Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0K00539g7.127ON45645623240.0
Suva_16.457.127ON47847818810.0
YPL259C (APM1)7.127ON47547618760.0
Smik_6.4667.127ON47647618650.0
Skud_16.197.127ON47647618460.0
KNAG0L009507.127ON46146318210.0
NCAS0E021407.127ON48145618190.0
KAFR0L004707.127ON46546818070.0
TBLA0A009507.127ON46946918020.0
ZYRO0C05236g7.127ON44745617890.0
NDAI0E036807.127ON44445517720.0
TDEL0H028907.127ON44245617700.0
SAKL0F05346g7.127ON44745617680.0
Kpol_1062.567.127ON45045717410.0
Ecym_83507.127ON44545517040.0
ADL017C7.127ON44345517000.0
TPHA0C043207.127ON45445816910.0
Kwal_55.208437.127ON44145616860.0
KLTH0F12584g7.127ON44145616840.0
KLLA0D14311g7.127ON44345516650.0
Ecym_52393.165ON4644795676e-67
KLTH0F06534g3.165ON4664805232e-60
SAKL0C07414g3.165ON4824985102e-58
Kwal_33.141823.165ON4674835083e-58
CAGL0C05203g3.165ON4754944997e-57
NDAI0G029203.165ON4864934936e-56
NCAS0C035803.165ON4914974921e-55
KLLA0C03894g3.165ON4754854865e-55
SAKL0D13090g2.555ON4995324877e-55
TDEL0D045803.165ON4824954841e-54
TBLA0F008403.165ON4814934796e-54
Kpol_1045.443.165ON4694804691e-52
ZYRO0B04840g3.165ON4764964682e-52
KLTH0D07502g2.555ON5045394597e-51
ADR315W3.165ON4923924447e-49
ABR047W2.555ON4984764396e-48
Kwal_26.81462.555ON5055414264e-46
YOL062C (APM4)3.165ON4913114193e-45
Smik_15.963.165ON4913014167e-45
TPHA0P006603.165ON4734264159e-45
Suva_15.1033.165ON4913014151e-44
KLLA0F25432g2.555ON5075394152e-44
Skud_15.913.165ON4913014053e-43
Ecym_45912.555ON5014914036e-43
KNAG0K011503.165ON4744833799e-40
TDEL0B064302.555ON5253373652e-37
TPHA0I023902.555ON5593673522e-35
ZYRO0E05874g2.555ON5493473485e-35
CAGL0K03223g2.555ON5983773408e-34
KAFR0A020602.555ON5403473352e-33
KAFR0C010203.165ON4284733294e-33
Skud_8.262.555ON5963713321e-32
NCAS0A126502.555ON5883673274e-32
Kpol_1056.132.555ON5413533248e-32
Smik_8.232.555ON6033543213e-31
YHL019C (APM2)2.555ON6053753213e-31
Suva_8.332.555ON5963723161e-30
KNAG0C055502.555ON5823562861e-26
TBLA0B067602.555ON6572302185e-18
NDAI0B016102.555ON6722712089e-17
SAKL0A09218g2.522ON4734201614e-11
KLTH0D06556g2.522ON4563211589e-11
TDEL0A029702.522ON4961471525e-10
TPHA0C041302.522ON5331531454e-09
AGL061W2.522ON4112371445e-09
Kwal_26.79572.522ON4561401429e-09
KLLA0E18789g2.522ON4972301303e-07
TBLA0I006202.522ON6091651285e-07
ZYRO0B01738g2.522ON4921461259e-07
KAFR0D035602.522ON4553201259e-07
Suva_4.5482.522ON4841431204e-06
Kpol_1018.422.522ON5751541171e-05
Skud_2.4192.522ON4841541171e-05
YBR288C (APM3)2.522ON4831471099e-05
Smik_2.4302.522ON4841391071e-04
KLLA0D11396g3.575ON5361221072e-04
Ecym_60073.575ON5371251028e-04
KLTH0G00528g3.575ON633137960.004
ZYRO0E09746g3.575ON538129950.004
AFR274C3.575ON532122950.005
NCAS0F040103.575ON547137950.005
TDEL0D064303.575ON536122950.005
Kwal_47.192923.575ON538137930.008
TBLA0E001403.575ON543132920.010
SAKL0F00594g3.575ON545122910.016
CAGL0L02145g2.522ON543157900.019
NDAI0B063203.575ON540114900.021
Smik_7.3713.575ON598125890.023
TDEL0B061901.388ON156107840.034
NDAI0K019302.522ON612165880.034
ZYRO0E05236g1.388ON15687840.038
Skud_6.1423.575ON546125870.044
Ecym_72662.522ON517140860.055
YFR051C (RET2)3.575ON546125860.058
TBLA0A012601.388ON15670820.063
YLR170C (APS1)1.388ON15670810.079
KLTH0H11770g1.388ON15690810.081
SAKL0D08074g1.388ON15687800.10
NDAI0G052101.388ON156103800.11
TPHA0G037003.575ON539137830.13
NCAS0A048702.522ON489161820.18
Suva_12.63.575ON546125810.22
CAGL0B04983g1.388ON15687760.36
Smik_12.2321.388ON15670760.37
Kpol_380.133.575ON535114790.38
CAGL0A04741g3.575ON536122790.41
KLLA0F22814g1.388ON156112760.42
TPHA0B035701.388ON15685740.77
Kpol_507.73.575ON533114760.81
KLLA0B06545g1.505ON14859711.7
Skud_12.2361.388ON15670702.3
TDEL0D011704.301ON66859732.3
Suva_10.2681.388ON15670702.3
Suva_4.5411.306ON875189732.4
KAFR0J001303.575ON54398722.7
KAFR0I020801.388ON15685692.9
NCAS0A087901.388ON156104693.1
AFR124W1.388ON15690683.7
KNAG0I013901.388ON15690684.4
Kwal_27.100201.505ON14784666.5
Kpol_1061.211.388ON15670666.9
NDAI0I007206.281ON74974688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0K00539g
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   899   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   729   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   727   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   723   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   715   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   706   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   705   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   700   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   698   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   693   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   687   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   686   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   685   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   675   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   660   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   659   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   655   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   654   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   653   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   645   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   223   6e-67
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   206   2e-60
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   201   2e-58
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   200   3e-58
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   196   7e-57
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   194   6e-56
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   194   1e-55
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   191   5e-55
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   192   7e-55
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   191   1e-54
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   189   6e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   185   1e-52
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   184   2e-52
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   181   7e-51
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   175   7e-49
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   173   6e-48
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   168   4e-46
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   166   3e-45
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   164   7e-45
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   164   9e-45
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   164   1e-44
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   164   2e-44
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   160   3e-43
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   159   6e-43
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   150   9e-40
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   145   2e-37
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   140   2e-35
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   138   5e-35
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   135   8e-34
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   133   2e-33
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   131   4e-33
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   132   1e-32
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   130   4e-32
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   129   8e-32
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   128   3e-31
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   128   3e-31
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   126   1e-30
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   114   1e-26
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    89   5e-18
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    85   9e-17
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    67   4e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    65   9e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    63   5e-10
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    60   4e-09
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    60   5e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    59   9e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    55   3e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    54   5e-07
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    53   9e-07
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    53   9e-07
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    51   4e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    50   1e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    50   1e-05
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    47   9e-05
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    46   1e-04
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    46   2e-04
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    44   8e-04
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    42   0.004
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    41   0.004
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    41   0.005
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    41   0.005
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    41   0.005
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    40   0.008
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    40   0.010
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    40   0.016
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.019
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    39   0.021
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    39   0.023
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    37   0.034
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    39   0.034
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    37   0.038
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    38   0.044
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    38   0.055
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    38   0.058
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    36   0.063
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    36   0.079
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    36   0.081
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    35   0.10 
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    35   0.11 
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    37   0.13 
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    36   0.18 
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     36   0.22 
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    34   0.36 
Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {O...    34   0.37 
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    35   0.38 
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    35   0.41 
KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa] ...    34   0.42 
TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON...    33   0.77 
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    34   0.81 
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    32   1.7  
Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {O...    32   2.3  
TDEL0D01170 Chr4 complement(219548..221554) [2007 bp, 668 aa] {O...    33   2.3  
Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {O...    32   2.3  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    33   2.4  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    32   2.7  
KAFR0I02080 Chr9 (426510..426980) [471 bp, 156 aa] {ON} Anc_1.38...    31   2.9  
NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1....    31   3.1  
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    31   3.7  
KNAG0I01390 Chr9 complement(269809..270279) [471 bp, 156 aa] {ON...    31   4.4  
Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C...    30   6.5  
Kpol_1061.21 s1061 complement(58801..59271) [471 bp, 156 aa] {ON...    30   6.9  
NDAI0I00720 Chr9 complement(156237..158486) [2250 bp, 749 aa] {O...    31   8.9  

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/456 (96%), Positives = 440/456 (96%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITEPKMLKQYITQ                RPPTSLTNSVSWRPEGIKHKKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
           APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
           AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/478 (73%), Positives = 394/478 (82%), Gaps = 22/478 (4%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FP LLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYLVAIATS+S NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+   N  P 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 241 APDDSS-------------VDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPP 287
           A   +S             +  S    KR  N+ELEDLKFHQCVRLSKFENEK ITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 288 DGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE 347
           DG F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 348 DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEK----- 402
           DADTP FKYSHGS+KYVPEK+AILWK+R+FPG KEYSM+AE+GLPS + G +  K     
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 403 ----LKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
               LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/476 (73%), Positives = 400/476 (84%), Gaps = 21/476 (4%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FPILLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VAI TS+S NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+ D N +P 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTN-IPS 239

Query: 241 AP----DDSSVDESKPK-------KKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDG 289
           A     D+++  + KP         K+  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG
Sbjct: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299

Query: 290 DFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDA 349
            F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359

Query: 350 DTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE---------S 400
           DTP FKYSHGS+KYVPEK+AILWKIR+FPG KEYSM+AE+GLPS +  E+         +
Sbjct: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419

Query: 401 EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           E LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/476 (72%), Positives = 394/476 (82%), Gaps = 20/476 (4%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+ G+PLLSR+YRDD+P SAID+F  LLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYLVAI TS++ NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDEN---G 237
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+ D N    
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 238 VPIAPDDSSVDESKP--------KKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDG 289
           V  A  D++ D  K           KR  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 290 DFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDA 349
            F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 350 DTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEK------- 402
           DTP FKYSHGS+KYVPEK+AILWK+R+FPG KEYSM+AE+GLPS +  ++  +       
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 403 --LKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
             LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/476 (73%), Positives = 394/476 (82%), Gaps = 20/476 (4%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FP LLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYLVAI TS+  NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQI E KMLKQYITQ                RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVP- 239
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+ D N  P 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 240 --IAPDDSSVD-ESKPKK-------KRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDG 289
              A  D+  D + KP         KR  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 290 DFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDA 349
            F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 350 DTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE---------S 400
           DTP FKYSHGS+KYVPEK+AILWK+R+FPG KEYSM+AE+GLPS +   E         +
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 401 EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           E LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/463 (73%), Positives = 397/463 (85%), Gaps = 9/463 (1%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+KG+PLLSR+Y+DD+P SAID+F  LL++ E+E+ +IPPCI HNGI++LFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ATS++ N A +F+FLHK++ VL EYLK VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITEP+MLK+YITQ                RPP+ L NSVSWR EGIK+KKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINML+TQKGQVLRSEIIG VK+KS+LSGMPDLKLGIND+G+F+KYLEG+  GV I
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 241 APD----DSSVDES---KPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFEL 293
            PD     S V ES      KKR  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+L
Sbjct: 241 -PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDL 299

Query: 294 MSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPV 353
           M+YRL+T+IKPLIWCDV+I+ HSKSRIEI CRAKAQIKKKS A NV+ILIPVP+DADTP 
Sbjct: 300 MNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPS 359

Query: 354 FKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQI 413
           FKYSHGSIKYVPE++AILWKI++FPG KEY+M AEMGLPS ++ EE  K+KRPVQVKF+I
Sbjct: 360 FKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEP-KVKRPVQVKFEI 418

Query: 414 PYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           PYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIR++
Sbjct: 419 PYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/456 (75%), Positives = 390/456 (85%), Gaps = 6/456 (1%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+KG PLL+R+YRDDIP SAI++FP LLS+ EEETNL+PPC+ +NG+Q+LFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHND+YLVAIA S+S NAA IF+FL+K+++VL  YLK VEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWR   IK+KKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DIIESINMLMTQKGQ+LRSEIIGEVKVKS+LSGMPDLKLGINDKG+FSK+++ D     +
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDS----L 267

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
             + +SV  S   KK+ NN+ELEDLKFHQCVRLSKFE EK ITFIPPDGDFELM+YRLST
Sbjct: 268 NNEGASVASSTTDKKK-NNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLST 326

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
           +IKPLIWCD+NI+ HS+SRIEI CRAKAQIKKKSTATNV+I+IPVPEDADTP FKYSHGS
Sbjct: 327 SIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGS 386

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IKYVPEKN I+WKIR+FPG KEYSM+A+M LPS    EE  K KRPVQ+KFQIPYFTTSG
Sbjct: 387 IKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEE-HKAKRPVQIKFQIPYFTTSG 445

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQV+YLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 446 IQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/468 (71%), Positives = 391/468 (83%), Gaps = 16/468 (3%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASA+YFCD+KG+PLLSRKYRDDIP SAID+F  LLS+ EEE+NL+PPCI HNGIQ++FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLYL A+ATS+  N +LIF+FLHK+I+VL  YLK VEEESIRDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YG+PQITE KMLK+YIT                 RPPT LTNSVSWRPEGIK+KKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DIIESINML+TQKGQVLRSEI+G V+VKS+LSGMPDLKLGIND+G+F+KYLEG+  G+  
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 241 APDDSSVDE--------SKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFE 292
             DD   D+        S+   KR  N+ELEDLKFHQCVRLSKFENEK I+FIPPDG+F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 293 LMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTP 352
           LM+YRLST+IKPLIWCDV+I+T+   RIEI C+AKAQIKKKS ATNVEILIPVPEDAD+P
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 353 VFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE-----SEKLKRPV 407
           +FKYSHG IKY+PEKN +LWKI +FPG KEYSMAA+MGLPS +  ++     S + K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 408 QVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
           QVKF+IPYFTTSGIQVRYLK+ E  LQYK+YPWVRYIT+SGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/469 (72%), Positives = 388/469 (82%), Gaps = 14/469 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S+I FCD+KG+ LLSRKYRDDIP +AID F  LL   EEE++++PPC+ HNGI +LFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ TS+S NA+ +F+FLHK++EV+SEYLK VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWRPEGIK+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEG------- 233
           DI+ESINMLMTQ+GQVLRSEIIGEVKV+S+LSGMPDLKLGINDKG+FSKYLE        
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 234 ------DENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPP 287
                 + N    +    S  + +   ++++N+ELEDLKFHQCVRLSKFENEK ITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 288 DGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE 347
           DG+FELMSYRL+T IKPLIWCDVNI  HSKSR+EI CRAKAQIKKKS A NVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 348 DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPV 407
           DADTP F+YSHGSIK+VPEKNAILWKIR+F G KEYSMAA++GLPS +  E+  KLKRPV
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKP-KLKRPV 419

Query: 408 QVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           Q+KFQIPYFTTSGIQVRYLK+ E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 420 QIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/456 (72%), Positives = 385/456 (84%), Gaps = 10/456 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SA+YFCD KGRP+LSR+YRDDIP SAID+F  LL   EEE+++IPPC+ H+GIQ+LFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY+VA+ATS++ N A +F+FLHK++EVL EYLK+VEEES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPPT +TNSVSWR   I HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINMLM Q+GQVLRSEIIG++KVKSKLSGMPDLKLGINDKG+FSKY+EGD +    
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD---- 236

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
            P  ++V E K K     N+ELEDLKFHQCVRLSKFENEK ITFIPPDG FELM+YRLS 
Sbjct: 237 -PVTTAVTEGKKK----TNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSM 291

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            +KPLIWCDVN++ HS+SRIEI CRA+AQIKK+S A +VEILIPVP+DADTP FKY+HGS
Sbjct: 292 PVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGS 351

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           +K+VP+KNAILWKIR+F G KEYSM+A+MGLPS NA ++  K+KRPVQ+KFQIPYFTTSG
Sbjct: 352 VKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKP-KVKRPVQIKFQIPYFTTSG 410

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLKI E  L YKSYPWVRYIT+SGDDYTI+L+
Sbjct: 411 IQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/455 (72%), Positives = 380/455 (83%), Gaps = 12/455 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MASAIYFCD KGRPLLSRKYRDDIP +AID+F  LL++ EEE+++IPPC+ +N  Q+LFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QH+D+YLVAI   +  N A +F+FL+K+I+VL +YLK VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP++LT+SVSWR EGIK+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINMLMTQKGQ+LRSEI+G VK+KS+LSGMPDLKLGINDKG+FSK L  D+     
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
                    +    K+ N +ELEDLKFHQCVRLSKFE EK ITFIPPDGDFELM+YRLST
Sbjct: 238 ---------NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLST 288

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
           +IKPLIWCD+N++ HS SRIEI CRAKAQIKKKSTATNVEILIPVPEDADTP FKYSHGS
Sbjct: 289 SIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGS 348

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+VPEK+AILWKIR+FPG KEYSMAAE+ LPST++  E  + K+PVQVKFQIPYFTTSG
Sbjct: 349 IKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSG 408

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
           IQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL
Sbjct: 409 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/456 (72%), Positives = 378/456 (82%), Gaps = 14/456 (3%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S IYFCD KGRP+LSR+YRDDIP SAIDRF  LL++ EEE+++IPPC+ H GIQ+LFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           +H DLY+VA++TS++ NAA +F+FLHK++E L +YLK VEEES+RDNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPPT LTNSVSWR +GI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           DI+ESINM+M Q+GQVLRSEIIG+V V+S+LSGMPDLKLGINDKG+F++  E  E+ V  
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETGESQVTA 240

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
                         K+ ++ ELEDLKFHQCVRLSKFENEK ITFIPPDG+FELMSYRL+T
Sbjct: 241 G-------------KKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTT 287

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            +KPLIWCDVN++ HSKSRIEI CRAKAQIKKKS A NVEILIPVP+DADTP F+YSHGS
Sbjct: 288 PVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGS 347

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+VPEKNAILWKIR+F G KEYSMAA+MGLPS N G E  K KRPVQVKFQIPYFTTSG
Sbjct: 348 IKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSIN-GVEKPKFKRPVQVKFQIPYFTTSG 406

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLKI E  LQYKSYPWVRYIT++GDDYTIRL+
Sbjct: 407 IQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRLN 442

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/456 (71%), Positives = 388/456 (85%), Gaps = 9/456 (1%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MAS IYFCD+KG+ +LSR+Y+DDIP +AID+FP+LL   E+E+++IPPC+ HNGIQ+LF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+S N A +F+FL+KV+EVL+EY+K VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D++ESINML+TQ+GQVLRSEI+G+VKVKS LSGMPDLKLG+NDKG+FS ++ G   GV  
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSG---GV-- 235

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
             +D + D S   KK++N +ELEDLKFHQCVRLSKFENEK ITFIPPDGDFELMSYRL+T
Sbjct: 236 --EDEADDLSATGKKKAN-IELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTT 292

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCD+ I+ HSKSRIE+ CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS
Sbjct: 293 PIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS 352

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+ PEKNAILWKI++FPG KEYSMAA++GLPS +  EE   +KRPVQVKFQIPYFTTSG
Sbjct: 353 IKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPV-MKRPVQVKFQIPYFTTSG 411

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLKI E  +QY+SYPWVRYIT+SGDDYTIR++
Sbjct: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/457 (71%), Positives = 380/457 (83%), Gaps = 10/457 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S +YFCD  G+P+LSR+YRDDIP SAID+F  +L   EEE++++PPC+ + GI +LFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QH+D+Y+VA+ TS   N A IF FLH+++ VL +YLK+VEEESIRDNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP +LTNSVSWR EGIK+KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDEN---G 237
           DIIESINMLM Q+GQVLRSEIIGEVKVKS+LSGMPDLKLGINDKG+FSKYLE +E+    
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 238 VPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYR 297
           V I  DDS+ +  K      +N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+FELM+YR
Sbjct: 241 VQIINDDSTTNGKK------SNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYR 294

Query: 298 LSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYS 357
           L+T IKPLIWCD+NI+ HSKSRIEI CRAKAQIKKKS A NVEILIPVP+DADTP FKYS
Sbjct: 295 LTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYS 354

Query: 358 HGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFT 417
           HGSIK++PEKNAILWK+R+F G KEYSM A++GLPS + G E  K+KRPVQ+KFQIPYFT
Sbjct: 355 HGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVD-GIEPPKVKRPVQIKFQIPYFT 413

Query: 418 TSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454
           TSGIQVRYLKI E  LQYKS+PWVRYIT+SGDDYTIR
Sbjct: 414 TSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/455 (69%), Positives = 374/455 (82%), Gaps = 10/455 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S IYFCD KG+ LLSR+Y+DDIP SAI++FP LL   E+E+N+IPPC  HNG+Q+LFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+  N A +FSFLH +++VL EY+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
            GIPQIT+ KML+QYITQ                RPP+SLT +VSWRPEGIK+KKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D+IESINM+MTQ+GQVLRSEI+G+VKV+S+LSGMPDLKLG+NDKG+F++  E +E     
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEE----- 235

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
             D+ S   S  +KK  +N+ELEDLKFHQCVRLSKFENEK ITFIPPDGDFELMSYRLST
Sbjct: 236 --DEPSSQPSITRKK--SNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLST 291

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCD  I+ HS+SR+E+ CRAKAQIK KSTA NVEILIPVP DAD+P F+YSHGS
Sbjct: 292 PIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGS 351

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+VPEKNAILWKI++FPG K+YSMAAEMGLPS N   +    KRPVQ+KFQIPYFTTSG
Sbjct: 352 IKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN-FKRPVQIKFQIPYFTTSG 410

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
           IQVRYLKI E  LQY SYPWVRYIT+SG+DY IR+
Sbjct: 411 IQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/455 (69%), Positives = 376/455 (82%), Gaps = 12/455 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S IYFCD+KG+ LLSR+Y+DDIP +AI++FP LL   E+E++++PPC   NG+Q+LFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+S N A +FS+LHK+IEVL EY+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           +GIPQIT+ KML+QYITQ                RPP +LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D++ESINML+TQ+GQVLRSEI+G+VKVKS+LSGMPDLKLG+NDKG+F++           
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQ----------- 229

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
             DD   + +    K+ +N+ELEDLKFHQCVRL+KFENEK ITFIPPDGDFELMSYRLST
Sbjct: 230 GDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLST 289

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCDV ++ HS+SRIEI CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHG+
Sbjct: 290 PIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGT 349

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+VP +NAILWKI++FPG K+YSMAAEMGLPS +   +  KLKRPVQ+KFQIPYFTTSG
Sbjct: 350 IKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSD-HKLKRPVQIKFQIPYFTTSG 408

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
           IQVRYLKI E  +QY SYPWVRYIT+SGDDYTIR+
Sbjct: 409 IQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/458 (69%), Positives = 373/458 (81%), Gaps = 7/458 (1%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S IYFCDN G+P+L+R+YRDDI  +AID F  LL   EEET +IPPCI H GI +LFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+ TS   N A IF FLH+++EVL EY+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXX--XXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEA 178
           +GIPQITE KMLK+YITQ                  RPP  LTNSVSWRPEGI +KKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGV 238
           FLDIIESINML+TQ+GQVLRSEI+G V+V+S+LSGMPDLKLGIND+G+FS YLE  EN V
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLE--ENNV 238

Query: 239 PIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRL 298
             +   + + E    KK    +ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+LM+YRL
Sbjct: 239 DGSSSSTPIPEGVEDKK--PQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 296

Query: 299 STAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSH 358
           +T IKPLIWCDVNI+ HSKSRIEI CRAKAQIKKKS A NVEILIPVP+DADTP F+YSH
Sbjct: 297 TTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSH 356

Query: 359 GSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTT 418
           GSIK++PEKNAILWK+R+F G KEYSM+A++ LPS + G E  K++RPVQVKFQIPYFTT
Sbjct: 357 GSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVD-GVEPPKVRRPVQVKFQIPYFTT 415

Query: 419 SGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           SGIQVRYLK+ E  LQYKSYPWVRYIT+SG+DYTIRL+
Sbjct: 416 SGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/456 (68%), Positives = 371/456 (81%), Gaps = 15/456 (3%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MAS IYFCDN G+ +LSR+YRDD+P SAI+RFP LL   E+E++++PPC+ HNG+Q++FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHND+Y++ ++ S+S N A +FSFL+K++EVL+EYLK VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP  LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D+ ESINML+T  GQVLRSEI+G+VKV+S+LSGMPDLKLG+NDKG+F+   EG  N    
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSE-EGGNNA--- 236

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
                   E    KK  +N+ELEDL+FHQCVRLSKFENEK I+FIPPDGDF+LM+YRLST
Sbjct: 237 --------EGGSGKK--SNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLST 286

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCD  I+ HS+SRIEI CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS
Sbjct: 287 PIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS 346

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           +KYVPEK+AILW+I+TF G KEYS AA++GLPS     E  K KRP+QVKFQIPYFTTSG
Sbjct: 347 LKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSM-TDVEVPKAKRPIQVKFQIPYFTTSG 405

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLK+ E  LQY+SYPWVRYIT+SGDDYTIR +
Sbjct: 406 IQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIRTA 441

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/456 (68%), Positives = 371/456 (81%), Gaps = 15/456 (3%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MAS IYFCDNKG+ +LSR+YRDD+P SAI++FP LL   E+E++++PPC+ HNG+Q+LFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           QHND+Y++ ++ S+S N A +FSFL+K++EVL+EY+K VEEESIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP+ LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D+ ESINML+T  GQVLRSEI+G+V V+S+LSGMPDLKLG+NDKG+F+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTS----------- 229

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
                S   S+  + + +N+ELEDLKFHQCVRLSKFENEK ITFIPPDGDFELM+YRLST
Sbjct: 230 ---VESASSSEATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLST 286

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCD  I+ HS+SRIEI CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS
Sbjct: 287 PIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS 346

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           +KYVPEK+AILWKI+TF G KEYS AA++GLPS     E  + KRP+QVKFQIPYFTTSG
Sbjct: 347 LKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDA-EVPRAKRPIQVKFQIPYFTTSG 405

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
           IQVRYLKI E  LQY+SYPWVRYIT+SGDDYTIR +
Sbjct: 406 IQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIRTA 441

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/455 (67%), Positives = 372/455 (81%), Gaps = 12/455 (2%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           MAS + FCD+KG+PLLSR+Y+DD+  SA++ F  LL   E+E++++PPC  HNGI ++++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
           Q+ND+Y++A+  S+S NA  +F+F++K+I V+ EY+K VEEESIRDN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFL 180
            G+PQ+TE KMLKQYITQ                RPPT LTNSVSWRPEGIK+KKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240
           D+IESINMLMTQ+GQVLRSEI+G VKV+S+LSGMPDLKLG+NDKG+F+     D+   P 
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTT---NDQEDSP- 236

Query: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300
            P  SS       KK+++N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+LM+YRLST
Sbjct: 237 EPVVSS-------KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLST 289

Query: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360
            IKPLIWCDV ++ HS SRIEI CRAKAQIKKKS A NVEILIP+PEDAD+P FKYS G+
Sbjct: 290 PIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGN 349

Query: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420
           IK+VPEKNAILWK  +F G KEYSMAA++GLPS +   E  KLKRPVQ+KFQIPYFTTSG
Sbjct: 350 IKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDA-EPPKLKRPVQIKFQIPYFTTSG 408

Query: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
           IQVRYLKIEE  LQY SYPWVRYIT+SGDDYTIRL
Sbjct: 409 IQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  223 bits (567), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 152/479 (31%), Positives = 246/479 (51%), Gaps = 41/479 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SA++    +G  ++S+  +D+I     + F I + N     ++  P +      F  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QHND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           + N  L+LV ++   + ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD ++
Sbjct: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLTNSVS-------------- 165
           D GIP+ TE   +  YI++                  P+ L  + +              
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDIL--NTPSWLVKAGARGMSSENLGLTSKD 173

Query: 166 ---WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
              WR EGI++KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G N
Sbjct: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKR---SNNMELEDLKFHQCVRLSKFENE 279
           D      YL    N      D  + +E+  K  +   + ++ LED KFHQCV+L KF+ E
Sbjct: 234 D------YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQE 287

Query: 280 KQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNV 339
           + I F+PPDG FELM Y +   +         + T     +E     K+    K  A +V
Sbjct: 288 RVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDV 347

Query: 340 EILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE 399
           E+ IP P D        S G  K++PE+NAI+WKI  + G  E   +A + +P  N G +
Sbjct: 348 ELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGN-GND 405

Query: 400 SEKLKR----PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454
           S  L++    P+ V+F+I  F+ SG+ VRYLK+ EK+L Y +  WV+YI+KSG  Y +R
Sbjct: 406 SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  206 bits (523), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 143/480 (29%), Positives = 241/480 (50%), Gaps = 41/480 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SA++    +G  L+S+  R  +P S  + F I + N     ++  P +      F  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVIN---NLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           +   +L++VA++ S + ++A I+ FL+K+  +L  +    E E ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITE-----------PKMLKQYIT---QXXXXXXXXXXXXXXXXRPPTSLTN--- 162
           + G+P  TE           P    + I    +                R  +S +N   
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 163 -------SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMP 215
                  ++ WR  GIK+KKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKP-KKKRSNNMELEDLKFHQCVRLS 274
             + G+ND    S          P   ++S     K   K  + ++ LED KFHQCV+L 
Sbjct: 236 VCRFGLNDSLSVS---------TPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLD 286

Query: 275 KFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKS 334
           KF++E+ I FIPPDG FELM Y +   +         +     + I+     K+    K 
Sbjct: 287 KFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKL 346

Query: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394
           TA +V++ IPVP +        S+G  K+VPE++AI+WK   + G  E S++A       
Sbjct: 347 TAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKD 406

Query: 395 NAGEESEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454
           +A    +  K P+ +KF+I  F+ SG+ VR+  + E +  YK   W++Y++KSG  Y +R
Sbjct: 407 SALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  201 bits (510), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 148/498 (29%), Positives = 247/498 (49%), Gaps = 61/498 (12%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +A++    KG  ++S+  RD I  S  + F I + N     ++  P +      F  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           + + +L++VA+  S + ++A I+ FL+K   +L  Y     EES+++ F+  YELLD ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITE-----PKMLKQYITQ------XXXXXXXXXXXXXXXXRPPTSLTNSVS--- 165
           + G+P  TE      KM ++ +                        R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207
                             WR  GIK+KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKR------SNNME 261
            + LSG P  + G+ND    S  L+G      ++ D   + E + K K+      + +++
Sbjct: 236 TTHLSGTPLCQFGLND----SLSLDGGT----LSRDLDFISEYEVKNKKAIPKAAAGSVQ 287

Query: 262 LEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRI 320
           LED KFHQCV+L++F  ++ I F+PPDG FELM Y +   +  P     +     +   +
Sbjct: 288 LEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAV 347

Query: 321 EIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGD 380
           E     K+    K TA +V + IPVP          S+G  ++VPE+NA+LWK   + G 
Sbjct: 348 EYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGL 407

Query: 381 KEYSMAAEMGLPSTNAGEESEKLKR----PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYK 436
            E +++A + +P  N  + S  L++    P+ + F+I  F+ SG+ VR+ K+ E++  Y 
Sbjct: 408 TENTLSA-LTVPMDN--QSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYH 464

Query: 437 SYPWVRYITKSGDDYTIR 454
           +  WV+YI++SG  Y +R
Sbjct: 465 TVKWVKYISRSG-AYEVR 481

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  200 bits (508), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 143/483 (29%), Positives = 244/483 (50%), Gaps = 46/483 (9%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +A++    +G  L+S+  +  +  S  + F I + N     ++  P +      F  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           +   +L++VA++ S + ++A I+ FL+++ E+L E      E  +++ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITEPKMLKQYIT--------------QXXXXXXXXXXXXXXXXRPPTSLTN--- 162
           + G+P  TE   +   ++              +                R   S  N   
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 163 -------SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMP 215
                  ++ WR  GIK+KKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDKGLFSKYLEGDENGVPIAPDD--SSVDESKPKKKRSNNMELEDLKFHQCVRL 273
             + G+ND    S          P   DD     ++    K  + ++ LED KFHQCV+L
Sbjct: 236 VCRFGLNDALSVS---------TPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQL 286

Query: 274 SKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFCRAKAQIKK 332
            KF++E+ I FI PDG FELM Y +   +  P     +     S S I+     K+    
Sbjct: 287 DKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPS 345

Query: 333 KSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLP 392
           K TA +V++ IPVP +  +     S+G  K+VPE++AI+WK   + G  E S++A   +P
Sbjct: 346 KLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVP 404

Query: 393 STNAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDY 451
             ++    E+  R P+ +KF+I  F+ SG+ VR+  + E++  YK   W++Y++KSG  Y
Sbjct: 405 MKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AY 463

Query: 452 TIR 454
            +R
Sbjct: 464 EVR 466

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  196 bits (499), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 148/494 (29%), Positives = 247/494 (50%), Gaps = 60/494 (12%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SA+    ++G  ++S+ +++++  S  D F I + N     ++  P +      F  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVIN---NLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYLVAIATS-ISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELL 115
           + N    DL+LV++  S I+C A  ++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 58  RSNVHGDDLWLVSVTRSNINCGA--VWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114

Query: 116 DEMM-DYGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRPPT---------------- 158
           D M+ + G P  T+P  + + ++                 +  T                
Sbjct: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174

Query: 159 -----------SLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207
                      ++   + WRP+GI HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234

Query: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPK----KKRSNNMELE 263
            + LSG P  + G+ND    S  ++ D+ G        S D  K K    K  + ++ LE
Sbjct: 235 VTHLSGTPVCQFGLND----SLSVKNDDYG-------DSFDYIKNKKAIPKAAAGSVLLE 283

Query: 264 DLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEI 322
           D KFHQCV L KF+ ++ I F+PPDG  ELM Y + + I  P     +   + S + +E 
Sbjct: 284 DCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEY 343

Query: 323 FCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKE 382
               K+    K TA NV + IPVP +        S+GS K+ PE+ A+LW    + G  E
Sbjct: 344 RITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTE 403

Query: 383 YSMAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPW 440
            +++A + + S +A   +  +  K P+ + F+I  F+ SG+ VRY  I+E   +YK+  W
Sbjct: 404 NTLSA-VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKW 461

Query: 441 VRYITKSGDDYTIR 454
           +RY++KSG  Y IR
Sbjct: 462 IRYVSKSG-SYEIR 474

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  194 bits (493), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 143/493 (29%), Positives = 241/493 (48%), Gaps = 45/493 (9%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M + I     +G  ++S+ ++  +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLD 116
           +     ++L+LVA AT  + N+A I+ FL+K+  +L EY    +EE +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITEPKMLKQYIT-----------------QXXXXXXXXXXXXXXXXRPPT 158
            M+   GIP  TEP  +   ++                                  R  +
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 159 SLT-------NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKL 211
           S +       N  SWRP+ IKHKKNE  L + E IN+L+ + G +L++ + G + ++++L
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGINDKGLF----SKY--LEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDL 265
           SG P  + G+ND        S+Y    G       +  DS++      K    N+ LED 
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 266 KFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFC 324
           KFHQCV L KF+ E+ I F+PPDG  ELM Y +   +  P     +   + +   ++   
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355

Query: 325 RAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYS 384
             K+    + +A  V + IPVP          S+G+ K+VP +NA++WK   + G  E +
Sbjct: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415

Query: 385 MAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVR 442
           ++A + +PS    + +  +  + P+ + F+I  F+ SG+ VRY  I E +  YK+  W++
Sbjct: 416 LSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIK 474

Query: 443 YITKSGDDYTIRL 455
           Y++KSG  Y +R 
Sbjct: 475 YVSKSG-SYEVRF 486

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  194 bits (492), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 140/497 (28%), Positives = 249/497 (50%), Gaps = 50/497 (10%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +A+     +G  ++S+ ++  +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +    ++L++VA++ + + ++A I+ FL+K+  +L  Y     EE +++ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDV 115

Query: 118 MM--DYGIPQITEPKMLKQYITQXXXXXXXXXXXXX------------------------ 151
           MM    GIP +TE  ++   ++                                      
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 152 XXXRPPTSLTNSVS------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEV 205
              R   SL+  +S      WRP+GI HKKNE  L + E IN+L+++ G VL++ + G +
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVKSKLSGMPDLKLGIND----KGLFSK-YLEGDENGVPIAPDDSSVDESKPKKKRSNNM 260
            +++ LSG P  + G+ND     G+ S  Y   + N      +    D+ +       ++
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSV 295

Query: 261 ELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSR 319
            LED KFHQCV L KF+ ++ I F+PPDG  ELM Y +   +  P     +   T + + 
Sbjct: 296 ILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTA 355

Query: 320 IEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPG 379
           +E     K+    + +A NV + IPVP +        ++GS K++PE++A++W+   F G
Sbjct: 356 LEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNG 415

Query: 380 DKEYSMAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKS 437
             E +++A + +P+ +  + S  +  K P+ + F+I  F+ SG+ VRY  I E++ +YK+
Sbjct: 416 LTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKA 474

Query: 438 YPWVRYITKSGDDYTIR 454
             W++YI++SG  Y IR
Sbjct: 475 VKWIKYISRSG-SYEIR 490

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  191 bits (486), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 248/485 (51%), Gaps = 42/485 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SAI+  + KG  L+S+  +D +  S  D F   + N   + ++  P +      F  +
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVIN---DPHVRSPILTLGSTTFQHV 57

Query: 61  --QHND---LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELL 115
             + +D   ++LVA++ S + ++++I+ +LHK+ +++ E     +E+ ++D F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLM-EAFGINDEDVLKDEFMLLYEIL 115

Query: 116 DEMMDYGIPQITE-----PKMLKQYI---TQXXXXXXXXXXXXXXXXRPP---------- 157
           +  ++ GIPQ T+     P++ ++ I   T                 + P          
Sbjct: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSI 175

Query: 158 -TSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPD 216
             S  +   WRP G+K+KKNE +LDI E I +L+ + G +++S + G V   S LSGMP 
Sbjct: 176 ALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235

Query: 217 LKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSN----NMELEDLKFHQCVR 272
            +LG+ND    +  + G+E       +  S  + K KK   N    ++ LED KFHQCV+
Sbjct: 236 CQLGLND----TYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQ 291

Query: 273 LSKFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKK 332
           L+K+E    I F+PPDG F+LM YR+   I         ++    S +      ++    
Sbjct: 292 LNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPS 351

Query: 333 KSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLP 392
             +A +V + IPVP       F  S G  KY   +  ++WK   + G  E +++ ++ +P
Sbjct: 352 NVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIP 411

Query: 393 STNAGEESEKLKR---PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGD 449
           +T + + S+ L+    P+ + F+I  F+ SG+ VR+LK +E  L Y+   W++YI+ SG 
Sbjct: 412 AT-SHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG- 469

Query: 450 DYTIR 454
            Y IR
Sbjct: 470 AYEIR 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  192 bits (487), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 143/532 (26%), Positives = 241/532 (45%), Gaps = 110/532 (20%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIP--PCIEHNGIQFL 58
           M+S IY  D   +PL+ +       F AI      +  F++  +  P  P   + GI F+
Sbjct: 1   MSSCIYILDETLQPLIYKN------FKAISNGEESIELFQQAHSKHPMVPVFHYKGIHFV 54

Query: 59  FIQHNDLYLVAIATSIS--------CNAALIFSFLHKVIEVLSEYLKA--VEEESIRDNF 108
           +I+ +  Y ++    ++         N   I ++L     +L  Y  +  +    I DNF
Sbjct: 55  YIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNF 114

Query: 109 VIIYELLDEMMDYGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRP------------ 156
            +IYELLDE +D+G+PQ+T+  +++ YI                  +             
Sbjct: 115 HLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESY 174

Query: 157 -----PTSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSK 210
                  + T+++SWRP+GI + KNE FLD+IE I   M   K ++ ++ + G ++ +S 
Sbjct: 175 MNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSY 234

Query: 211 LSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQC 270
           LSGMP LK+G+                       S +  S PK++      + + KFHQC
Sbjct: 235 LSGMPKLKIGL-----------------------SKITSSLPKEREQF---MNNAKFHQC 268

Query: 271 VRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-----PLIWCDVNIKTHSKSRIEIFCR 325
           V L   + +  ++FIPPDG+F+L  Y+L   ++      L+  DV  +   + +I I   
Sbjct: 269 VSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLT 327

Query: 326 AKAQIKKKSTATNVEILIPVP--------EDADTPVFKYSHGSIKYVPEKNAILWKIRTF 377
                K +++ + + I IP+         + A  P FK   G++ +    + +LW++ + 
Sbjct: 328 ITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSI 387

Query: 378 PG---DKEYSMAAEMGL-------------------PSTNAGEESEKL------------ 403
            G     E+SM  E  L                   P    G + E+L            
Sbjct: 388 KGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNR 447

Query: 404 KRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
            R V ++F+IPY+T SG++V+YLKIEE  LQY S+PWVRY T + ++Y  ++
Sbjct: 448 SRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  191 bits (484), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 139/495 (28%), Positives = 250/495 (50%), Gaps = 55/495 (11%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M SAI    ++G  ++++  +  +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           + +    L+LVA++ S + N+  I+ FL+K + V+ +     +E ++++NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYK-LNVIMDVYGLTKEGTLKENFMNCYEILDT 115

Query: 118 MMD-YGIPQITE------------PKMLKQYITQXXXXXXXXXXXXXXXXRPPTSLT--- 161
           +++  GIP  TE            PK +   +                     ++L+   
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 162 ------------------NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIG 203
                             +++SWRP GIK+KKNE  L++ E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 EVKVKSKLSGMPDLKLGINDKGLFSKYLE-GDENGVPIAPDDSSVDESKPKKKRSNNMEL 262
            + + + LSGMP  + G+ND    S  +E GD++   I+  +   ++    K  +  + L
Sbjct: 236 TIDLTTHLSGMPICQFGLND----SLSVEFGDDS---ISEVEDFANKKAIPKAAAGRVML 288

Query: 263 EDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIE 321
           ED KFHQCV L KF  ++ I F+PPDG  ELM Y +   +  P     +       + I+
Sbjct: 289 EDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTID 348

Query: 322 IFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDK 381
                K+    K +A +V + IPVP          S+G  K+VPE++A++WK   + G  
Sbjct: 349 YRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLT 408

Query: 382 EYSMAAEMGLPSTNAGEESEKL--KRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYP 439
           E +++A + +PS++  + + +   + P+ + F+I  F+ SG+ VRY K+ +K+ +Y++  
Sbjct: 409 ENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAK 467

Query: 440 WVRYITKSGDDYTIR 454
           W++YI+KSG  Y IR
Sbjct: 468 WIKYISKSG-SYEIR 481

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 240/493 (48%), Gaps = 52/493 (10%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +A+     +G  L+ + ++  +  +  D F + + N +   N+  P +      F FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND---NIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +    + L+LVA+  S + ++  I+ +L+K +  L E      E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYK-LNSLMEVYGLTHEDILKDEFIVCHELLDI 115

Query: 118 MMDY-GIPQITE-----PKML---KQYITQXXXXXXXXXXXXXXXXRPPTSLT------- 161
            +   G+P  TE      KM     Q +T                    T ++       
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 ----------------NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEV 205
                           +++ WR   IK+KKNE  +++IE IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDL 265
            + + LSGMP  ++G+ND       ++G EN      D +S  ++ P     + + LE  
Sbjct: 236 DITAHLSGMPMCQIGMNDLST----IQGGENAHWTNEDRASNRDAMPDVS-GDRVILEGS 290

Query: 266 KFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-PL-IWCDVNIKTHSKSRIEIF 323
           KFHQCV L K+  +  I FIPPDG FELM Y +S  +  P  I   V + +H  + +   
Sbjct: 291 KFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTA-LSYA 349

Query: 324 CRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEY 383
            + K+   +K +A NV + IPVP          S G  K++PE+N ++W    F G  E 
Sbjct: 350 IKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTEN 409

Query: 384 SMAAEMGLPSTNAGEESEK--LKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWV 441
            + A+  +P+ +   +S K   + P+ + F++  F+ +G+ VRYLK++EKN+ Y +  W+
Sbjct: 410 HLNAQT-VPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWI 468

Query: 442 RYITKSGDDYTIR 454
           +YI+ +G  Y +R
Sbjct: 469 KYISAAG-SYEVR 480

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 137/480 (28%), Positives = 233/480 (48%), Gaps = 38/480 (7%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M + +     KG  ++S+  + +   S  D F + + N     ++  P +      F  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QHND---LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           + N    L+LVA+  S + N+  I+ FL+K   +L+ +     E ++++ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDL 115

Query: 118 MMDY-GIPQITE-----PKM-------LKQYITQXXXXXXXXXXXXXXXXRPPTSLT--- 161
           M++  G+P  TE      KM       +                      R   S++   
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 162 -----NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPD 216
                ++  WRP GIK+KKNE FL+I E I++L+++   +L++ + G V + S LSG P 
Sbjct: 176 MNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPT 235

Query: 217 LKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKF 276
            + G+ND       L  DE     + D+   ++    +  +  + LED KFH+CV L KF
Sbjct: 236 CQFGLNDS------LSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKF 289

Query: 277 ENEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFCRAKAQIKKKST 335
             ++ I F+PPDG  ELM Y +   I  P       I + S++ ++     K+    K +
Sbjct: 290 NRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLS 349

Query: 336 ATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTN 395
           A +V + IPVP          S+G  ++VPE++ I+WK   + G  E  ++A     +  
Sbjct: 350 ANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDT 409

Query: 396 AGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454
                ++  R P+ + F+I  F+ SG+ VRYLKI EK+ +Y++  W++YI++SG  Y +R
Sbjct: 410 TQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  184 bits (468), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/496 (27%), Positives = 239/496 (48%), Gaps = 63/496 (12%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +AI+    +G  ++S+ + + +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVIN---NLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           + N    L++V ++ + + N+  I+ FL+K   +L  Y    +EE ++++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115

Query: 118 MMDYG-IPQITEPKMLKQYIT---QXXXXXXXXXXXXXXXXRPPTSLTNS---------- 163
           ++  G IP  TE   +   I+                     P ++L+ S          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 164 ----------------VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207
                             WRP GIK+KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKP-KKKRSNNMELEDLK 266
            + LSG P  + G+ND           E G  +  D       K   K  + ++ LED K
Sbjct: 236 TTHLSGTPICQFGLNDS-------PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288

Query: 267 FHQCVRLSKFENEKQITFIPPDGDFELMSY------RLSTAIKPLIWCDVNIKTHSKSRI 320
           FHQCV L KF  E+ I F+PPDG+ ELM Y       L   I P++       T   S +
Sbjct: 289 FHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTV 341

Query: 321 EIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGD 380
           E     K+    K +A +V + IPVP          S+G  K+  E+NA++W+   + G 
Sbjct: 342 EYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGL 401

Query: 381 KEYSMAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSY 438
            E +++A + +P+++  + +  +  + P+ + F+I  F+ SG+ VRY ++ +K+ +Y+  
Sbjct: 402 TENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVV 460

Query: 439 PWVRYITKSGDDYTIR 454
            W++YI+KSG  Y +R
Sbjct: 461 KWIKYISKSG-SYEVR 475

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  181 bits (459), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 147/539 (27%), Positives = 235/539 (43%), Gaps = 119/539 (22%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S ++  D +  PL+ R  +     +  + + +       ++    P I   GI +++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLK---SIAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYLVAIATS-ISCNAALIFSFLHKVIEVLSEYLKA--VEEESIRDNFVIIYELLDE 117
             + LY V+++   +  N   I ++L+    +L +YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDYGIPQITEPKMLKQYIT----------------------QXXXXXXXXXXXXXXXXR 155
            +DYGIPQ+T+  +++  I                       +                R
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 156 PPTSLTNS---------VSWRPEGIKHKKNEAFLDIIESINMLMTQKG-QVLRSEIIGEV 205
                 NS         +SWRP+GI + KNE F+DIIE  + LM  K  QV ++ + G++
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDL 265
             +S LSGMP +++ IN                              K  +  ++ L   
Sbjct: 236 NCRSYLSGMPIVRVCIN------------------------------KMLKDKDLFLGSS 265

Query: 266 KFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNI-KTHSKSRIE 321
           KFHQCV L    ++  I FIPPDGDF+L  Y+L   I   P+I   D  I +   K R+ 
Sbjct: 266 KFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHRLH 325

Query: 322 IFCRAKAQIKKKSTATNVEILIPVP--------EDADTPVFKYSHGSIKYVPEKNAILWK 373
           +    +   K +++AT ++I IP          +    P FK  HGS+ +      +LW 
Sbjct: 326 LSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWD 385

Query: 374 ---IRTFPGDKEYSMAAEMGL-------------------PSTNAGEESEKLKRPVQ--- 408
              I+   G+  YSM  E  L                   P    G   E+L   V+   
Sbjct: 386 AQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNK 445

Query: 409 ------------VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455
                        +F++PY+T+SG++V YLKI E+NL+Y+S+ WVRY T +  +Y  ++
Sbjct: 446 EGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  175 bits (444), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 118/392 (30%), Positives = 197/392 (50%), Gaps = 32/392 (8%)

Query: 48  PCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDN 107
           P +      F  I+ +    + +    + ++A I+ FL+ + ++L  Y    EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 108 FVIIYELLDEMMDYGIPQITEPKMLKQYITQX-XXXXXXXXXXXXXXXRPPTSLTNSVS- 165
           F++ YELLD ++D G+PQ TE   +   +++                 R   + T +VS 
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 166 ------------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSG 213
                       WR EGIK+KKNE +LD+IE +++L+ + G +L++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 214 MPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRL 273
           MP    G ND    S+ L         AP     DE +       ++ LED KFHQCV+L
Sbjct: 224 MPLCHFGFND----SQSLRQRSPRRQYAPRVFGTDERE-------SVVLEDCKFHQCVQL 272

Query: 274 SKFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKK 333
           +KF+ E+ I F+PPDG+FELM Y +   ++P       +   ++  IE     ++    K
Sbjct: 273 NKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTK 332

Query: 334 STATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPS 393
            +A +VE+ IP P    +     S G  K+VPE+NAI+WKI  F G  E +++A     +
Sbjct: 333 LSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVT--IA 390

Query: 394 TNAGEESEKLKR----PVQVKFQIPYFTTSGI 421
              G  ++ L +    P+ +K +I  F+T+ +
Sbjct: 391 DEQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  173 bits (439), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 116/476 (24%), Positives = 213/476 (44%), Gaps = 110/476 (23%)

Query: 48  PCIEHNGIQFLFIQHNDLYLVAIATSISCNAAL-IFSFLHKVIEVLSEYL-KAVEEESIR 105
           P + H G  +++IQ + LY ++++  +     + +F++L ++ ++  +YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDYGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXRP--------- 156
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+                  +          
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 157 -----------------PTSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLR 198
                              + T+++SWRP GI + KNE FLD++E +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSN 258
           +++ G +  +S LSGMP L +G+N                 +A D     +         
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNKM---------------VAQDRDFTSQ--------- 256

Query: 259 NMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAI--KPLI---WCDVNIK 313
                 + FHQCV L +   ++ ITF+PPDG+F+L  Y+L+     +PLI    C   +K
Sbjct: 257 ------VHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVK 310

Query: 314 THSK----SRIEIFCRAKAQIKKKSTATNVEILIPVPEDADT--------PVFKYSHGSI 361
              +     R+ +        K +   + +++ +P+    +         P FK   G +
Sbjct: 311 PRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCV 370

Query: 362 KYVPEKNAILW---KIRTFPGDKEYSMAAEMGLPS-------------------TNAGEE 399
            +    + +LW   K +   GD+ ++M ++  L                      + G++
Sbjct: 371 MFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQ 430

Query: 400 SEKLKRP------------VQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRY 443
            E L               ++V F++PY T SG++V +LKI E  LQY+S+PW+RY
Sbjct: 431 LEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  168 bits (426), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 147/541 (27%), Positives = 237/541 (43%), Gaps = 122/541 (22%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S+I+  D +  PL+ + ++        + F        + +N+  P I H GI F+ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYLVAIAT-SISCNAALIFSFLHKVIEVLSEYLK--AVEEESIRDNFVIIYELLDE 117
             + LY V+++  S+  +      +L+    +L +YL+  A++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 --------MMDYGI--------PQIT-EPKMLKQYITQXXXXXXXXXXXXXXXXRPPTSL 160
                   + D+ I        P I  +PK+ +                           
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 161 ---------------TNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKG-QVLRSEIIGE 204
                          T ++SWRP+GI + KNE F+D+IES   +M  K  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELED 264
           +  +S LSGMP +K+ IN                              K  +  +  L  
Sbjct: 236 IICRSYLSGMPVVKICIN------------------------------KMLKDRDQFLSS 265

Query: 265 LKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK-----PLIWCDVNIKTHSKSR 319
            KFHQCV L    ++  I FIPPDGDF+L  Y++   I       LI   V ++   K +
Sbjct: 266 AKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHK 324

Query: 320 IEIFCRAKAQIKKKSTATNVEILIPVPEDADT--------PVFKYSHGSIKYVPEKNAIL 371
           ++I  + +   K +++AT ++I +P+ +  +T        P FK   GSI +      +L
Sbjct: 325 LQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLL 384

Query: 372 WK---IRTFPGDKEYSMAAEMGLPSTN------------------------------AGE 398
           WK   ++   G+  +SM  E  L                                  A E
Sbjct: 385 WKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHE 444

Query: 399 ESEKLKRPVQ----VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIR 454
           E  ++  PV+     +F++PYFT+SG++V YLKIEE+ LQY+S+PWVRY T +  +Y  +
Sbjct: 445 EKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQ 504

Query: 455 L 455
           +
Sbjct: 505 M 505

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 166/311 (53%), Gaps = 34/311 (10%)

Query: 162 NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E IN+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GLFS----KYLE----------GDENGVPIAPDDSSVDESKPKKKRSNNMELEDLK 266
           ND  G+ S    K+L           G++N +P              K  + ++ LED K
Sbjct: 256 NDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIP--------------KAAAGSVLLEDCK 301

Query: 267 FHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCR- 325
           FH+CV L KF     I F+PPDG  ELM Y +   I  L +    I THS    EI  R 
Sbjct: 302 FHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHSTRDNEIDYRI 360

Query: 326 -AKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYS 384
             K+    K +A +V + IPVP          S+G  K+VPE+NA++W+   + G  E +
Sbjct: 361 TLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 385 MAAEMGLPSTNAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRY 443
           ++A     S       ++  R P+ ++F++  F+ SG+ VRY  I  K+ ++++  W++Y
Sbjct: 421 LSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY 480

Query: 444 ITKSGDDYTIR 454
           I+K+G  Y +R
Sbjct: 481 ISKAG-SYEVR 490

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S +    ++G  +L++ +++ +  S  D F + + N     ++  P +      F  I
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +  H D L+LV I  S + N+A I+ FL+K+  V++ Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MM-DYGIPQITE 128
           M+   GIP  TE
Sbjct: 116 MLGGNGIPIDTE 127

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  164 bits (416), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 162/301 (53%), Gaps = 14/301 (4%)

Query: 162 NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GLFSKYLEGDENGVPIAPDDSSVDESKPK----KKRSNNMELEDLKFHQCVRLSKF 276
           ND  G+ S+    DE          S    + K    K  + ++ LED KFH+CV L KF
Sbjct: 256 NDSLGMQSE----DEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKF 311

Query: 277 ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCR--AKAQIKKKS 334
                I F+PPDG  ELM Y +   I  L +    I THS    EI  R   K+    K 
Sbjct: 312 NKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKL 370

Query: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394
           +A +V + IPVP          S+G  K+VPE+NA++W+   + G  E +++A     S 
Sbjct: 371 SAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSAVTVSTSD 430

Query: 395 NAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTI 453
                 ++  R P+ + F++  F+ SG+ VRY  I  K+ ++++  W++YI++SG  Y +
Sbjct: 431 TTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEV 489

Query: 454 R 454
           R
Sbjct: 490 R 490

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S +    ++G  +L++ +++ +  S  D F + + N     ++  P +      F  I
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +  H D L+LV I  S + N+A I+ FL+K+  V++ Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MM-DYGIPQITE 128
           M+   GIP  TE
Sbjct: 116 MLGGNGIPIDTE 127

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  164 bits (415), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 125/426 (29%), Positives = 207/426 (48%), Gaps = 54/426 (12%)

Query: 65  LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM-DYGI 123
           L++VAI  S + N+ +I+ FL+K+  +L+ Y     EE + + F++ YE++D M+    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQITE------------PKMLKQYITQXXXXXXXX------XXXXXXXXRPPTSLTNS-V 164
           P  TE            PK +    T                       +  +++T S +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 165 SWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDK 224
            WRP GIK+KKNE FL + E IN+L+++   +L++ + G + + S LSG P  + G+ND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLND- 241

Query: 225 GLFSKYLEGDENGVPIAPDDSSVD-----ESKPKKKRSNNMELEDLKFHQCVRLSKFENE 279
                YL    N +    D+   D     +    +  S+++++ED  FHQCV L KF +E
Sbjct: 242 -----YLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDE 296

Query: 280 KQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIF---CRAKAQIKKKS-- 334
           + I F+PPDG FELM Y +          D+NI      R+ I    C  + +I  KS  
Sbjct: 297 RLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIILKSLF 348

Query: 335 ----TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMG 390
               +A +  + IP+P          S G   +    N  +WK   + G  E  +  E  
Sbjct: 349 PTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILET- 407

Query: 391 LPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSG 448
           +PS++    S  +  + P+ + F+I  F+ SG+ V+YLK+ E+  +Y+   W++Y++KSG
Sbjct: 408 VPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSG 467

Query: 449 DDYTIR 454
             Y IR
Sbjct: 468 -SYEIR 472

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  164 bits (415), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 165/301 (54%), Gaps = 14/301 (4%)

Query: 162 NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGL 255

Query: 222 NDK-GLFSKYLEGDENGVPIAPDDSSVDESKPK----KKRSNNMELEDLKFHQCVRLSKF 276
           ND  G+ S   E  EN +    D  S +  + K    K  + ++ LED KFH+CV + KF
Sbjct: 256 NDSLGMQS---EDQENWLS-QQDQHSHNGFENKNCFPKAAAGSVLLEDCKFHECVSIDKF 311

Query: 277 ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCR--AKAQIKKKS 334
                I F+PPDG  ELM Y +   I  L +    I  HS    E+  R   K+    K 
Sbjct: 312 NKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHSARDNEVDYRITLKSLFPGKL 370

Query: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394
           +A +V + IPVP          S+G+ K+VPE+NA++W+   F G  E +++A     S 
Sbjct: 371 SAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENTLSAVTVSTSD 430

Query: 395 NAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTI 453
                 ++  R P+ + F++  F+ SG+ VRY  I  ++ ++++  W++YI+KSG  Y +
Sbjct: 431 TTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKWIKYISKSG-SYEV 489

Query: 454 R 454
           R
Sbjct: 490 R 490

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S +    ++G  +L++ +++ +  S  D F + + N     ++  P +      F  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +    ++L+LV I  S + N+A I+ FL+K+  V++ Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MM-DYGIPQITE 128
           M+   GIP  TE
Sbjct: 116 MLGGNGIPIDTE 127

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  164 bits (415), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/539 (25%), Positives = 235/539 (43%), Gaps = 116/539 (21%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILL-SNFEEETNLIPPCIEHNGIQFLF 59
           M+S     D    PL+ R  R   P   +D   + L +N +       P  E NG  +  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYLVAIA-TSISCNAALIFSFLHKVIEVLSEYLKA-VEEESIRDNFVIIYELLDE 117
           I  ++LY   I   + S +   +  +L ++ ++  +++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 MMDYGIPQITEPKMLKQYITQXXXXXXXXXXXXXXXXR--PPT-------------SLTN 162
             DYGI Q+T   ++  +I                     PP              ++T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGI 221
           +VSWRP+GI + KNE FLD+IE +  +M  +  V+R+ +I G +  +S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQ 281
           N                              K  + N   ++ LKFH+CV L     E+ 
Sbjct: 238 N------------------------------KLMQKNVHFMKRLKFHECVDLHTLIKEES 267

Query: 282 --ITFIPPDGDFELMSYRLSTAI--KPLI-----WCDVNIKTHSKSRIEIFCRAKAQIKK 332
             I FIPPDG+FEL +Y+L+  +  +P+I           + + +++ ++  +A      
Sbjct: 268 PVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHF 327

Query: 333 KSTATNVEILIPVP----------EDADTPVFKYSHGSIKYVPEKNAILWKIRTFPG--- 379
           K+  +  E+LI +P          +    P+FK   G + +     +I+WKI    G   
Sbjct: 328 KAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHG 387

Query: 380 -------------DKEYSMAAEMGL------PSTNAGEESEKLKRP-------------- 406
                        D++   A E+ L      P    G + E++                 
Sbjct: 388 NKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQ 447

Query: 407 ---------VQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456
                    + + F+IPY+  SG++V Y KIEE  L Y+S+PWVRY T + ++Y  ++S
Sbjct: 448 KEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEYIYQVS 506

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  160 bits (405), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 162/301 (53%), Gaps = 12/301 (3%)

Query: 161 TNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLG 220
           +N ++WR  GI HKK+E FL + E +N+L+++ G +L+S + G + + + L+G P  + G
Sbjct: 195 SNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFG 254

Query: 221 INDK-GLFSKYLEGDENGVPIAPDDSSVDESKPK---KKRSNNMELEDLKFHQCVRLSKF 276
           +ND  G+ S   E ++N +      S  D        K  + ++ LED KFH+CV + KF
Sbjct: 255 LNDSLGMQS---EDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDCKFHECVSIEKF 311

Query: 277 ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCR--AKAQIKKKS 334
                I FIPPDG  ELM Y +   I  L +    I +HS    EI  R   K+    K 
Sbjct: 312 NKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHSTRDNEIDYRITLKSLFPGKL 370

Query: 335 TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPST 394
           +A +V + IPVP          S+G  K+VPE+NA++W+   + G  E +++A     S 
Sbjct: 371 SAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSAATVSTSD 430

Query: 395 NAGEESEKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTI 453
                 ++  R P+ + F++  F+ SG+ VRY  I  K+ ++++  W++YI+KSG  Y +
Sbjct: 431 TTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKYISKSG-SYEV 489

Query: 454 R 454
           R
Sbjct: 490 R 490

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 9/132 (6%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M S +    ++G  +L++ +++ +  S  D F + + N     ++  P +      F  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVIN---NLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           +  H D L+LV I  S + N+A I+ FL+K+  V++ Y +   EE++++ F+I++E+LD 
Sbjct: 58  RSKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MM-DYGIPQITE 128
           M+   GIP  TE
Sbjct: 116 MLGGNGIPIDTE 127

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  159 bits (403), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 126/491 (25%), Positives = 225/491 (45%), Gaps = 113/491 (23%)

Query: 48  PCIEHNGIQFLFIQHNDLYLVAIATSIS-CNAALIFSFLHKVIEVLSEYL-KAVEEESIR 105
           P +++    ++FIQ + LY ++++  ++     ++FS+L+++  +  +YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELLDEMMDYGIPQITEPKMLKQYI----------------------------T 137
            NF +I+EL+DE +  G PQ+T+  +++ YI                            +
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDS 160

Query: 138 QXXXXXXXXXXXXXXXXRPPTSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVL 197
           +                    + T+++SWRP+GI + KNE +LD+IE +  L+  +   +
Sbjct: 161 KKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNI 220

Query: 198 RSEII-GEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKR 256
           +S  + G ++ +S LSGMP L +G+N     ++Y                        +R
Sbjct: 221 KSNTVYGYIQCRSYLSGMPMLTIGLNKLNSENEYF----------------------MRR 258

Query: 257 SNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIK--PLIW---CDVN 311
           +N        FHQCV L +   +K I+F PPDG+F+L +Y+L+  +   P+I    C V 
Sbjct: 259 AN--------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVK 310

Query: 312 IKTHSK----SRIEIFCRAKAQIKKKSTATNVEILIPVPE-----DAD---TPVFKYSHG 359
           +K         R+ +        K + + + + I +P+ +     D D    P FK   G
Sbjct: 311 LKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQG 370

Query: 360 SIKYVPEKNAILW---KIRTFPGDKEYSMAAEMGLPS-------------------TNAG 397
            + +    + +LW   K++   GDK   M +E  L +                      G
Sbjct: 371 KVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRG 430

Query: 398 EESEKLKRP-------------VQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYI 444
              EKL +              ++V+F+IPY+T SG++V +LKIEEK LQ++S+PWVRY 
Sbjct: 431 PHLEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYK 490

Query: 445 TKSGDDYTIRL 455
           T + D Y  +L
Sbjct: 491 TINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  150 bits (379), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 116/483 (24%), Positives = 233/483 (48%), Gaps = 39/483 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M +A+     +G  ++S+ ++  +  S  D F + + N     ++  P +      F ++
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVIN---SLDVRSPILTLGSTTFHYV 57

Query: 61  Q--HNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEM 118
           +     L++V+++ + + N+A  + FL+K   +L+ Y +   EE +++ F++ +ELLD M
Sbjct: 58  RTPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTM 115

Query: 119 MDYG-IPQITEPKML--------------------KQYITQXXXXXXXXXXXXXXXXRPP 157
           ++ G IP  T+P  +                    +Q  T                   P
Sbjct: 116 VEGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNP 175

Query: 158 TSLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDL 217
             ++       +G + K+NE  + + ESI++L+++ G +L++ + G + + +KL G    
Sbjct: 176 GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVC 235

Query: 218 KLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE 277
           + G+ND    S     +    P+   ++     + K      + L D KFHQCV L +F+
Sbjct: 236 QFGLNDS--LSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFD 293

Query: 278 NEKQITFIPPDGDFELMSYRLSTAIK-PLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTA 336
            ++ I F PP+G  ELM Y +   +  P     + I T + +  +     K+    K +A
Sbjct: 294 RDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPT-ANNETDYRVTIKSLFPGKLSA 352

Query: 337 TNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNA 396
            NV + IPVP          S+G+ K++PE+NA++WK   + G  E  ++A + +P+ + 
Sbjct: 353 KNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRDT 411

Query: 397 GEES-EKLKR-PVQVKFQIPYFTTSGIQVRYLKIEEK---NLQYKSYPWVRYITKSGDDY 451
            + + ++  R P+ + F+I  ++ +G+ VRY  + +K   N ++K+  W++Y++ SG  Y
Sbjct: 412 TQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSG-SY 470

Query: 452 TIR 454
            +R
Sbjct: 471 EVR 473

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  145 bits (365), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/337 (31%), Positives = 157/337 (46%), Gaps = 80/337 (23%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGIN 222
           VSWR +GI + +NE FLD++E +  LM     +++  +I G++  KS LSGMP LK+   
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIA-- 273

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQI 282
               F+K  + DE  +  +                        KFHQCV      NEK+I
Sbjct: 274 ----FNKLSQKDEQFISHS------------------------KFHQCVTWPS-SNEKEI 304

Query: 283 TFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIKTH-SKSRIEIFCRAKAQIKKKSTATN 338
            FIPPDGDF L  Y L   +K  P++      +K    K +I++ C  +   K +++ + 
Sbjct: 305 EFIPPDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTST 364

Query: 339 VEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAILWKIRTFPG---DKEYSMAA 387
           + + IP+         D   P  FK   G + +    + +LW I    G   D + SMAA
Sbjct: 365 LNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAA 424

Query: 388 EMGL-------------------PSTNAGEESEKL--------------KRPVQVKFQIP 414
           E  L                   P    G + E+L               R + +KF+IP
Sbjct: 425 EFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIP 484

Query: 415 YFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDY 451
           Y T SG+QV YLKI+E+ LQY+S+PWVRY T + ++Y
Sbjct: 485 YSTCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 74/140 (52%), Gaps = 9/140 (6%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S I+  D    PL+S+  +       I R  +  S +  E+    P I  +   F+ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILR--LFKSVYTPESQ---PVISASSFHFVHI 55

Query: 61  QHNDLYLVAI--ATSISCNAALIFSFLHKVIEVLSEYL--KAVEEESIRDNFVIIYELLD 116
           + + L  V++  A   S N  LI +FL +   +L +YL   A+++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EMMDYGIPQITEPKMLKQYI 136
           E +D+G+ QIT+  +++ YI
Sbjct: 116 ESIDFGVIQITDASIMRDYI 135

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  140 bits (352), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 168/367 (45%), Gaps = 103/367 (28%)

Query: 159 SLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDL 217
           + T +VSWR +GI + KNE FLD++ES+  LM  K +V+R  +I G++K KS LSGMP L
Sbjct: 220 TTTMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTL 279

Query: 218 KLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLS--- 274
           ++ +N      K L+ D+  +  A                        KFHQCV L+   
Sbjct: 280 RIALN------KILQDDKQFLGHA------------------------KFHQCVSLNSIN 309

Query: 275 -----------------KFENEKQITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIK- 313
                             F N+K+I FIPPDG+F L  Y L   +K  P+I     +IK 
Sbjct: 310 IKDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKP 369

Query: 314 THSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE--------DADTPVFKYSHGSIKYVP 365
              K R++I  + +   K++++ + + I IP+ +         +  P FK   G + +  
Sbjct: 370 NFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNI 429

Query: 366 EKNAILWKIRTFP---GDKEYSMAAEMGLPST---------------------------- 394
            ++ ++W+I       G+ E  M AE  L +                             
Sbjct: 430 SEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEEL 489

Query: 395 ------NAGEESEKLKRPVQ---VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYIT 445
                 N   E   LK   Q   ++F+IPY T SG++V YLKIEE  L+Y+S+PWVRY T
Sbjct: 490 YEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKT 549

Query: 446 KSGDDYT 452
            + D+Y 
Sbjct: 550 LNDDEYA 556

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEE-TNLIPPCIEHNGIQFLF 59
           M+S ++  D    PL+S+  +       +   P ++ +F+E  T   PP I  +   +++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYLVAIATSIS--C-NAALIFSFLHKVIEVLSEYLKA--VEEESIRDNFVIIYEL 114
           ++ + L+ VA    +   C N  +I  +L ++  +L  Y K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEMMDYGIPQITEPKMLKQYI 136
           +DE +D+GI Q+T+P +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  138 bits (348), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 163/347 (46%), Gaps = 84/347 (24%)

Query: 159 SLTNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDL 217
           + T  VSWR +GI + KNE FLD++E +  L   K +V+R  +I G++  KS LSGMP L
Sbjct: 231 TTTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKL 290

Query: 218 KLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE 277
           K+ +N      K L+ D   +  +                        KFHQCV L    
Sbjct: 291 KIALN------KLLQRDAQFMSHS------------------------KFHQCVALETL- 319

Query: 278 NEKQITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIKTH-SKSRIEIFCRAKAQIKKK 333
           NEK++ FIPPDG+F L  Y L   +   P++      IK    K ++ I    +   K +
Sbjct: 320 NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTR 379

Query: 334 STATNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAILWKI---RTFPGDKE 382
           ++ + + + IP+ +       D   P  FK + G + +    + +LW+I   R   G+ +
Sbjct: 380 NSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQ 439

Query: 383 YSMAAEMGL--------------------------------PSTNAGEESEKLKRPVQ-- 408
           +SM AE  L                                  T++ ++ E L + +Q  
Sbjct: 440 FSMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQ 499

Query: 409 ---VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
              + F+IPY T SG++V YLKIEE+ LQY+S+PWVRY T S ++Y 
Sbjct: 500 LVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 11/141 (7%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEE-ETNLIPPCIEHNGIQFLF 59
           M+S +Y  D    PL+S+  +      +I     L+  F+E  ++  PP + +    F+ 
Sbjct: 1   MSSCLYILDENLEPLISKNIK------SIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 60  IQHNDL-YLVAI-ATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
            + + L +L AI  T  S NA +I  ++ +   +L +YL   + +       ++  L   
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELL 114

Query: 118 MM--DYGIPQITEPKMLKQYI 136
               ++G+PQ+TEP ++K YI
Sbjct: 115 EESSEFGVPQMTEPSVMKDYI 135

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  135 bits (340), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 110/377 (29%), Positives = 164/377 (43%), Gaps = 118/377 (31%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD+IE +  L+  + G V RS I G++  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFEN---- 278
                 K L+ D+  +                          ++FHQCV L   E     
Sbjct: 309 ------KLLQNDKQFI------------------------SQVQFHQCVSLDSIEKVIKY 338

Query: 279 ------------------EKQITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIK-THS 316
                             E +I FIPPDGDF L SY L   I+  P++  C   I     
Sbjct: 339 AEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWK 398

Query: 317 KSRIEIFCRAKAQIKKKSTATNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKN 368
           K +++I    +   K  ++ + +++ IP+ +       D   P+ FK S+G + Y    +
Sbjct: 399 KYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDD 458

Query: 369 AILWKIRTFPGDKEY-------------SMAAEMGL-------------------PSTNA 396
            +LW+I    G K +             +MAAE GL                   P    
Sbjct: 459 FLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRT 518

Query: 397 GEESEKL---------------KRP------VQVKFQIPYFTTSGIQVRYLKIEEKNLQY 435
           G + E +               ++P      + + F+IPY T SG++V YLKI+E  LQY
Sbjct: 519 GPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQY 578

Query: 436 KSYPWVRYITKSGDDYT 452
           +S+PWVRY T + D+Y 
Sbjct: 579 QSFPWVRYKTINDDEYA 595

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 75/141 (53%), Gaps = 10/141 (7%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S+IY  D    PL+S+  +       ++    L      ++    P I+    +F++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYLVAIATSIS---CNAALIFSFLHKVIEVLSEYL--KAVEEESIRDNFVIIYELL 115
           + + LY VA+  +      N   I ++L ++ ++  +Y+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDYGIPQITEPKMLKQYI 136
           DE +DYGI Q+TEP ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  133 bits (335), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 153/347 (44%), Gaps = 88/347 (25%)

Query: 163 SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGI 221
           SVSWR +GI++ KNE FLD+IE +   M     +++  +I GE+  KS LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQ 281
           N                 I   D                 L   KFHQCV     +  K 
Sbjct: 282 N----------------KIIYQDKQF--------------LSSCKFHQCVMPDSVDEGKV 311

Query: 282 ITFIPPDGDFELMSYRLSTAIK-----PLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTA 336
           + F+PPDGDF L  Y L   +       LI  +V  K   K ++++F   ++  KK ++ 
Sbjct: 312 LEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNST 370

Query: 337 TNVEILIPVP---EDADTPVFK-----YSHGSIKYVPEKNAILWKIRTFP-GDKEYSMAA 387
           T + I IP+    E  D  + K        G I +    + +LW+I     G+ +  M A
Sbjct: 371 TKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGA 430

Query: 388 EMGLPS-----------------------------------------TNAGEESEKLK-R 405
           +  L +                                         T  GE S++ K  
Sbjct: 431 DFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGN 490

Query: 406 PVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
            +++ F+IPY T+SG++V YLKIEE NLQY+++PWVRY T S D Y 
Sbjct: 491 LIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 71/144 (49%), Gaps = 18/144 (12%)

Query: 1   MASAIYFCDNKGRPLLSRKYRD----DIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQ 56
           M+S +Y  +     LLS+  +     DIP S   +       F +     P  I  + I 
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLSLFKK------QFHKHQVTTPVIIYEDYI- 53

Query: 57  FLFIQHNDLYLVAIATSISCNAALI--FSFLHKVIEVLSEY--LKAVEEESIRDNFVIIY 112
           F  IQ + LY V+   SI C   ++    +L++   +L  Y  +K +++  I DN V I 
Sbjct: 54  FTCIQRDTLYFVS---SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPIL 110

Query: 113 ELLDEMMDYGIPQITEPKMLKQYI 136
           EL++E +D+GI QIT+  ++K YI
Sbjct: 111 ELIEESVDFGIIQITDSNLMKDYI 134

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  131 bits (329), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 120/473 (25%), Positives = 221/473 (46%), Gaps = 63/473 (13%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPI-LLSNFEEETNLIPPCIEHNGIQFLF 59
           M SAI     +G  ++S+ YR++I  S  + F I +++NF    N+  P +      F  
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNF----NVRSPILTLGSTTFHH 56

Query: 60  IQH-------NDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIY 112
           I+        ++L+LV +  + + N+A I+ FL K+  +L +Y     E  ++D F+ ++
Sbjct: 57  IRSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVH 114

Query: 113 ELLDEMM-DYGIPQITEPKML--KQYITQXXXXXXXXXXXXXXXXRPPTSLTN---SVSW 166
           E+LD M+   GI Q T+ K +  K  +                  R  T LT    + S 
Sbjct: 115 EILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSL 174

Query: 167 RPEGIK--HKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDK 224
            P      HKKNE F  + ES+N+L+++ G +L++ + G++++KS L+G P  +  + D 
Sbjct: 175 IPTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVD- 233

Query: 225 GLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITF 284
                                  D++K          + D KF QC+   +    + +  
Sbjct: 234 -----------------------DQTK----------ITDFKFDQCIEKVQ---SRTVRV 257

Query: 285 IPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIP 344
              DG+ E+++Y +      + +    I +  K  ++     K+   K  +AT+V + IP
Sbjct: 258 AATDGELEIVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKSLFPKNLSATDVVLTIP 317

Query: 345 VPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLK 404
           VP +        S+G  K+  E+NA++W    F G  E +++A + +         E   
Sbjct: 318 VPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA-ITIADGRQIMNLESWT 376

Query: 405 RP-VQVKFQIPYFTTSGIQVRYLKIEEKN-LQYKSYPWVRYITKSGDDYTIRL 455
           RP +Q+ F+I  ++ SG+ +R L I +K+  +YK+  W++YI+++G  Y +R 
Sbjct: 377 RPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG-SYEMRF 428

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  132 bits (332), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 109/371 (29%), Positives = 163/371 (43%), Gaps = 112/371 (30%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +  LM  +KG + ++ I GE+  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE----- 277
                 K L  D                 P+   ++N       FHQCV L         
Sbjct: 313 ------KILNRD-----------------PQFMSNSN-------FHQCVSLDSINTIEKG 342

Query: 278 --------------NEKQITFIPPDGDFELMSYRLSTAIK--PLIWC-DVNIKTH-SKSR 319
                         + ++I F+PPDG+F L  Y L   +K  P+I   D  IK    KS+
Sbjct: 343 QEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSK 402

Query: 320 IEIFCRAKAQIKKKSTATNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAIL 371
           I+I  + +   K  ++ + + + IP+         D    + FK ++G + +    + +L
Sbjct: 403 IQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLL 462

Query: 372 WKIRTFPGDKE----------------YSMAAEMGL-------------------PSTNA 396
           W+I+T  G +E                 SM AE  L                   P    
Sbjct: 463 WEIQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRT 522

Query: 397 GEESEKL---------------KRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWV 441
           G + E+L                R V + F+IPY T SG++V YLK+EE  LQY+S+PWV
Sbjct: 523 GPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWV 582

Query: 442 RYITKSGDDYT 452
           RY T + ++Y 
Sbjct: 583 RYKTVNDEEYA 593

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 82/142 (57%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEE-ETNLIPPCIEHNGIQFLF 59
           M+S+++  D    P++S+  R      A+     +LS+F++   +  PP +  N   F+ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDLYLVA-IATSISCNAAL--IFSFLHKVIEVLSEY--LKAVEEESIRDNFVIIYEL 114
           ++ + L+LV+ I T+   N  L  I +FL +   +L +Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITEPKMLKQYI 136
           +DE +D+GI Q+T+P ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  130 bits (327), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 106/367 (28%), Positives = 157/367 (42%), Gaps = 109/367 (29%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +   M  K  V+R  +I GE+  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE----- 277
                 K L+ D                           L ++KFHQCV L         
Sbjct: 310 ------KILKQDVQF------------------------LSNVKFHQCVSLDSIRARSNP 339

Query: 278 ------------------NEKQITFIPPDGDFELMSYRLSTAIK--PLIWC---DVNIKT 314
                             N+ +I FIPPDG+F L  Y L   +K  P+I     ++  K 
Sbjct: 340 PAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKL 399

Query: 315 HSKSRIEIFCRAKAQIKKKSTATNVEILIPVP--------EDADTPVFKYSHGSIKYVPE 366
           H K +I+I    +   K  ++ + + + IP+         + +  P FK   G++ +   
Sbjct: 400 H-KFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLS 458

Query: 367 KNAILWKIRTF---PGDKEYSMAAEMGL-------------------PSTNAGEESEKLK 404
              +LW++ T     G+   SM AE  L                   P    G + E+L 
Sbjct: 459 DKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELY 518

Query: 405 RPVQ-------------------VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYIT 445
           + +                    + F++PY T SG+++ YLKIEE  LQY+S+PWVRY T
Sbjct: 519 KKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKT 578

Query: 446 KSGDDYT 452
            S D+Y 
Sbjct: 579 ISDDEYA 585

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEE--ETNLIPPCIEHNGI--Q 56
           M+S+I+  D    P++ +  R      A+   P L++ F+E   +N + P    N I  Q
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  FLFIQHNDL-YLVAIATSISCNAALIFSFLHKVIEVLSEYLKA--VEEESIRDNFVIIYE 113
           FL I+ + L +L  +  +  CN   +F++L +  ++L +YL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDYGIPQITEPKMLKQYI 136
           L+DE +D+G+ Q T+  ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  129 bits (324), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 163/353 (46%), Gaps = 94/353 (26%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD+IE +  LM    G++ ++ I GE+K K  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE----- 277
                 K ++ DE  +                  SN+      KFHQCV ++  +     
Sbjct: 276 ------KLIKNDEQFI------------------SNS------KFHQCVSINSLKREINN 305

Query: 278 -------NEKQITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIKTH-SKSRIEIFCRA 326
                  + K+I FIPPDG+F L  Y L   ++  P+I   ++ IK    K +I+I    
Sbjct: 306 EEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTI 365

Query: 327 KAQIKKKSTATNVEILIPVP--------EDADTPVFKYSHGSIKYVPEKNAILWKIRTFP 378
           +   KK+++ + + I IP+         +    P FK   G + +    + ++W++ +  
Sbjct: 366 ETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMK 425

Query: 379 G-----------------DKEYS-----MAAEMGLPSTNAGEESEKL------------- 403
           G                  +EY      M   M  P    G + E++             
Sbjct: 426 GGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDK 485

Query: 404 ----KRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
               ++ + +KF++PY T SG++V YLKIEE  + Y+S+PWVRY T + D+Y 
Sbjct: 486 NGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60
           M+S ++  D    PL+S+  +     + I  F  L  N++E     PP        ++FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHNDL-YLVAIATS---ISCNAALIFSFLHKVIEVLSEYLK--AVEEESIRDNFVIIYEL 114
           + + L ++ AI  +   I+   AL F +L ++  +L  Y    +++   + DN ++I EL
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTF-YLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIEL 114

Query: 115 LDEMMDYGIPQITEPKMLKQYI 136
           +DE MD+GI Q+T+P ++K YI
Sbjct: 115 IDESMDFGIVQLTDPSIIKDYI 136

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  128 bits (321), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 162/354 (45%), Gaps = 78/354 (22%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +  LM  +KG + ++ I GE+  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGLFSKYLEGDENGVPIAPDDS--SVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEK 280
                 K L  D   +  +      S+D  K  +KR    E ED        L    + K
Sbjct: 320 ------KILNRDAQFLSNSSFHQCVSLDSIKTIEKRE---EKED----DDTGLQAAADAK 366

Query: 281 QITFIPPDGDFELMSYRLSTAIK--PLIWC-DVNIKTH-SKSRIEIFCRAKAQIKKKSTA 336
           ++ F+PPDG+F L  Y L   +K  P+I   D  IK    K +I+I  + +   K  ++ 
Sbjct: 367 ELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKPTNST 426

Query: 337 TNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAILWKIRTFPGDKEY----- 383
           + + + IP+ +       D    + FK + G + +    + +LW+I+   G +E+     
Sbjct: 427 SKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHNTNKT 486

Query: 384 -----------SMAAE-------------------MGLPSTNAGEESEKLKRPVQ----- 408
                      SM AE                   M  P    G   E+L R V      
Sbjct: 487 SQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHDQQIA 546

Query: 409 ----------VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
                     + F+IPY T SG+++ YLK+EE  LQY+S+PWVRY T S D+Y 
Sbjct: 547 HVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 57/95 (60%), Gaps = 5/95 (5%)

Query: 47  PPCIEHNGIQFLFIQHNDLYLVAIATSI---SCNAALIFSFLHKVIEVLSEY--LKAVEE 101
           PP +  N   F+ ++ + L+ V++  +    + +   I +FL +   +L EY  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYI 136
           + I DN +++ EL+DE +D+GI Q+T+P ++K YI
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYI 136

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  128 bits (321), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 158/375 (42%), Gaps = 116/375 (30%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +  LM  +KG + ++ I GE+  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE----- 277
                 K L  D    P    +SS                    FHQCV L         
Sbjct: 318 ------KILNRD----PQFMSNSS--------------------FHQCVSLDSINTIEKD 347

Query: 278 ---------------NEKQITFIPPDGDFELMSYRLSTAIK--PLIWC-DVNIKTH-SKS 318
                          + ++I FIPPDG+F L  Y L   +K  P++   D  IK    K 
Sbjct: 348 EEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKF 407

Query: 319 RIEIFCRAKAQIKKKSTATNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAI 370
           +I+I  + +   K  ++ + + + IP+ +       D    + FK + G + +    + +
Sbjct: 408 KIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFL 467

Query: 371 LWKIRTFPGDKEYS--------------------------------------MAAEMGLP 392
           LW+I+T  G +E+S                                      M   M  P
Sbjct: 468 LWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPP 527

Query: 393 STNAGEESEKLKRPVQ---------------VKFQIPYFTTSGIQVRYLKIEEKNLQYKS 437
               G   E+L R V                + F+IPY T SG++V YLK+EE  LQY+S
Sbjct: 528 PLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQS 587

Query: 438 YPWVRYITKSGDDYT 452
           +PWVRY T S ++Y 
Sbjct: 588 FPWVRYKTVSDEEYA 602

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEE-ETNLIPPCIEHNGIQFLF 59
           M+S+++  D    PL+S+  R      A+     +LS+F++   +  PP +  N   F+ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYLVAIATSI---SCNAALIFSFLHKVIEVLSEY--LKAVEEESIRDNFVIIYEL 114
           ++ + L+ V++  +    + +   I +FL +   +L +Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEMMDYGIPQITEPKMLKQYI 136
           +DE +D+GI Q+T+P ++K YI
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYI 136

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 159/372 (42%), Gaps = 113/372 (30%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +  LM  +KG + ++ I GE+  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE----- 277
                 K L  D   +                  SN+      KFHQCV L         
Sbjct: 312 ------KLLNRDPQFM------------------SNS------KFHQCVSLDSINIIEEE 341

Query: 278 -------------NEKQITFIPPDGDFELMSYRLSTAIK--PLIWCD-VNIKTH-SKSRI 320
                        + K+I FIPPDG+F L  Y L   +K  P+I      IK    K +I
Sbjct: 342 GRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKKFKI 401

Query: 321 EIFCRAKAQIKKKSTATNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAILW 372
           +I  + +   K  ++ + + + IP+ +       D    + FK + G + +    + +LW
Sbjct: 402 QIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLW 461

Query: 373 KIRTFPGDKE---------------YSMAAE-------------------MGLPSTNAGE 398
           +I T  G +E                SM AE                   M  P    G 
Sbjct: 462 EIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGP 521

Query: 399 ESEKLKRPVQ------------------VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPW 440
           + E+L + V                   V F+IPY T SG++V YLK+EE  LQY+S+PW
Sbjct: 522 KLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPW 581

Query: 441 VRYITKSGDDYT 452
           VRY T S D+Y 
Sbjct: 582 VRYKTISDDEYA 593

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNL-IPPCIEHNGIQFLF 59
           M+S+++  D    PL+S+  R      AI     +LS+F++  +   PP +  NG  F+ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYLVAIATSI---SCNAALIFSFLHKVIEVLSEY--LKAVEEESIRDNFVIIYEL 114
           ++ + L+ +++  +    + +   I +FL +   +L +Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMMDYGIPQITEPKMLKQYI 136
           +DE +D+GI Q+T+P ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 150/356 (42%), Gaps = 97/356 (27%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FL++IE +   M     V++  +I GE++ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE--NEK 280
                            I  +D                 L + KFHQCV L+  E  + K
Sbjct: 313 ----------------KIVNEDKQF--------------LANCKFHQCVSLASLESSDHK 342

Query: 281 QITFIPPDGDFELMSYRLSTAIK--PLI-WCDVNIKTHSKSRIEIFCRA-KAQIKKKSTA 336
            + F+PPDG+F L  Y L   ++  P++   +  +K   K          +   K  +  
Sbjct: 343 DVEFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETHFKTTNAT 402

Query: 337 TNVEILIPVPE-------DADTPV-FKYSHGSIKYVPEKNAILWKIRTFPG---DKEYSM 385
           + + + +P+ +       D    +  K   G+I +    + +LW++ +  G   + + SM
Sbjct: 403 SKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSM 462

Query: 386 AAEMGL-------------------PSTNAGEESEKLKRPVQ------------------ 408
             E  L                   P    G + E+L + +                   
Sbjct: 463 GVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRL 522

Query: 409 ------------VKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
                       + F++PY T+SG++V YLKIEE  L+Y+S+PWVRY T S  +Y 
Sbjct: 523 QPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 69/140 (49%), Gaps = 10/140 (7%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEE-ETNLIPPCIE-HNGIQFL 58
           M+S +Y  D     L+S+  +      A+      ++ F++   +  PP I+ H+   F 
Sbjct: 1   MSSVLYILDENLETLISKNIK------AVPSLEYPIAQFKKLYGSNAPPVIDYHDLFTFT 54

Query: 59  FIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYL--KAVEEESIRDNFVIIYELLD 116
           +IQ + L  V++   +         +L    EVL  YL  K +++  + DN V+I EL++
Sbjct: 55  YIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIE 114

Query: 117 EMMDYGIPQITEPKMLKQYI 136
           E +D+G  Q+T+  +L  YI
Sbjct: 115 ETIDFGAIQVTDSGLLADYI 134

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 110/230 (47%), Gaps = 46/230 (20%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEII-GEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E    +M  K  ++R  +I G++  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQI 282
                 K L+ D+                          L  L+FHQCV L   +N K+I
Sbjct: 347 ------KLLQKDQQF------------------------LSQLRFHQCVSLETIQN-KEI 375

Query: 283 TFIPPDGDFELMSYRLSTAIK-----PLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTAT 337
            FIPPDG+F L  Y L   +K      LI  ++  K   K +I+I        K +++ +
Sbjct: 376 EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTS 434

Query: 338 NVEILIPVPEDAD--------TPVFKYSHGSIKYVPEKNAILWKIRTFPG 379
            + + IP+ +  +        +P FK + G +K+    + +LW+I +  G
Sbjct: 435 ILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKG 484

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (73%)

Query: 407 VQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
           + V F+IPY+  SG++V YLKIEE+ L Y+S+PWVRY T +  DY 
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDYV 654

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEE--TNLIP-PCIEHNGIQF 57
           M S I+  D    PL+S+  R      AI  F  ++  F +   TN    P +  N   F
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDL-YLVAIATSISCNAALIFS-FLHKVIEVLSEYLKA--VEEESIRDNFVIIYE 113
           + I+ + L +L AI  +   +  +  S +L K   +L  +LK   +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEMMDYGIPQITEPKMLKQYI 136
           L+DE +D+GI Q+T+P ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 114/271 (42%), Gaps = 69/271 (25%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMT-QKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD+IE +   M  +KG + ++ I GE+  K  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKF------ 276
                            I  +DS                L +  FHQCV L         
Sbjct: 355 ----------------KILQNDSQF--------------LSNAHFHQCVSLDSLHLQSAE 384

Query: 277 -----------ENE--------KQITFIPPDGDFELMSYRLSTAIK--PLIWCDV-NIKT 314
                      ENE        K+I FIPPDGDF L  Y L   +K  P+I   + +IK 
Sbjct: 385 DDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKP 444

Query: 315 H-SKSRIEIFCRAKAQIKKKSTATNVEILIPVPE-------DADTPV-FKYSHGSIKYVP 365
             SK +++I    +   K  +  + + + IP+         D    + FK   G + +  
Sbjct: 445 KLSKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNL 504

Query: 366 EKNAILWKIRTFPGDK-EYSMAAEMGLPSTN 395
             N ++W+I +  G   E +M+     P  N
Sbjct: 505 SDNFLIWEIGSMKGGHGEVTMSMMAEFPIFN 535

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 24/160 (15%)

Query: 1   MASAIYFCDNKGRPLLSRKYRDD-------IPFSAIDR--------------FPILLSNF 39
           M+S I+  D    P+L++  R         + F  I R               PIL +N 
Sbjct: 1   MSSCIFILDENLEPILNKNIRSIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPILNTND 60

Query: 40  EEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALI-FSFLHKVIEVLSEYLKA 98
              +N       + G QFL I+ + L  V+I  + S N+ +I FS+L +  ++L  YL  
Sbjct: 61  YGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNV 120

Query: 99  --VEEESIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYI 136
             +++  + DNF+++ ELLDE +D+GI Q T+  ++K YI
Sbjct: 121 TKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI 160

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 37/46 (80%)

Query: 407 VQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYT 452
           +++ F+IPY+T SG+++ YLKIEE  LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 157/420 (37%), Gaps = 89/420 (21%)

Query: 82  FSFLHKVIEVLSEYLK--AVEEESIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYI--- 136
           F FL  V  +L++Y     ++   I  N+  +  L + M+D G P IT+   LK+ +   
Sbjct: 96  FVFLQTVDTILNQYFGKDVLKASKITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLK 155

Query: 137 ----------------TQXXXXXXXXXXXXXXXXRPPTSLT-----NSVSWRPEGIKHKK 175
                           T                 R  +S++      +V WR  G+K+  
Sbjct: 156 NNFARVINSTASSIGKTISNAEGNQMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTN 215

Query: 176 NEAFLDIIESINMLMTQKGQV-----LRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKY 230
           NE ++D+ E++N+++ +         +   I GEV  K  LS  P ++L +N        
Sbjct: 216 NELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELDLN-------- 267

Query: 231 LEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE-NEKQITFIPPDG 289
             G + G+P                           FH+CVR    + +   + FIPPDG
Sbjct: 268 TNGHDLGIP--------------------------AFHRCVRTEGSDFHPGTLRFIPPDG 301

Query: 290 DFELMSYRL--------STAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEI 341
           DF LM Y +        +  +  L    V+  T    + + F   K  +       +VE 
Sbjct: 302 DFCLMEYNIDLDSLRNRNKILSNLGLVSVDYHTGLGPKKDEF-EIKVTVALSRNVKHVED 360

Query: 342 LI------PVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTN 395
           L       P+ ED    + + +HG       +N I  K  T+  DKE  +     L    
Sbjct: 361 LKIDVHFDPLREDGKIKILRNTHGGF-----ENGINNK-GTWTFDKETPVGVFPVLRGCI 414

Query: 396 AGEESEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEK-NLQYKSYPWVRYITKSGDDYTIR 454
            G       + + + +       SGI+V  + I        K +  V+YITK G DY +R
Sbjct: 415 EGCTEPTWPKYLSMSYSNKGQLPSGIRVNSVNILSGFPAGVKPFKGVKYITKIG-DYVVR 473

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 126/321 (39%), Gaps = 71/321 (22%)

Query: 155 RPPTSLTNSVSWRPEGIKHKKNEAFLDIIESINMLM-----TQKGQVLRSEIIGEVKVKS 209
           + P +    V WR  G+K+  NE ++D++E++++++     T +   +R  + G V  +S
Sbjct: 177 KGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRS 236

Query: 210 KLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQ 269
            LSG P + L +         L G + G+P                            HQ
Sbjct: 237 HLSGNPVIALNLR--------LRGHDLGMP--------------------------ALHQ 262

Query: 270 CVRLSKFENEKQITFIPPDGDFELMSYRL---STAIKPLIWCDVNIKTHSKSRIEIF--- 323
           C   S      Q+ F+PPDG F+LM Y +   S   K  ++ ++ + +    R E+    
Sbjct: 263 CCLDSYQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLVS-PDYRTELGDLG 321

Query: 324 --CRAKAQIKKKSTATNVEILI------PVPEDADTPVFKYSHGSIKYVPEKNAILWKIR 375
                   I     A  V+ L+      P+P +    V + +HG  +     N   W   
Sbjct: 322 DEFEVNLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVF- 380

Query: 376 TFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTT----SGIQVRYLKI--- 428
               DKE        LP      E+   ++   ++  + Y       SGI+V  + I   
Sbjct: 381 ----DKETPTGT---LPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSG 433

Query: 429 EEKNLQYKSYPWVRYITKSGD 449
             KN+  K +  V+YI K+GD
Sbjct: 434 LSKNI--KPFKGVKYIAKTGD 452

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 63/147 (42%), Gaps = 46/147 (31%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLR----------SEIIGEVKVKSKLSG 213
           V WR  G+K+  NE ++D+ ESI+++  + G+  R            I G+  VK  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRL 273
            P + L ++        L G++ GVP                           FH+CV L
Sbjct: 271 NPTVDLQLD--------LAGNDLGVP--------------------------AFHECVEL 296

Query: 274 SKFENEKQ--ITFIPPDGDFELMSYRL 298
              +N     + FIPPDG F LM Y +
Sbjct: 297 DNHQNPSNCDLRFIPPDGRFNLMQYSI 323

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 50/153 (32%)

Query: 163 SVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQ----------VLRSEIIGEVKVKSKLS 212
           +V WR   + H  NE +LD++ESI++++  K +          ++   IIG+  VKS L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVR 272
           G P +++ I+  G                                   +LE +  H+CV+
Sbjct: 261 GNPIVEMKIDMAG----------------------------------NDLESIFLHECVK 286

Query: 273 L------SKFENEKQITFIPPDGDFELMSYRLS 299
                   +FEN K I F+PPDG F+L  Y ++
Sbjct: 287 SKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 93/237 (39%), Gaps = 57/237 (24%)

Query: 84  FLHKVIEVLSEYL--KAVEEESIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYI----- 136
           FL +  +VL EY   +A+  + + +N   +  LL  M+D G   +T+   L+Q +     
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 137 --------TQXXXXXXXXXXXXXXXXRPPTS----LTNSVSWRPEGIKHKKNEAFLDIIE 184
                   T+                 P  +       +V WR    ++  NE ++D++E
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMLMTQKGQ---VLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIA 241
           ++N  + QKG    ++   + G++ VK  LSG P ++L                      
Sbjct: 161 TVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQL---------------------- 198

Query: 242 PDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRL 298
                       K R++   L++   H+CV L +      + F+PPDG F L  Y +
Sbjct: 199 ------------KLRTSGHPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 39/140 (27%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLM--TQK-GQV--LRSEIIGEVKVKSKLSGMPDLK 218
           V WR  G+K+  NE ++D++E+I++++  T+K GQ+  +R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFEN 278
           L +N        L G + GVP                            H C +     +
Sbjct: 246 LKLN--------LHGHDLGVP--------------------------ALHPCCQAQYTGS 271

Query: 279 EKQITFIPPDGDFELMSYRL 298
            + + F+PPDG F LM Y +
Sbjct: 272 PENLQFVPPDGKFRLMQYTI 291

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 94/230 (40%), Gaps = 53/230 (23%)

Query: 162 NSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMP--DLKL 219
           + V WR  GI +  NE F+D+ E IN ++ +KG++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENE 279
           G+ D  L   +L                                +  FH+C+   K  + 
Sbjct: 267 GLLDHKL--SHL--------------------------------NTTFHRCILEDKANSI 292

Query: 280 K--------QITFIPPDGDFELMSYRLSTAIKP--LIWCDVNIKTHSKSRIEIFCRAKAQ 329
                    ++TF+PPDG   L  Y L    +   L   DVN+++    R++ F   +  
Sbjct: 293 NDLIAGKFTKLTFVPPDGRTRLCQYTLPLVKRDSNLGIIDVNLQSSLGKRLDEF-EVRVT 351

Query: 330 IKKKSTATNVE-----ILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKI 374
           +   +T   +E     I +         V + +HG ++    +  + W +
Sbjct: 352 VGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHL 401

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 71/165 (43%), Gaps = 56/165 (33%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKG------------------QVLRSEIIGEV 205
           V WR   +K+  NE ++D+IE I+++  ++                   +++R++IIGE+
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVKSKLSGMPDLKLGINDKGLFSKYLEGDEN--------GVPIAPDDSSVDESKPKKKRS 257
            V+S LS  P +++ + D+    +     EN        G+P+                 
Sbjct: 316 NVRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLFKQLNLGLPM----------------- 358

Query: 258 NNMELEDLKFHQCVRLS--KFENE--KQITFIPPDGDFELMSYRL 298
                    FH CV +   K  N+  + I FIPPDG F LM Y +
Sbjct: 359 ---------FHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 40/146 (27%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLM-----TQKGQVLRSEIIGEVKVKSKLSGMPDLK 218
           V WR   +K+  +E ++DIIE+++++          Q++   I G+V VKS LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFEN 278
           + ++        L G+E   P                            HQCV + +  +
Sbjct: 252 MDMD--------LAGNEMYAP--------------------------SMHQCVEMPQ-GS 276

Query: 279 EKQITFIPPDGDFELMSYRLSTAIKP 304
              + FIPPDG+  L++Y +   + P
Sbjct: 277 PSSLCFIPPDGNCNLLNYTIDLDMNP 302

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 126/320 (39%), Gaps = 67/320 (20%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLM------TQKGQVLRSEIIGEVKVKSKLSGMPDL 217
           V WR + IK  +NE ++D+ E++ + +      + + ++L   I G V V S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 218 KLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKF- 276
           ++             G  +   I P                       KFH CV +++F 
Sbjct: 233 EVSF-----------GGCDFKDIIP-----------------------KFHDCVEVNEFL 258

Query: 277 -ENEKQITFIPPDGDFELMSYR--LSTAIKPLIWCD-VNIKTHSKSRIEIFCRAKAQIKK 332
             +   I FIPPDG F+LM Y   LS+    LI C+  N   +S    EI         K
Sbjct: 259 TNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKS-NK 317

Query: 333 KSTATNVEILIPVPE---DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGD--------K 381
                N+++ +        +   + + +HG  +Y   KN  ++      G         +
Sbjct: 318 VPKINNLQVCLNFENREGQSKVKILRNTHGRFEY--GKNTWIFDSELLTGTLPVLRGCVE 375

Query: 382 EYSMAAEMGLPSTNAGEESEKLK---RPVQVKFQIPYFTTSGIQVRYLKIEEKNL----Q 434
           E +   E G           KL+   R V + FQ      SG +V  + I   +     +
Sbjct: 376 EETKNEEDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQR 435

Query: 435 YKSYPWVRYITKSGDDYTIR 454
            + +  V+Y+TK+  +Y IR
Sbjct: 436 QQLFKGVKYVTKTS-NYEIR 454

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 42/143 (29%)

Query: 164 VSWRPEGI-KHKKNEAFLDIIESINMLMTQKGQVLR---SEIIGEVKVKSKLSGMPDLKL 219
           V WR     KH+ NE ++D++E+ ++++ +K   LR    +I G V V+S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENE 279
            +N  G        +E G+P                            H+CV ++  + E
Sbjct: 259 KLNTMG--------NEIGIP--------------------------SLHECVEIND-DGE 283

Query: 280 ---KQITFIPPDGDFELMSYRLS 299
                ITFIPPDG F L+ Y ++
Sbjct: 284 FTPSNITFIPPDGKFRLLEYSIN 306

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 69/154 (44%), Gaps = 54/154 (35%)

Query: 166 WRPEGIKHKKNEAFLDIIESINML----------MTQKGQVLRSEIIGEVK----VKSKL 211
           WR + +KH  NE ++D++ES++++          +T+  Q ++  + G +K    V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCV 271
           +G P ++L +         L G++ G P                           FH+CV
Sbjct: 263 NGNPLVELQLE--------LSGNDIGHP--------------------------SFHECV 288

Query: 272 RLSKF----ENE--KQITFIPPDGDFELMSYRLS 299
            + ++    +N     + FIPPDG F LM Y ++
Sbjct: 289 DIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 67/154 (43%), Gaps = 45/154 (29%)

Query: 155 RPPTSLTNS---VSWR-PEGIKHKKNEAFLDIIESINMLMTQKGQVLR---SEIIGEVKV 207
           R  TSL  +   V WR  +  KH+ NE ++D++E+ +++   K   LR     I G V V
Sbjct: 187 RGSTSLVENEEVVPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDV 246

Query: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKF 267
           +S L+  P + + +N  G        ++ GVP                            
Sbjct: 247 RSYLNNNPLVSVKLNTMG--------NDIGVPT--------------------------L 272

Query: 268 HQCVRLSKFENE---KQITFIPPDGDFELMSYRL 298
           H+CV + K + E     ITFIPPDG F L+ Y +
Sbjct: 273 HECVEI-KDDGEFLPSNITFIPPDGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 64/147 (43%), Gaps = 41/147 (27%)

Query: 164 VSWR-PEGIKHKKNEAFLDIIESINMLMTQKGQVLR---SEIIGEVKVKSKLSGMPDLKL 219
           V WR     KH+ NE ++D++E+ +++  +K   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSK-FEN 278
            +N  G        ++ G+P                            H CV ++    +
Sbjct: 259 KLNTMG--------NDIGIP--------------------------SLHDCVEINDGVFS 284

Query: 279 EKQITFIPPDGDFELMSYR--LSTAIK 303
              ITFIPPDG F L+ Y   LS+ +K
Sbjct: 285 PSNITFIPPDGKFRLLEYSVDLSSQVK 311

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 40/139 (28%)

Query: 164 VSWR-PEGIKHKKNEAFLDIIESINMLMTQKGQVLR---SEIIGEVKVKSKLSGMPDLKL 219
           V WR     KH+ NE +LD++E+ +++  +K   +R     I G + V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFE-- 277
            +N  G        ++ G+P                            H+CV ++     
Sbjct: 259 KLNTMG--------NDIGIP--------------------------SLHECVEINDGGVF 284

Query: 278 NEKQITFIPPDGDFELMSY 296
           +   ITFIPPDG F L+ Y
Sbjct: 285 SPSNITFIPPDGKFRLLEY 303

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 8/122 (6%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFI 60
           A+     KG+PLLSR++RD       DR   LLSNF+     ++     +E   +++++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITK----DRVMELLSNFQTLVANSSKQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T++  N       L+  ++ +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 14/125 (11%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQF 57
           A+      G+PLLSR++RD       DR   LLSNF+   NL+         +E   +++
Sbjct: 5   AVSITTKSGKPLLSRQFRDITK----DRVMELLSNFQ---NLVASSSREHTFVEEEHVRY 57

Query: 58  LFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           ++I  +D Y++ I T+   N       L+   + ++  LK   EE + ++   I    DE
Sbjct: 58  IYIPFDDYYIILI-TNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IISLG 121

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFI 60
           A+     +G+PLLSR++RD     + DR   LLSNF+    +++     +E   +++++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRD----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 156

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N       L    + ++ YL + +E  I +N   I    DE++ 
Sbjct: 157 PFDDYYIILI-TNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQITEPKMLKQYIT 137
            G  +      +  Y++
Sbjct: 216 MGYKENLSISQINTYLS 232

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRDDIPFSAIDRFPILLSNFEE-ETNLIP--PCIEHNGIQFLFIQHNDLYLV 68
           G+PLLSR++R+       DR   LLSNF+   TNL      +E N +++++   +D Y++
Sbjct: 13  GKPLLSRQFRELTK----DRVLELLSNFQSLVTNLSSEHTFVEGNHVRYVYRPFDDYYII 68

Query: 69  AIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYGIPQITE 128
            I T+   N     S L+ + + ++  L + +E  I D+   I    DE++  G  +   
Sbjct: 69  LI-TNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 PKMLKQYIT 137
              +  Y+T
Sbjct: 128 STQVTTYLT 136

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFI 60
           A+      G+PL+SR+++D     + DR   LLSNF+     ++     +E   +++++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKD----ISRDRIMELLSNFQGLVANSSRQHTFVEEEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N       L+   + ++ +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFI 60
           A       G+PLLSR++R+       DR   LLSNF+   + I      +E   +++++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTK----DRVMELLSNFQGLVSSISSDHTFVEDEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N     S L+   + ++ YL + +E  + DN   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 121 YGIPQITEPKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLTAAQVSTYLS 136

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFI 60
           A       G+PLLSR++R+       DR   LLSNF+     I      +E   +++++ 
Sbjct: 5   AASITTRTGKPLLSRQFREITK----DRVLELLSNFQSLVTNISSDHTFVEDEHVRYVYR 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N  +  S L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVV 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 65/137 (47%), Gaps = 8/137 (5%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFI 60
           A+     +G+PLLSR++R+     + DR   LLSNF+    +++     +E   +++++ 
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N       L    + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEVIT 119

Query: 121 YGIPQITEPKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLSMTQINTYLS 136

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 14/132 (10%)

Query: 12  GRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQFLFIQHNDL 65
           G+PLLSR++ D       DR   LLSNF+    L+         +E   +++L+   +D 
Sbjct: 13  GKPLLSRQFTD----VTKDRVMELLSNFQ---GLVAKGSSEHTYVEDEHVRYLYKPFDDY 65

Query: 66  YLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYGIPQ 125
           YL+ I T+   N     S L    + ++ YL + +E  I +N   I    DE++  G  +
Sbjct: 66  YLIII-TNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKE 124

Query: 126 ITEPKMLKQYIT 137
                 ++ Y+T
Sbjct: 125 NLTMAQVETYLT 136

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFI 60
           A+      G+PLLSR++RD     + DR   LLSNF+     ++     +E   +++++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRD----ISKDRVTELLSNFQGLVANSSSQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D Y++ I T+   N       L+   + ++  L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILI-TNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 57/157 (36%)

Query: 166 WR-PEGIKHKKNEAFLDIIESINMLMTQK-----------------GQV--LRSEIIGEV 205
           WR  + I + +NE + D+ E I ++  +K                 G +  +R  I G V
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 206 KVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDL 265
            ++  L+G P +++ +   GL        + G+P                          
Sbjct: 287 DMRCFLTGNPLVEIALKQGGL--------DIGIP-------------------------- 312

Query: 266 KFHQCV---RLSKFENEKQITFIPPDGDFELMSYRLS 299
            FH CV    L K E   +++FIPPDG F LM Y ++
Sbjct: 313 GFHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFIQHNDLYLV 68
           G+PLLSR++RD       DR   LLSNF+     I      +E   +++++   +D Y++
Sbjct: 13  GKPLLSRQFRD----LTKDRVMELLSNFQGLVANISSDHTFVEDEHVRYVYKPFDDYYII 68

Query: 69  AIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYG 122
            I T+   N     S L+   + ++  L   +E  I DN   I    DE++  G
Sbjct: 69  LI-TNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 14/125 (11%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQF 57
           A      +G+PLLSR+++D     + DR   LLSNF+   NL+         +E   +++
Sbjct: 58  AASITTRQGKPLLSRQFKD----LSKDRVLELLSNFQ---NLVTEISSDHTFVEDKHVRY 110

Query: 58  LFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           ++   ++ Y++ I T+   N     S L+   + ++ YL + +++ I  N   I    DE
Sbjct: 111 VYRPFDNYYIILI-TNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 169

Query: 118 MMDYG 122
           ++  G
Sbjct: 170 IVSMG 174

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 30  DRFPILLSNFEEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVI 89
           D  P++LS   +  N++    E++  + ++ ++  LY +   T    N  L    +H+ +
Sbjct: 36  DLTPLVLSRKAKMCNIV----EYSDHKVVYRRYASLYFICGITPEYDNELLTLELIHRYV 91

Query: 90  EVLSEYLKAVEEESIRDNFVIIYELLDEMM--DYGIPQITEPKMLKQ 134
           E +  Y   V E  I  NF   YE+L+EM+  D  I +  + ++L+Q
Sbjct: 92  ETMDSYFGNVCELDIIFNFSRAYEILNEMIMCDGSIAESGKAEVLQQ 138

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 63/165 (38%), Gaps = 68/165 (41%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESI-----NMLMTQKGQ-------------------VLRS 199
           V WR   IK+ KNE ++D+ E I     N +  +KG+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EIIGEVKVKSKLSGMP--DLKLGI--NDKGLFSKY----LEGDENGVPIAPDDSSVDESK 251
            I G + V+S L+G P  ++KL    ND G  S +    LEGD NG     DD  V +S 
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCGNDMGTPSLHPCVELEGDMNG-----DDDKVMDS- 372

Query: 252 PKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSY 296
                                         + FIPPDG F L  Y
Sbjct: 373 ------------------------------LKFIPPDGKFCLARY 387

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 33  PILLSNFEEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVL 92
           P++LS   +  N++    E++  + ++ ++  LY +   T  + N  L    +H+ +E +
Sbjct: 39  PLILSRKPKMCNIV----EYSDHKVVYRRYASLYFICGITPEADNELLTLEIIHRYVETM 94

Query: 93  SEYLKAVEEESIRDNFVIIYELLDEMM 119
             Y   V E  I  NF   Y +LDEM+
Sbjct: 95  DTYFGNVCELDIIFNFGKAYAILDEML 121

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 14/125 (11%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQF 57
           A      +G+PLLSR+++D     + DR   LLSNF+   NL+         +E   +++
Sbjct: 5   AASITTRQGKPLLSRQFKD----LSKDRVLELLSNFQ---NLVSEISSDHTFVEDKHVRY 57

Query: 58  LFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           ++   ++ Y++ I T+   N     + L+   + ++ YL + +++ I  N   I    DE
Sbjct: 58  VYRPFDNYYIILI-TNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 54/140 (38%), Gaps = 39/140 (27%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKG----QVLRSEIIGEVKVKSKLSGMPDLKL 219
           V WR   + +  NE ++D++E++ + + Q       V    I G++ +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVR-LSKFEN 278
            ++  G                         KP               H+C+   S   +
Sbjct: 255 NLHSAG----------------------HAFKPS------------ALHRCLDPSSSSFD 280

Query: 279 EKQITFIPPDGDFELMSYRL 298
              + FIPPDG F L+ Y +
Sbjct: 281 SSSLRFIPPDGKFTLLEYTI 300

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 14/125 (11%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQF 57
           A      +G+PLLSR+++D     + DR   LLSNF+   NL+         +E   +++
Sbjct: 5   AASITTRQGKPLLSRQFKD----LSKDRVLELLSNFQ---NLVSEISSDHTFVEDKHVRY 57

Query: 58  LFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           ++   ++ Y++ I T+   N     + L+   + ++ YL + +++ I  N   I    DE
Sbjct: 58  VYRPFDNYYIILI-TNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E++  + ++ ++  LY +   T+   N  LI   +H+ +E +  Y   V E  I  NF 
Sbjct: 52  VEYSDHKVVYRRYASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFS 111

Query: 110 IIYELLDEMM 119
             Y++LDEM+
Sbjct: 112 KAYDILDEMI 121

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           IE+N  + ++ ++  LY +   T    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IEYNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFS 111

Query: 110 IIYELLDEMM 119
            +Y++L+EM+
Sbjct: 112 KVYDILNEMI 121

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E+   + ++ ++  LY +   +S S N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  LEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFT 111

Query: 110 IIYELLDEMM--DYGIPQITEPKMLKQYIT 137
             YE+L+E++  D  + + ++  +L+  +T
Sbjct: 112 KAYEILNEVLVCDGSMTETSKQAILRSVMT 141

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E+N  + ++ ++  LY V   +    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM--DYGIPQITEPKMLKQ 134
             Y +LDE++  D  I + ++ ++LK 
Sbjct: 112 KAYSILDEVLICDGSITETSKKEVLKH 138

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 33  PILLSNFEEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVL 92
           P++LS   +  N++    E++  +  + ++  LY +   T    N  L    +HK +E +
Sbjct: 39  PLILSRKAKMCNIL----EYSDHKVAYRRYASLYFICGITPDVDNELLTLEIIHKYVETM 94

Query: 93  SEYLKAVEEESIRDNFVIIYELLDEMM--DYGIPQITEPKMLK 133
            +Y   V E  I  NF   Y++L+EM+  D  + + ++  +LK
Sbjct: 95  DQYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLK 137

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFI 60
           A       G+PLLSR++ +     + DR   LLSNF+     I      +E   +++++ 
Sbjct: 5   AASITTRNGKPLLSRQFVE----MSKDRVMELLSNFQGLVANISSDHTYVEDEHVRYVYK 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             +D YL+ + T+   N     S L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIV 119

Query: 121 YGIPQITEPKMLKQYIT 137
            G  +    + +  YI+
Sbjct: 120 MGHKENLTIQQVNNYIS 136

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 56/161 (34%), Gaps = 62/161 (38%)

Query: 164 VSWRPEGIKHKKNEAFLDIIESINMLMTQKG---------------QVLRSEIIGEVKVK 208
           V WR  GIK  K E ++D+ E + +   +                 +++   I G + V+
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFH 268
             L+G P + L      +F     G++ G+P                           FH
Sbjct: 249 CYLNGNPTVSL------MFDTM--GNDLGIP--------------------------SFH 274

Query: 269 QCVRLS-------------KFENEKQITFIPPDGDFELMSY 296
            CV                 F+ ++ + F+PPDG F L  Y
Sbjct: 275 ACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQY 315

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 14/125 (11%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC------IEHNGIQF 57
           A      +G+PLLSR+++D     + DR   LL+NF+   NL+         +E   +++
Sbjct: 5   AASITTRQGKPLLSRQFKD----LSKDRVLELLANFQ---NLVAEISSDHTFVEDKHVRY 57

Query: 58  LFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117
           ++   ++ Y++ I T+   N     + L+   + ++ YL +  ++ I  N   I    DE
Sbjct: 58  VYRPFDNYYIILI-TNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDE 116

Query: 118 MMDYG 122
           ++  G
Sbjct: 117 IVSMG 121

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E++  + +F ++  LY +   T    N  L    +H+ +E +  Y + V E  I  NF 
Sbjct: 52  LEYSDHKVVFRRYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFH 111

Query: 110 IIYELLDE--MMDYGIPQITEPKMLKQ 134
             Y++LDE  M D  I + ++ ++L  
Sbjct: 112 KAYDILDELVMCDGAIAESSKKEVLHH 138

>Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           IE++  + ++ ++  L+ +   TS   N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IEYSDHKVVYKRYASLFFIVGVTSDVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM 119
            +Y++L+EM+
Sbjct: 112 KVYDILNEMI 121

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFIQHNDLYLV 68
           G+PLLSR++ +       DR   LLSNF+     I      +E   +++++   +D YL+
Sbjct: 13  GKPLLSRQFTEITK----DRVMELLSNFQGLVANISSDHTYVESEHVRYVYKPFDDYYLI 68

Query: 69  AIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYG 122
            + T+   N     S L+   + ++ YL + +E  I +N   I    DE++  G
Sbjct: 69  -LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIVMG 121

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPP---CIEHNGIQFLFI 60
           A       G+PLLSR++R+       +R   LLSNF+   + I      +E   +++++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTK----ERTMELLSNFQGLVSNISSDHTFLEDEHVRYVYR 60

Query: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120
             ++ Y++ I T+   N     S L+     ++ YL + +E  I DN   I    DE++ 
Sbjct: 61  PFDNYYIILI-TNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>KLLA0F22814g Chr6 complement(2119266..2119736) [471 bp, 156 aa]
           {ON} highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 6/112 (5%)

Query: 11  KGRPLLSRKYRDDIPFSAIDRFPIL---LSNFEEETNLIPPCIEHNGIQFLFIQHNDLYL 67
           +G+  L R Y+   PF    +  IL    +N     + +   +E+   + ++ ++  LY 
Sbjct: 13  QGKTRLIRWYQ---PFDIKYKHKILREVTTNVLSRKSKMCNILEYQDHKVVYKKYASLYF 69

Query: 68  VAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           +A     S N  L    +H+ +E +  Y   V E  I  NF   Y +LDEM+
Sbjct: 70  IAGIDLDSDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFSKAYSILDEMI 121

>TPHA0B03570 Chr2 complement(834660..835130) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E+   + ++ ++  LY +   +  S N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  VEYGDHKVVYRRYASLYFICGISQNSDNELLTLEIVHRYVETMDTYFGNVCELDIIFNFE 111

Query: 110 IIYELLDEMM--DYGIPQITEPKML 132
             Y +LDEM+  D  I + ++  +L
Sbjct: 112 KAYNILDEMIMCDGSITETSKSNVL 136

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRDDIPFSAIDRFPILLSNFE---EETNLIPPCIEHNGIQFLFIQHNDLYLV 68
           G+PLLSR++++      I+    LLSNF+    +++     +E   +++++   +D YL+
Sbjct: 13  GKPLLSRQFKELTKERVIE----LLSNFQGLVSKSSSDHTYVEDEHVRYVYRPFDDYYLI 68

Query: 69  AIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYG 122
            + T+   N     S L+   + ++ YL + +EE I  N   I    DE++  G
Sbjct: 69  -LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMG 121

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 28/59 (47%)

Query: 80  LIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYITQ 138
           +  S +H  +EVL  +   V E  I  NF   Y ++DEM   G  Q T  K L + I Q
Sbjct: 85  IYLSQIHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           IE++  + ++ ++  L+ +   T    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IEYSDHKVVYKRYASLFFIVGVTPDIDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM 119
            +Y++L+EM+
Sbjct: 112 KVYDILNEMI 121

>TDEL0D01170 Chr4 complement(219548..221554) [2007 bp, 668 aa] {ON}
           Anc_4.301 YLR424W
          Length = 668

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 315 HSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKY-VPEKNAILW 372
           H K  +E FC   A + +K      ++   V +D   PVFK S G+    +  K+ ILW
Sbjct: 593 HFKDVVEDFCAENAYVLQKLQGQYTQLPYGVHKDTLAPVFKISRGNSSVDIAMKDDILW 651

>Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           IE++  + ++ ++  L+ +   T    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IEYSDHKVVYKRYASLFFIVGVTPDVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFN 111

Query: 110 IIYELLDEMM 119
            +Y++L+EM+
Sbjct: 112 KVYDILNEMV 121

>Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON}
           YBR281C (REAL)
          Length = 875

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 78/189 (41%), Gaps = 33/189 (17%)

Query: 186 INMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDS 245
           +N    Q+G++L SE+       SK +    L  G ND  L    L    + VP++  D+
Sbjct: 357 VNHWNPQQGKILSSEVF------SKSAETVSLLTGGNDGSLTLWDLTSLLSAVPLS--DA 408

Query: 246 SVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLSTAIKPL 305
           S   +   +  SN   +         + +   NE+ +  +      EL+SY+  +  K  
Sbjct: 409 SQINASSTRHTSNAWAV--------YQPASLNNEEMLNTLR-----ELISYQTVSQSKD- 454

Query: 306 IWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVP 365
                   T S  R  I+ +   Q+  K  ATN + L P+P+     VF Y  G+ K  P
Sbjct: 455 -----TASTLSLRRCAIYLQ---QLFLKFGATNAQ-LFPLPDGGSPVVFAYFQGNGKTEP 505

Query: 366 --EKNAILW 372
             +K  ILW
Sbjct: 506 GSKKKRILW 514

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
          YFR051C
          Length = 543

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 49/98 (50%), Gaps = 9/98 (9%)

Query: 4  AIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPC----IEHNGIQFLF 59
          A     + G+PLLSR+++D     + DR   LLSNF+   +L        +E + +++++
Sbjct: 5  AASITTSNGKPLLSRQFKD----LSRDRVLELLSNFQNLVSLKHSSNHTFVEDDHVRYVY 60

Query: 60 IQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLK 97
             +D Y++ I T+   N     S L+   + ++ +L 
Sbjct: 61 KPFDDFYIILI-TNRQSNIVQDLSTLNLFSQTINAFLN 97

>KAFR0I02080 Chr9 (426510..426980) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           I+++  + ++ ++  LY +   +S   N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IDYSDHKVVYRRYASLYFICGISSDIDNELLTLEIIHRYVETMDTYFGNVCELDIIFNFS 111

Query: 110 IIYELLDEMM--DYGIPQITEPKML 132
             Y++L+EM+  D  I + ++  +L
Sbjct: 112 KAYDILNEMIMCDGSIAETSKKDIL 136

>NCAS0A08790 Chr1 (1739972..1740442) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 50/104 (48%), Gaps = 6/104 (5%)

Query: 33  PILLSNFEEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVL 92
           P++LS   +  N++    E++  +  + ++  LY +   T    N  L    +H+ +E +
Sbjct: 39  PLILSRKPKMCNIL----EYSDHKVAYRRYASLYFICGITPEVDNELLTLEVIHRYVETM 94

Query: 93  SEYLKAVEEESIRDNFVIIYELLDE--MMDYGIPQITEPKMLKQ 134
             Y   V E  I  +F   Y++L+E  M D  + + ++ ++LK 
Sbjct: 95  DSYFGNVCELDIIFHFTKAYDILNELIMCDGSLAETSKKEILKN 138

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           IE+   + ++ ++  L+ V   +    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  IEYQDHKVVYKRYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFT 111

Query: 110 IIYELLDE--MMDYGIPQITEPKMLKQYIT 137
             Y +LDE  M D    + ++  +LK   T
Sbjct: 112 RAYNILDELIMCDGSFVESSKTDVLKNMAT 141

>KNAG0I01390 Chr9 complement(269809..270279) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 30  DRFPILLSNFEEETNLIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVI 89
           D  P++L    +  N++    +++  + ++ ++  LY +   T    N  L    +H+ +
Sbjct: 36  DLTPLILGRKPKMCNIL----DYSDHKVIYRRYASLYFIIGITPNVDNELLCLDLVHRYV 91

Query: 90  EVLSEYLKAVEEESIRDNFVIIYELLDEMM 119
           E +  Y   V E  I  NF   Y++L+EM+
Sbjct: 92  ETMDVYFGNVCELDIIFNFAKAYDILNEMV 121

>Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C
           (APS2) - Clathrin-associated protein, small subunit
           [contig 43] FULL
          Length = 147

 Score = 30.0 bits (66), Expect = 6.5,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 53  NGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIY 112
           +  + ++ ++  LY V +   +     +  S +H ++EVL  +   V E  I  NF   Y
Sbjct: 58  DSTKLVYKRYAGLYFV-MGVGLQDEELIYLSHIHLLVEVLDAFFGNVCELDIVFNFHKAY 116

Query: 113 ELLDEMMDYGIPQITEPKMLKQYI 136
            +LDE++  G  Q T  ++L + I
Sbjct: 117 MILDELIIGGEIQETSKEVLLERI 140

>Kpol_1061.21 s1061 complement(58801..59271) [471 bp, 156 aa] {ON}
           complement(58801..59271) [471 nt, 157 aa]
          Length = 156

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%)

Query: 50  IEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFV 109
           +E    + ++ ++  LY V   T    N  L    +H+ +E +  Y   V E  I  NF 
Sbjct: 52  VEFGDHKVVYKRYASLYFVCGITQEVDNELLTLEVIHRFVETMDTYFGNVCELDIIFNFE 111

Query: 110 IIYELLDEMM 119
             Y +LD+M+
Sbjct: 112 KAYNILDDML 121

>NDAI0I00720 Chr9 complement(156237..158486) [2250 bp, 749 aa] {ON}
           Anc_6.281 YMR192W
          Length = 749

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 292 ELMSYRLSTAIKPLIW-CDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDAD 350
           EL++  +ST+I+P++W C  N+ T SK     F +          ++ V  +I     ++
Sbjct: 308 ELITNGISTSIRPIVWQCFSNVCTISKDEYNSFIQGDTDNNNNDDSSKVRRIIDAYLKSN 367

Query: 351 TPVFKYSHGSIKYV 364
             +  YS     YV
Sbjct: 368 NNLISYSSEMDSYV 381

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,979,304
Number of extensions: 2188272
Number of successful extensions: 7140
Number of sequences better than 10.0: 134
Number of HSP's gapped: 7126
Number of HSP's successfully gapped: 191
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)