRRSTN----RANSLFFHDDHESDNDNGSVP 222

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 99/217 (45%), Positives = 139/217 (64%), Gaps = 11/217 (5%)

Query: 300 DDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEV 359
           +D++A TQ+II++IQ+RE++ERD R K +  K++ Q+  F + A  LP GYS+SF+T   
Sbjct: 497 EDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPEGYSSSFSTEPK 556

Query: 360 IRXXXXXXXXXXXXXXXMI----------VCNLCGVELGIGIPEEFTGISKEDFALSFAE 409
           ++                +           C LCGVELG+GIP++F G S +D  +SF  
Sbjct: 557 VKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGTSDKDHGVSFEF 616

Query: 410 LMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSL 469
           L+ KY   CPYQSL KPS+LDRDLS++ YV++CGH FCGRC+ R  NA+S  K    K  
Sbjct: 617 LVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNAKSKSKLPKKKLA 676

Query: 470 NVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
            +K G+SHPDN+ PK CP  +CK  +RS+G+MRE+YF
Sbjct: 677 ELK-GSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 9/85 (10%)

Query: 118 VTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVPAERQNQ 177
           V +LEER +   V LNLPGG R+ +NA   E P RSSFE L  N        VP  R+ Q
Sbjct: 218 VMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFESLNEN-------IVPLSRR-Q 269

Query: 178 RVQRNYRPVRNDGMFVPESDDSQDD 202
            ++R  R   N  +F   SD+++ D
Sbjct: 270 LLRRATRRATN-SLFFHGSDENESD 293

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  201 bits (510), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/217 (46%), Positives = 137/217 (63%), Gaps = 12/217 (5%)

Query: 300 DDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASF-ATPE 358
           DD+E  TQ+IIDIIQ REE + D R ++Y   ++SQ++ F   A++LP GY ASF  TP+
Sbjct: 343 DDDEV-TQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARAQRLPEGYYASFDPTPK 401

Query: 359 V---------IRXXXXXXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAE 409
           +                          + VC LCGVELG+GIP++F GIS  D  +SF  
Sbjct: 402 MKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLCGVELGLGIPDDFAGISAVDRGVSFES 461

Query: 410 LMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSL 469
           L+ KY   CPYQ+L  PS  DRDLS++T+V++CGH FCGRC+ R  NA+   K  + K L
Sbjct: 462 LVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCFARINNAKRFSKI-SKKRL 520

Query: 470 NVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
               G SHPDN+ P+VCPA+ C+ Q+R++GKMREV+F
Sbjct: 521 AELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMREVFF 557

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 13/102 (12%)

Query: 105 NLVPNAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE--RLMRNN 162
           ++V N     +D V ++EER       LNLP G+ + ++ +  + P+R SFE  R  R N
Sbjct: 99  SMVINHDGGGDDDVAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQRTARAN 158

Query: 163 QLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEW 204
            LR      A R  QR+  N     NDG   P   ++ D E+
Sbjct: 159 MLRR-----AARSAQRLFMN----ENDGE--PSEREASDREY 189

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  200 bits (508), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 150/246 (60%), Gaps = 15/246 (6%)

Query: 274 NFPVLPQSMASYMHNHVYGT----PITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYT 329
           N P   + +  ++H+ + G     P  G+E DEEA TQ+II +I++RE +ERD +VK+  
Sbjct: 406 NMPAHTRFVQGFLHS-IMGLGGDFPYGGTESDEEATTQNIIRMIEEREANERDSKVKQLM 464

Query: 330 RKSESQKKKFYEEAKQLPPGYSASFA-TPEVI--------RXXXXXXXXXXXXXXXMIVC 380
           +K++ Q++ F  +AK LP G+SASF+  P+ I        +               + VC
Sbjct: 465 KKTKKQQEDFENKAKYLPKGFSASFSLVPKKIISIDGDDSKREIVTDEFLAEEYEELPVC 524

Query: 381 NLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVS 440
            LCGVELG+GIP+ F GI+ E+  +SF  L+ KY   CPY +L  P ++DRDLS+RTYV+
Sbjct: 525 CLCGVELGVGIPDSFRGITPEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVA 584

Query: 441 NCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGK 500
           +CGH FCGRC RR  +A+   K    K L   +G  +PD + PK CPA +C  ++R KG+
Sbjct: 585 SCGHSFCGRCVRRINHAKESGKISKQK-LKELVGPENPDIYGPKTCPATDCTGKLRRKGQ 643

Query: 501 MREVYF 506
           MREVYF
Sbjct: 644 MREVYF 649

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%)

Query: 113 NDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSF 155
           N  D + +++ER +   V L LPG R I +NAA  + PVRSSF
Sbjct: 192 NGADDLVIVQERTSAPTVTLTLPGNRSIQINAAPTDRPVRSSF 234

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  198 bits (504), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 139/240 (57%), Gaps = 36/240 (15%)

Query: 303 EAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATP----- 357
           E +TQ +I +IQ+REE E D R +++T+K+E  ++   E+AK +P GYS+SF+T      
Sbjct: 425 EQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSFSTEVPVKL 484

Query: 358 ----------------EVIRXXXXXXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKE 401
                           + +                + VC LCGVELGIGIPE F GIS E
Sbjct: 485 IDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPETFAGISAE 544

Query: 402 DFALS-FAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSL 460
           D  L  F ++  KYG  CPYQ++ +P+ELDRDLS+RT++SNCGH FCGRC+ R   A++ 
Sbjct: 545 DKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYNRIHLAKAE 604

Query: 461 MKTKAGKSLN--------------VKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
            K   G+ +               V LG+ +PDN+ PK+CP  +CKYQIR++ KMRE YF
Sbjct: 605 TKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRARTKMREAYF 664

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 113 NDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERL 158
           ND+D + + E+ + +  + LNLPGGR   ++    + P RSSFE L
Sbjct: 111 NDDDLMIVGEQVIENPHILLNLPGGRTFELSTTTNDLPFRSSFEML 156

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  194 bits (493), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 131/216 (60%), Gaps = 11/216 (5%)

Query: 301 DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVI 360
           D+ A T+ II +IQ+REE +   R K+    ++SQ++K+ ++A  LP GYSASF T  ++
Sbjct: 393 DDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLM 452

Query: 361 RXXXX----------XXXXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFAEL 410
                                     + VC LCGVELG+GIP+++ G+S+ED  +SF  L
Sbjct: 453 SMTMENEGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEAL 512

Query: 411 MDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLN 470
              Y   CPYQ+L +P+ +DRDLS+RTYVS+CGH FCGRC  R  NAR +   +  K  N
Sbjct: 513 QSHYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKN 572

Query: 471 VKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
            + G SHPDN+ PK CPA+ C   +R KG MREVYF
Sbjct: 573 SQ-GPSHPDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 31  LPAIVVDEEDNSGAPVEVTSVNAXXXXXXXXLTLLRQSNIRVPRRQISTPVAYINLXXXX 90
           L   V + ED + AP+   + +         L +  + ++R P   I+    YINL    
Sbjct: 42  LSRFVSNAEDRNVAPI-APATDLPVSTDGEDLEITAEVSLR-PDGPINDDAEYINLDNYR 99

Query: 91  XXXXXXXXIEFLGGNLVPNAGDNDEDAVTLLEERLADGLVP--LNLPGGRRIIVNAANGE 148
                        G +V +  + D+D + L+EER+ +   P  L LP G+ + V+A+  E
Sbjct: 100 ASN---------NGTVVVDHREGDDD-LMLVEERIQESGRPVLLQLPAGQTLQVDASWNE 149

Query: 149 APVRSSFE-RLMRN-NQLRYLR 168
            PV  SF+ ++ RN NQLR LR
Sbjct: 150 LPVGRSFQNQVYRNPNQLRRLR 171

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  191 bits (484), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 100/229 (43%), Positives = 140/229 (61%), Gaps = 3/229 (1%)

Query: 280 QSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKF 339
           QS+   +H+ +    +    DDEE  TQ+II +IQ+RE++ERD RVK +T KS+   K  
Sbjct: 320 QSLLPRIHDFLQMRLMGYPNDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSI 379

Query: 340 YEEAKQLPPGYSASFATPEVIRXXXXX--XXXXXXXXXXMIVCNLCGVELGIGIPEEFTG 397
            +EAK LP  YSASF  P                     +  C LCG ELG+GIP+ F G
Sbjct: 380 LKEAKSLPSNYSASFHYPSSPSKPQIPGGSTSETAESEEVSCCVLCGSELGVGIPDSFIG 439

Query: 398 ISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNA 457
            S ED  L F+ L+ KY   CPYQSL +P++LDRDLSKRT++S CGH++CGRC+ R  NA
Sbjct: 440 RSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGRCFARIDNA 499

Query: 458 RSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
           ++  K    +  ++K G S+P+ + P++C AD C   IR+K ++RE+YF
Sbjct: 500 KAKSKISKKELASLK-GCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 111 GDNDEDAVTLLEERLAD---GLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNN 162
           G++D D +T+LEER A        L LPG   + +  A  + P+ +SF  L R++
Sbjct: 75  GNDDTDEITVLEERPAPPPPNTTELYLPGRNVMHIRTAQSDNPIPTSFRNLRRDD 129

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  190 bits (482), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 142/245 (57%), Gaps = 18/245 (7%)

Query: 277 VLPQSMASYMHNHVYGTPITGSEDD---EEAQTQSIIDIIQQREESERDKRVKEYTRKSE 333
           +L   +  Y    + G P  G  DD   EEA+TQSI++ IQ+REE ERD + K    K+ 
Sbjct: 315 ILEPGIFGYGSFRMIGNP--GGFDDGMEEEARTQSILNAIQEREEQERDAQTKSNMEKTR 372

Query: 334 SQKKKFYEEAKQLPPGYSASF-ATPEVIR----------XXXXXXXXXXXXXXXMIVCNL 382
           SQ++ F E+ K LP GYSASF  TP  +R                         + VC L
Sbjct: 373 SQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIAEWEEIAVCCL 432

Query: 383 CGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNC 442
           CGVELG+G+P++FTGIS +D  LSF EL+ KY S CPYQSL   +  +R LS +T+V++C
Sbjct: 433 CGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERALSMKTFVASC 492

Query: 443 GHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIR-SKGKM 501
           GH FCGRC  R  NAR+     + K L+   G  HPDN+ P++CPA  CK  IR  + KM
Sbjct: 493 GHTFCGRCVVRIENART-HSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKM 551

Query: 502 REVYF 506
           RE +F
Sbjct: 552 REAFF 556

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 112 DNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQLRYLRTVP 171
           D ++D +  ++E+     + LNLPG   + + A   + P R SFE+   N QLR+   V 
Sbjct: 108 DAEDDELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTRVA 167

Query: 172 AERQNQRVQRNYRPVRNDGMFVPESDD 198
             +  +R  R      N  M   ESDD
Sbjct: 168 RRQPMRRAARRA----NHSMNGYESDD 190

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  189 bits (479), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 101/221 (45%), Positives = 133/221 (60%), Gaps = 15/221 (6%)

Query: 299 EDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPE 358
           +DDEE +TQSII +IQ+REE E+D R K+Y+  ++ ++ +F   A +LP GYS+SF T  
Sbjct: 373 DDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATELPDGYSSSFNTEP 432

Query: 359 VIRXXXXXX----------XXXXXXXXXMIVCNLCGVELGIGIPEEFTGISKEDFALSFA 408
             +                         + +C LCGV L  GIP+EF G+S ED  L F 
Sbjct: 433 KAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEGIPDEFQGMSNEDRFLPFE 492

Query: 409 ELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKS 468
           EL +KY S CPYQ L +PS+ DRD SKR YV+NCGH +CGRC+RR  N++   K+K  KS
Sbjct: 493 ELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQNSKE--KSKLPKS 550

Query: 469 LNVKL-GASHPDNFAPKVCPADNCKYQIR-SKG-KMREVYF 506
              KL GA HPDN+ PK CP  +C   +R S+G   RE YF
Sbjct: 551 QLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  187 bits (475), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/226 (45%), Positives = 139/226 (61%), Gaps = 12/226 (5%)

Query: 292 GTPITGSED-DEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGY 350
           GT +    D DEE QTQ+II +IQ+REE E + R ++Y   ++ ++  + ++A +LP GY
Sbjct: 362 GTGMAAYNDADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQKAAKLPDGY 421

Query: 351 SASFATP-----EVIRXXXXXXXXXXXXXXXMI-----VCNLCGVELGIGIPEEFTGISK 400
           SASF T       +++                +      C LCGVELG+GIP+ F G+ +
Sbjct: 422 SASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGVELGVGIPDGFQGLYE 481

Query: 401 EDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSL 460
           ED  +SF  L  KY   CPYQ+L KPS  DRDLS+RTYV+ CGH FCGRC+ R  NARS 
Sbjct: 482 EDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSF 541

Query: 461 MKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506
            +    K   +K GAS+PDN+ PK CPA +C  ++RS+GKMREVYF
Sbjct: 542 NRASKKKLSELK-GASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 115 EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156
           E+ + +LEER       LNLPGG  + ++ +  + PVR SF+
Sbjct: 117 EEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQ 158

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 42/107 (39%), Gaps = 32/107 (29%)

Query: 397 GISKEDFALSFAELMDKYGSRCPYQSL------GKPSELDRDLSKRTYVSNCGHLFCGRC 450
             SKED   +   +M KY  +  + +L        P  LD+        + CGH FC  C
Sbjct: 856 AFSKEDIDNAIDRIMKKYNPQIDFPALECSICTTDPIPLDK-----IVFTECGHPFCESC 910

Query: 451 WRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRS 497
              Y       + +AGK+L +K             CP  NC+ QI S
Sbjct: 911 IEEYF------EFQAGKNLELK-------------CP--NCREQINS 936

>KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} similar
           to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
           E3 ubiquitin ligase for Rad6p required for the
           ubiquitination of histone H2B recruitment of Rad6p to
           promoter chromatin and subsequent methylation of histone
           H3 (on L4 and L79) contains RING finger domain
          Length = 663

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 435 KRTYVSNCGHLFCGRCWRRYLNAR 458
           K T + NCGH+FC  C +  L AR
Sbjct: 619 KNTAIKNCGHVFCEECCKERLAAR 642

>Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {ON}
           YDL074C (BRE1) - putative coiled-coil protein with
           RING-finger and myosin-like domains [contig 0] FULL
          Length = 668

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 435 KRTYVSNCGHLFCGRCWRRYLNAR 458
           K T + NCGH+FC  C +  L AR
Sbjct: 624 KNTAIKNCGHVFCEECCKERLAAR 647

>AAR049C Chr1 complement(428904..430235) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR066W
           (RAD18)
          Length = 443

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 431 RDLSKRTYVSNCGHLFCGRCWRRYLNARS 459
           +D+ +   ++ CGH FC  C R YLN  S
Sbjct: 36  KDMLQTPVLTQCGHTFCSLCIREYLNKES 64

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 33/112 (29%)

Query: 391 IPEEF-TGISKEDFALSFAELMDKYGSRCPYQSL------GKPSELDRDLSKRTYVSNCG 443
           + E F    SKE+       L  KY     +QSL       +P +LD+ L      + CG
Sbjct: 879 VSERFDNSFSKEELDAMIQRLKVKYPDNKSFQSLECSICTTEPMDLDKAL-----FTECG 933

Query: 444 HLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQI 495
           H FC +C   Y+  ++       K+L +K             CP  NC+ QI
Sbjct: 934 HSFCEKCLFEYIEFQN------SKNLGLK-------------CP--NCRNQI 964

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 431 RDLSKRTYVSNCGHLFCGRCWRRYLNARS 459
           +D  K + ++ CGH FC  C R+YL   S
Sbjct: 36  KDFLKASVLTPCGHSFCSICIRKYLQKES 64

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 431 RDLSKRTYVSNCGHLFCGRCWRRYLN 456
           +D  K   ++ CGH FC  C R YLN
Sbjct: 48  KDFLKTPVLTPCGHTFCSLCIREYLN 73

>CAGL0J06226g Chr10 (589288..590814) [1527 bp, 508 aa] {ON} highly
           similar to uniprot|P39006 Saccharomyces cerevisiae
           YNL169c PSD1
          Length = 508

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 291 YGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGY 350
           Y +P   +  DEEA      D+I  + E+E DK V EY   S S+  K   E     P Y
Sbjct: 280 YSSPDLNATKDEEAT-----DVI--KFENEGDKTVDEYNTPSISKTMKLLTEVSPNFPSY 332

Query: 351 SASFATPE 358
           ++S   PE
Sbjct: 333 TSSMTGPE 340

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 431 RDLSKRTYVSNCGHLFCGRCWRRYLNARS 459
           +D  K   ++ CGH FC  C R Y+N +S
Sbjct: 32  KDFLKVPVLTPCGHTFCSICIREYINRQS 60

>Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}
           similar to Ashbya gossypii AFR104W
          Length = 550

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 46/119 (38%), Gaps = 31/119 (26%)

Query: 407 FAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRY----LNARSLMK 462
           F+ L  + G  CP     + SE     + +T+   CGH +C  C++ Y    LN  +++K
Sbjct: 166 FSRLKTRDGFVCPI--CCESSE-----TMKTFSLECGHEYCLTCYQHYISDKLNVGNIIK 218

Query: 463 TK--------------AGKSLNVKLGASHPDNFAP------KVCPADNCKYQIRSKGKM 501
                            G+  + KL  S    F        K CP  +CKY I  K  M
Sbjct: 219 CMNCELALKNDDIDIIMGEGSSTKLMLSSIKGFIQKHSQYYKWCPFTDCKYVIHVKNTM 277

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 17/82 (20%)

Query: 397 GISKEDFALSFAELMDKYGSRCPYQSL------GKPSELDRDLSKRTYVSNCGHLFCGRC 450
             SKE+   +  +L  KY      QSL       +P +L++ L      + CGH FC +C
Sbjct: 888 SFSKEELEATIEKLRTKYPDNKSLQSLECSICTAEPIDLNKAL-----FTECGHSFCEKC 942

Query: 451 WRRYLNARSLMKTKAGKSLNVK 472
              Y++ ++      GK L +K
Sbjct: 943 LFEYIDFQN------GKKLCLK 958

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 431 RDLSKRTYVSNCGHLFCGRCWRRYLNARS 459
           +D  K   ++ CGH FC  C R YL + S
Sbjct: 32  KDFLKTPVLTPCGHTFCSVCIREYLQSNS 60

>Smik_14.352 Chr14 complement(627777..628196) [420 bp, 139 aa] {ON}
           YNR022C (REAL)
          Length = 139

 Score = 30.8 bits (68), Expect = 4.1,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 4/76 (5%)

Query: 277 VLPQSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVK----EYTRKS 332
           V P  M +Y+HNH     I     D   +   +  + + + E ER    K    E  RK 
Sbjct: 40  VKPSLMRNYLHNHNGAKYILNEVHDVNMELLKLYQVRELKLEEERQLLSKHKKMEAQRKM 99

Query: 333 ESQKKKFYEEAKQLPP 348
           E Q++   E+ KQ  P
Sbjct: 100 ELQRQSVLEQDKQEKP 115

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 17/83 (20%)

Query: 396 TGISKEDFALSFAELMDKYGSRCPYQSL------GKPSELDRDLSKRTYVSNCGHLFCGR 449
           +  +KED      +L  KY      QSL       +P +LD  +      + CGH FC +
Sbjct: 885 SSFTKEDLEAVMEKLRFKYPDNESLQSLECSICTAEPIDLDNAV-----FTECGHSFCEK 939

Query: 450 CWRRYLNARSLMKTKAGKSLNVK 472
           C   Y+  ++      GK L++K
Sbjct: 940 CLFEYIEFQN------GKQLSLK 956

>TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.286
           YKR017C
          Length = 541

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 432 DLSKRTYVSNCGHLFCGRCWRRYLNAR 458
           D  K TY   CGH +C  C+R Y+  R
Sbjct: 175 DQIKETYSLECGHEYCISCYRHYIEDR 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,498,561
Number of extensions: 2048826
Number of successful extensions: 7662
Number of sequences better than 10.0: 75
Number of HSP's gapped: 7815
Number of HSP's successfully gapped: 96
Length of query: 506
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 392
Effective length of database: 40,409,475
Effective search space: 15840514200
Effective search space used: 15840514200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)