Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J11792g6.46ON51051026720.0
NDAI0D008906.46ON5394689341e-120
ZYRO0C07172g6.46ON4504379181e-118
TDEL0G042406.46ON4444698981e-115
NCAS0H009006.46ON4954578951e-114
KAFR0L004206.46ON4604778241e-104
Suva_13.1176.46ON5134938211e-103
YML043C (RRN11)6.46ON5074858071e-101
SAKL0E01980g6.46ON4654858031e-101
Smik_13.1066.46ON5064797971e-100
Skud_13.1056.46ON5124857909e-99
KLTH0C10582g6.46ON4815057522e-93
Kwal_56.225276.46ON4814477052e-86
KLLA0C05852g6.46ON4824836948e-85
ACL020W6.46ON5394896543e-78
Ecym_30496.46ON5014846487e-78
KNAG0E009106.46ON4865046355e-76
TBLA0B005706.46ON5174875852e-68
TPHA0J005106.46ON4374785286e-61
Kpol_1037.116.46ON4014404672e-52
ABR149W7.488ON1226164771.0
Ecym_83838.126ON147996742.1
Suva_10.5324.288ON57662723.5
Smik_12.5044.288ON57058723.6
YJL039C (NUP192)5.261ON168351714.9
Smik_10.2155.261ON168351715.1
Skud_10.521.185ON559173705.6
KLTH0D14762g4.267ON104435706.9
Suva_12.375.261ON168351697.4
YLR417W (VPS36)4.288ON56655697.4
TDEL0B006608.831ON959123697.9
KAFR0K003806.201ON93339698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11792g
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...  1033   0.0  
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   364   e-120
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   358   e-118
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   350   e-115
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   349   e-114
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   322   e-104
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   320   e-103
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   315   e-101
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   313   e-101
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   311   e-100
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   308   9e-99
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   294   2e-93
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   276   2e-86
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   271   8e-85
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   256   3e-78
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   254   7e-78
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   249   5e-76
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   229   2e-68
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   207   6e-61
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   184   2e-52
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    34   1.0  
Ecym_8383 Chr8 (779290..783729) [4440 bp, 1479 aa] {ON} similar ...    33   2.1  
Suva_10.532 Chr10 (914757..916487) [1731 bp, 576 aa] {ON} YLR417...    32   3.5  
Smik_12.504 Chr12 (887706..889418) [1713 bp, 570 aa] {ON} YLR417...    32   3.6  
YJL039C Chr10 complement(368748..373799) [5052 bp, 1683 aa] {ON}...    32   4.9  
Smik_10.215 Chr10 (350516..355567) [5052 bp, 1683 aa] {ON} YJL03...    32   5.1  
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    32   5.6  
KLTH0D14762g Chr4 complement(1209483..1212617) [3135 bp, 1044 aa...    32   6.9  
Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON...    31   7.4  
YLR417W Chr12 (955010..956710) [1701 bp, 566 aa] {ON}  VPS36Comp...    31   7.4  
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...    31   7.9  
KAFR0K00380 Chr11 (82200..85001) [2802 bp, 933 aa] {ON} Anc_6.20...    31   8.0  

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/510 (97%), Positives = 497/510 (97%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60

Query: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120
           SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE
Sbjct: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120

Query: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180
           HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS
Sbjct: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180

Query: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240
           EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL
Sbjct: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240

Query: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300
           GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW
Sbjct: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300

Query: 301 NCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360
           NCLIKVTELISI             DNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW
Sbjct: 301 NCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360

Query: 361 FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ 420
           FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ
Sbjct: 361 FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ 420

Query: 421 FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG 480
           FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG
Sbjct: 421 FIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGNLVEEG 480

Query: 481 IDPVIKTHWEPTMNMDALKFNYNSTDDSSE 510
           IDPVIKTHWEPTMNMDALKFNYNSTDDSSE
Sbjct: 481 IDPVIKTHWEPTMNMDALKFNYNSTDDSSE 510

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  364 bits (934), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/468 (43%), Positives = 298/468 (63%), Gaps = 35/468 (7%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYH--AKRRSKRRRQANSLPTPENSAVENDQ 58
           MFE+PI YN +R   ER++RY YIN LS+KY+    R +        LPTPE+SA E+  
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 59  SESQLPSREQIKEKKMK------LGEDYSDSE---------AETSSEGEDTTKDDNEFAN 103
            +    S + IK K+++      +GE YSD++          E   + ED   D +E A+
Sbjct: 61  DDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDHHESAH 120

Query: 104 DMNKFE-KLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVE 162
            +++ E + F++KYEKP+ +FE+W      N  K+  + K+ I YT+L ++E+ AK+++ 
Sbjct: 121 HIHENEERKFFKKYEKPQETFEIW----QTNNLKRVPINKSMITYTKLKKIEKQAKRKIT 176

Query: 163 KNVVHMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRT 222
             ++H   +NK  F+  SEG E++ PLV I+++ L+HIE LT +L+ +VS+ NWDIAYR 
Sbjct: 177 VPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRI 236

Query: 223 FSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPV 282
           F+LLIRI ++DIR+IWG+G RIL E+   T++L+FL WM++VYSS+ NF+Q   +R  PV
Sbjct: 237 FTLLIRIKKLDIRSIWGIGVRILSEKS-PTKTLDFLNWMNSVYSSRLNFIQGINYRMDPV 295

Query: 283 FRSGSRTHTPKYALTWLWNCLIKVT--ELISIXXXXXXXXXXXXXDNGSKQSAMD----- 335
           F+SGSRTHTPKY LTWLW  LI+ +  ++IS              D  S +  +D     
Sbjct: 296 FKSGSRTHTPKYTLTWLWKSLIQYSTKKIIS----GNNNSNESLEDGSSSELDIDINIDR 351

Query: 336 -KLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQ 394
             L +LI+KISEMVL+PP+++D E+WFIYS+CHMV AD LS KFN    +GSR DI RNQ
Sbjct: 352 NNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISNGSRGDIERNQ 411

Query: 395 VTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPEN 442
           V QHI   K+YLQ    KG+FEYP+++I  +L  +E+R+Y  +    N
Sbjct: 412 VIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASDPTSNN 459

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 193/437 (44%), Positives = 266/437 (60%), Gaps = 35/437 (8%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFE+P+    +R    R+++YQYIN LS+KY         +    LPTPENSA E  ++E
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQ--TELPTPENSATETSENE 58

Query: 61  --SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEK 118
              Q   R   K  K  +GE YSD E   S E +   + DNE        E+ FYRKYEK
Sbjct: 59  EVGQQKRRRIRKRLKSIIGESYSDLE---SDEEQPVEEVDNE--------ERKFYRKYEK 107

Query: 119 PEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDI 178
           P+ +FE W      + +K+  +++  I+Y R+NR++R   +R+E ++      NK +F  
Sbjct: 108 PQLTFEKW----QCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHA 163

Query: 179 KSEGYEVLEPLVD-IDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNI 237
            ++GY++ +P     +++ LKHI  LT +L  +V +  W++AY+ F+LLIRIP VD+R +
Sbjct: 164 TTQGYQLFDPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTL 223

Query: 238 WGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALT 297
           WGLG RIL ER Q TRSLEFL+WMS+VYS+K  F     +R APVF  GS+THTPKY  T
Sbjct: 224 WGLGERILAER-QPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKYTTT 282

Query: 298 WLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDP 357
           WLW CLI+    +                    +SA +    L+D+ISEMVL PPY+DDP
Sbjct: 283 WLWECLIRYANGLEDLEM-------------DSKSAAENFQSLMDRISEMVLGPPYMDDP 329

Query: 358 EIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEY 417
           E+WFIY++CHMV AD LS +F+  RL+GS RDIA NQV QHI   K++LQ CS KG F +
Sbjct: 330 EVWFIYALCHMVKADTLSQQFD-PRLTGSARDIASNQVIQHIQNTKSHLQQCSSKGGFTF 388

Query: 418 PKQFIQSRLEEFEKRMY 434
           PK++I  +L  FE R+Y
Sbjct: 389 PKRYIARQLAAFEARLY 405

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  350 bits (898), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/469 (41%), Positives = 283/469 (60%), Gaps = 37/469 (7%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFE P+    RRL   +++RYQY+N LS K++   R +R    N LPTPENSA E+ ++E
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFN---RLERITNTNGLPTPENSAAESSENE 57

Query: 61  SQLPSREQIKEKKM--KLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEK 118
             L  +++   +++    GE YSDSE    S+  D   D+    ++    E+ F   YE 
Sbjct: 58  EALQRKKKRIRRRLKSAAGESYSDSE----SDEVDNNHDNEVVEDEEEDQERKFLNNYEL 113

Query: 119 PEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDI 178
           P+ SFE W D  S    K+  ++++ I +T+  R+ R AK+++  ++      NK Y D 
Sbjct: 114 PQESFEKWQDDPS----KRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDT 169

Query: 179 KSEGYEVLEPL-VDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNI 237
            SEG+E+++P+    D++ +KHI ILT +L   VS+  WD AY  F+LLIR+P+VDIRNI
Sbjct: 170 ISEGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNI 229

Query: 238 WGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALT 297
           WG+G  IL ER +  +SLEFL WMS+VYSS+  F +   HR  PVF  GS+TH PK+A T
Sbjct: 230 WGIGDLILRER-EPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKFATT 288

Query: 298 WLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQS--AMDKLTELIDKISEMVLVPPYLD 355
           W+W  LI+ T+                 + G  +   + D L +LI++ISEMVL PPY+D
Sbjct: 289 WMWESLIQCTK--------------NSLETGELEQIESNDGLQDLIERISEMVLAPPYMD 334

Query: 356 DPEIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNF 415
             E+WFIY +CH++ AD LS +F+  RL+GS RDIA NQV QHI   K+ LQ C  KG+F
Sbjct: 335 ASEVWFIYGLCHLIKADILSNQFDG-RLAGSARDIASNQVIQHIQRTKSCLQTCLSKGDF 393

Query: 416 EYPKQFIQSRLEEFEKRMYEDESKPENM-----KLQESYDNTSYSNEDD 459
           +YPK++I+ +LEEFEKR+   E  P++       L +  D  S  ++DD
Sbjct: 394 KYPKRYIERQLEEFEKRLDRQEDTPDDSDHEVESLHDKLDTQSIESDDD 442

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/457 (40%), Positives = 298/457 (65%), Gaps = 25/457 (5%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MF++P   + +R+  ER++RY YIN LSRKY+     ++  +++SLPTPENSA E+ +S 
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYN-----RQDAESSSLPTPENSASESHEST 55

Query: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120
            +    E+++ +++K        EA + ++ ++  +++ E     N+ E+ F++ +EKP+
Sbjct: 56  GE---DEEVRRRRLKRRWKNVIGEAVSDTDEDEDGEEEREDEGPENQ-ERRFFKTHEKPQ 111

Query: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180
            S+E+W    S +  K+  L+K  I +++LN++E+  K+R++ +++H    N   F+  S
Sbjct: 112 ESYEIW----STDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESIS 167

Query: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240
           +G E++ PL   +S+ LKHIE LT +L  +V +G W++AY+ F+L++RIP+VDIR+IWG+
Sbjct: 168 QGQELVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGI 227

Query: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300
           G +IL +R  TT +L+FL WM++VYSS+ N++Q   HR  PVFRSGS+TH+ K+ +TWLW
Sbjct: 228 GVKILSQRAATT-TLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKFTITWLW 286

Query: 301 NCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360
             LI  T+                 D+       DKL  LI+K+SE+VL+PP+++D E+W
Sbjct: 287 KSLIYCTD----------TDNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVW 336

Query: 361 FIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQ 420
           FIY++CHMV AD LS  FN  + +GS RDIARN+V Q+I  VKT+LQ    KG+FEYP++
Sbjct: 337 FIYALCHMVKADQLSLNFNLNQSNGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPER 396

Query: 421 FIQSRLEEFEKRMY-EDESKPENMKLQESYDNTSYSN 456
           FI  +L  FE+R+Y +DE+  ++    ES + +S  N
Sbjct: 397 FITRQLNTFEERLYSKDETNSKDKDNNESDNGSSMDN 433

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  322 bits (824), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/477 (38%), Positives = 291/477 (61%), Gaps = 56/477 (11%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFE+P+  N + L+ ER++RY+YIN  +R++      +R+   N + TPE S       E
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRF------ERKDDRNGMITPETS-------E 47

Query: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFAN--DMNKFEKLFYRKYEK 118
            +L  R++ ++    +GE  SD +  +  + +D  +++       ++N  E+ F++K +K
Sbjct: 48  DELQQRKK-RDWLHVIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNLNNEERKFFKKIDK 106

Query: 119 PEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDI 178
           P+ ++E W      + +KK  +++  + Y R N+V R  ++++  ++VH+   N+ +F  
Sbjct: 107 PQETYEHW-----PSHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRYHFKC 161

Query: 179 KSEGYEVLEPL-VDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNI 237
           K +G E++EPL     ++ LK IE LT +L+ +V++GNW+IAY+ F++LIRIP+VDIR++
Sbjct: 162 KIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVDIRSV 221

Query: 238 WGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALT 297
           W +G RIL E+ +  RSLEFL+WMS+VYS++  F+Q   +R  PVFRSGS+ HTPKY L 
Sbjct: 222 WNVGNRILYEKDKL-RSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKNHTPKYTLQ 280

Query: 298 WLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDP 357
           WLWN L++ TE +                    ++  + + +LIDKI+EMVL+PP++DDP
Sbjct: 281 WLWNSLLEYTEQLF-------------------ENDDENIDKLIDKIAEMVLIPPFMDDP 321

Query: 358 EIWFIYSMCHMVHADYLSGKFNCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQK--GNF 415
           EIWFIYSMCHMV AD+LS KF+   + GS RDI+ NQV QHI+ VK YL  C +K  G +
Sbjct: 322 EIWFIYSMCHMVKADFLSSKFDTHSV-GSMRDISMNQVIQHINDVKRYLNVCKEKSQGQY 380

Query: 416 EYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSF 472
           E  +  I  +L+ FE R+Y++   P               N+ D +N  ++DESN F
Sbjct: 381 ESNEMIITKQLKAFEVRLYKEPVFP-----------LEPENDLDGDNEEEVDESNVF 426

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/493 (38%), Positives = 287/493 (58%), Gaps = 53/493 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAV------ 54
           MFEVPIT   ++    R+++YQYIN +SR++   R +K+    +SLPTPENSA       
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRF--DRITKKSNTTDSLPTPENSAAENNDED 58

Query: 55  ----------ENDQSESQLPSREQIKEKKMK-----LGEDYSDSEAETSSEGEDTTKDD- 98
                     E+D  ES +  R+Q K ++ +     +GE YS +E E+ S+ ED  + D 
Sbjct: 59  YDDDEEERNYESDAGESSI--RQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQ 116

Query: 99  ----NEFANDMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVE 154
                    +    E+ F++KYEKPE SFEVW    +V++  K  + K  I Y    ++E
Sbjct: 117 VEHETRLKEEDTDEERKFWKKYEKPEKSFEVW---QTVSSHNKSPINKQKITYHNYKKIE 173

Query: 155 RIAKKRVEKNVVHMPLVNKRYFDIKSEGYEVLE-PLVDIDSYLLKHIEILTQILFSSVSQ 213
           + + +++E  ++H    NK YF + ++G E L+ P     +Y  +HI  LT +L  +VS+
Sbjct: 174 KNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSR 233

Query: 214 GNWDIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQ 273
            NW +AY+ F+ LIRIP V I++IWG+G +IL      + SL+FL+WM  VYSSK  FVQ
Sbjct: 234 HNWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRFVQ 293

Query: 274 SHCHRK-APVFRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQS 332
           +  +R   P F++GSRTHT K+A+T+LW+CLI   + I               DN   Q 
Sbjct: 294 NVNYRSVVPPFQTGSRTHTSKFAITYLWSCLISCQKSIE---------SSNATDN---QY 341

Query: 333 AMD--KLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF-NCQR---LSGS 386
            M+  +L ELID+ISE VL+PP+++D E++FIY+ CH++ AD LS +F N  R   L G 
Sbjct: 342 DMENSRLEELIDQISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNNDLVGL 401

Query: 387 RRDIARNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQ 446
            +DI  NQV ++IHYVK +LQ C  KG F  P + I+++L+ FE R+Y +       ++ 
Sbjct: 402 NKDIKINQVIKNIHYVKVFLQTCLDKGGFTIPNRLIENQLKSFESRLYGEAQDIHERRMV 461

Query: 447 ESYDNTSYSNEDD 459
           + YDNT  S+ D+
Sbjct: 462 DDYDNTDNSSADN 474

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  315 bits (807), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 285/485 (58%), Gaps = 46/485 (9%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND--- 57
           MFEVPIT   R+    R+++YQYIN +SR++   R SK+    +SLPTPENSA EN+   
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRF--DRISKKSTTTDSLPTPENSAAENNDEE 58

Query: 58  ---QSESQLPSREQIKEKKMK--------LGEDYSDSEAETSSEGEDTTKD---DNEFAN 103
               SE+    R  +++KK +        +GE YS +E+ET S+ E+T +    D     
Sbjct: 59  EGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDK 118

Query: 104 DMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEK 163
           + +  E+ F++KYEKPE SFE+W    +V+++ K  + K  + Y    ++E+I  +++E 
Sbjct: 119 EDSDEERKFWKKYEKPEKSFEIW---RTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEI 175

Query: 164 NVVHMPLVNKRYFDIKSEGYEVLEPL----VDIDSYLLKHIEILTQILFSSVSQGNWDIA 219
            ++H    NK YF   S G   LEPL     ++ +Y  +HI  LT +L  +VS+ NW +A
Sbjct: 176 PLLHCTKENKLYFQSISRG---LEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLA 232

Query: 220 YRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRK 279
           Y+ F+ LIRIP V I+++WG+G  IL     ++  L+FL+WM  +YSSK  FVQ+  +R 
Sbjct: 233 YKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRS 292

Query: 280 -APVFRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLT 338
             P F++GSRTHT K+A+T+LW+ LI   +  S+             +N       D L 
Sbjct: 293 IVPPFQTGSRTHTAKFAITYLWSSLINCQK--SMEPSSNIIDKPFDTEN-------DLLQ 343

Query: 339 ELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF----NCQRLSGSRRDIARNQ 394
           ELIDKISE VL PP+++D E+WFIY+ CH++ AD LS +F        L G  RDI  NQ
Sbjct: 344 ELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQ 403

Query: 395 VTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMY---EDESKPENMKLQESYDN 451
           V +HIHYV+T+L+ C  KG F  P + I+++L+ FE R+Y   +D  + +   + +S DN
Sbjct: 404 VIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDN 463

Query: 452 TSYSN 456
           +S  N
Sbjct: 464 SSVEN 468

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  313 bits (803), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/485 (38%), Positives = 285/485 (58%), Gaps = 30/485 (6%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFE+P+    +++  +R++RYQYIN L++K+    +   ++Q   LPTPE+SA E   ++
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKH---EQLNPKKQTVGLPTPESSAAETSDTD 57

Query: 61  SQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPE 120
            +L   +  + K+ K         A +SS+ +D ++++N+   +   +EK    KY KP+
Sbjct: 58  -ELEDSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECDYEKHVKNKYYKPQ 116

Query: 121 HSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKS 180
            ++E+W  G     + +  L  T + Y +  ++ + A +RV + + +    +  +F    
Sbjct: 117 ETYELWTTG----PENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIY 172

Query: 181 EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIWGL 240
            GYE  E    +++Y   HI  LT +L  +V + NW+IAYR FS+LIR+P VDIR+IWG+
Sbjct: 173 NGYEPYE-TSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGI 231

Query: 241 GTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTPKYALTWLW 300
           G RIL E  +  RS EFL+WMS+V+S+K NF Q   H   PVFRSGS+THTPK+  +WLW
Sbjct: 232 GVRILKEIDRK-RSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLW 290

Query: 301 NCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDDPEIW 360
             L+  T                  +NG++   ++KL  L +KISE+VL PPY+DDP+IW
Sbjct: 291 ETLMGCT--------------SKDENNGNRD--VNKLQFLTEKISELVLTPPYMDDPKIW 334

Query: 361 FIYSMCHMVHADYLSGKF--NCQRLSGSRRDIARNQVTQHIHYVKTYLQNCSQKGNFEYP 418
           FIY++CH+V AD+LS +F  N    +GSRRDIARNQV QHI   K +LQ C +KG F++P
Sbjct: 335 FIYALCHIVEADHLSQQFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFP 394

Query: 419 KQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEE-NPFQIDESNSFLGNLV 477
           KQ I+ +L  FE R+Y+      N    +S  +  ++ +D ++ NP   +E N F G L 
Sbjct: 395 KQHIEKQLSNFENRLYQRTEDLLNNFDSDSSASNEFNRQDFQDVNPIVYEEENVF-GELG 453

Query: 478 EEGID 482
           +   D
Sbjct: 454 DAQFD 458

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  311 bits (797), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/479 (39%), Positives = 280/479 (58%), Gaps = 48/479 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQSE 60
           MFEVPIT   ++    R+++YQYIN  SR++  ++  K+   A SLPTPENSA EN++ +
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRF--EKIVKKSTTALSLPTPENSAAENNEED 58

Query: 61  SQ-------------LPSREQIKEKKMK--LGEDYSDSEAETSSEGEDTTKDDNEFANDM 105
                          L  R++ +E+  K  +GE YS +E E+ S+ ED  +D  E  N  
Sbjct: 59  DGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQ-EDAEED--EECNTE 115

Query: 106 NKFEKL-----FYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKR 160
            K E +     F++KYEKPE SFEVW    +V+++ K  + K  + Y    ++E+ + ++
Sbjct: 116 GKEEDIDEERKFWKKYEKPEESFEVW---RTVSSQNKSPINKQKMTYHTFKKIEKNSLRK 172

Query: 161 VEKNVVHMPLVNKRYFDIKSEGYEVLEPLV-DIDSYLLKHIEILTQILFSSVSQGNWDIA 219
           +E  ++H    +K +F   S+G E L+P   ++ +Y  KHI  LT +L  +VS+ NW +A
Sbjct: 173 MEVPLLHCTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLA 232

Query: 220 YRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRK 279
           Y+ F+ LIRIP V I++IWG+G  IL      + SL+FL+WM  +YSSK  FVQS  +R 
Sbjct: 233 YKIFATLIRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRS 292

Query: 280 -APVFRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAM--DK 336
             P F++GSRTHT K+A T+LW+ LI   + + +             D   K+  M  D 
Sbjct: 293 IVPPFQTGSRTHTSKFATTYLWSSLITCQKSMEL------------PDINDKRYDMENDL 340

Query: 337 LTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF----NCQRLSGSRRDIAR 392
           L +LID+ISE VL PP+++D E+WFIY+ CH++ AD LS +F        L G  RDI  
Sbjct: 341 LQDLIDRISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFANDNKTSDLIGLDRDIKI 400

Query: 393 NQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDN 451
           NQV +HIHYVK +LQ CS KG F  P + I+S+L+ FE R+Y +       ++ + Y++
Sbjct: 401 NQVIKHIHYVKVFLQTCSDKGGFTVPNRLIESQLKGFESRLYGEAQDLREREMDDDYNS 459

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  308 bits (790), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 183/485 (37%), Positives = 274/485 (56%), Gaps = 44/485 (9%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAV------ 54
           MFEVPIT   ++    R+++YQYIN LSR++   + +K     +SLPTPENSAV      
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRF--DKVAKTTNTTDSLPTPENSAVENNDDD 58

Query: 55  -----------END---QSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNE 100
                      E D   +S  Q   R + +  K  +GE YS +E E+ S+ E+  ++D  
Sbjct: 59  YDYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGR 118

Query: 101 FANDMNKF---EKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIA 157
                N     E+ F++K+EKPE SFE+W    + + + K  + +  + Y +  ++++ +
Sbjct: 119 ETGRKNGDTDEERKFWKKHEKPERSFEIW---QTASLQNKGPINRRKMTYHKFQKIQKNS 175

Query: 158 KKRVEKNVVHMPLVNKRYFDIKSEGYEVLE-PLVDIDSYLLKHIEILTQILFSSVSQGNW 216
            ++V+  ++H    N+ YF   S+G E L+ P   I +Y  +HI  LT +L  +VS+ NW
Sbjct: 176 LRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNW 235

Query: 217 DIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHC 276
            +AYR F+ LIRIPEV +++IWG G +IL     ++ SL+FL+WM  +YSSK  FVQ+  
Sbjct: 236 SLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQNIN 295

Query: 277 HRK-APVFRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMD 335
           HR   P F++GSRTHT K+A T+LW  LI   + I               ++       D
Sbjct: 296 HRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIE----------PSTINDKHYDMEND 345

Query: 336 KLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF----NCQRLSGSRRDIA 391
           +L ELIDKISE VL PP+++D E+WFIY+ CH++ AD LS +F        L G  RDI 
Sbjct: 346 RLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIK 405

Query: 392 RNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDN 451
            NQV +HIHYVK +LQ C  KG F  P + I+ +L+ FE R+Y +    +  ++ + YD 
Sbjct: 406 INQVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDE 465

Query: 452 TSYSN 456
           T  S+
Sbjct: 466 TDISS 470

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  294 bits (752), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/505 (35%), Positives = 274/505 (54%), Gaps = 67/505 (13%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVE---- 55
           MFE+P+  N +R+   R++RYQYIN L ++Y   R+ +    ANS LPTPENSA E    
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEY---RKVQSFANANSTLPTPENSAAEEASD 57

Query: 56  NDQSESQLPSREQIKEKKM--KLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFY 113
            D + +   SR + +++++   LG       AET +E  D   ++     D    EK F+
Sbjct: 58  GDHNSADATSRRRRRKRRLLSVLGH------AETDTELSDMEAEEGSHEADQADSEKEFF 111

Query: 114 RKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNK 173
            ++EKP+ +FEVW    + + +K   +    + Y    ++E+ A+KRV   + H+     
Sbjct: 112 TRHEKPQETFEVW----NTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNAN 167

Query: 174 RYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVD 233
            +F    +GYE +    +  S+ L HI  L ++L +++ +G WD AYR FSLLIR+P +D
Sbjct: 168 FHFQAMKDGYETVAETPE--SHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGID 225

Query: 234 IRNIWGLGTRILMERGQTTRSL----EFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRT 289
           IR++WG G RIL E     + L    EFL W+S ++SS+ NF Q+      PVFR GS+T
Sbjct: 226 IRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKT 285

Query: 290 HTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMD----KLTELIDKIS 345
           H  K+ + WLW  L                      D     SA D    KL+ L++++S
Sbjct: 286 HAAKFVVAWLWELLFASCP-----------------DGTEHPSAEDASNRKLSHLLERLS 328

Query: 346 EMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGS--RRDIARNQVTQHIHYVK 403
           EMVL+PPY++DPE+WFI+++CH+V AD LS +F   +L  S   RDI+RNQVTQHI    
Sbjct: 329 EMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAH 388

Query: 404 TYLQNC-SQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEEN 462
             ++ C ++K  F +P++ I+ +L  FEKR+Y+               N+  S   D  +
Sbjct: 389 MCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQ---------------NSGESTASDLGS 433

Query: 463 PFQIDESNSFLG--NLVEEGIDPVI 485
            F++D S   L   N++  G+ P+I
Sbjct: 434 GFELDNSPENLDTQNVLGPGMSPMI 458

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  276 bits (705), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 251/447 (56%), Gaps = 37/447 (8%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVEN--- 56
           MFE+P+  N  R+   R++RYQYIN LS+++   RR +    A++ LPTPENSA E+   
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEH---RRIQDSAAAHATLPTPENSAAEDASD 57

Query: 57  -DQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRK 115
            DQ      SR + +++++     + DSE+E S    D         +++ + EK F+  
Sbjct: 58  GDQDSEDAGSRRRRRKRRILSVLGHIDSESELS----DVDMSTESHHSELQESEKEFFSH 113

Query: 116 YEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRY 175
           +EKP+ ++E W    + + +K   +    + Y     +E  A++RV + + H   + + +
Sbjct: 114 HEKPQDTYETW----NTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSH 169

Query: 176 FDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIR 235
           F+    GYE+      +  +   HI  L ++L  +V +G W+ A+R FS+LIR+P VDIR
Sbjct: 170 FNSIKRGYEIYSRPSQV--HQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIR 227

Query: 236 NIWGLGTRILMERGQTTRSL----EFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHT 291
           ++WGLG RIL E   T +++    EFL W+S +Y+S+ NF  +      PVFR+GS+ HT
Sbjct: 228 SMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHT 287

Query: 292 PKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVP 351
            K+   WLW  L                      DNGS      KL +L++K+SEMVL+P
Sbjct: 288 AKFVSAWLWEMLFAACP---------DKLEERQADNGSGNR---KLIQLLEKLSEMVLIP 335

Query: 352 PYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGS--RRDIARNQVTQHIHYVKTYLQNC 409
           PY++DPEIWFIY++CH+V AD LS +F       +   RDI+RNQVTQHI      ++ C
Sbjct: 336 PYMEDPEIWFIYALCHLVSADELSQRFTFTYSESTELERDISRNQVTQHITNAHNCIRTC 395

Query: 410 SQKG-NFEYPKQFIQSRLEEFEKRMYE 435
             KG +F +P++ I+ +L  FE+R+YE
Sbjct: 396 EAKGDDFFFPRRIIEEQLAFFERRLYE 422

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  271 bits (694), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 170/483 (35%), Positives = 254/483 (52%), Gaps = 53/483 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKY--------HAKRRSKRRRQANSLPTPENS 52
           MF++P+     R    R++RYQYIN L RKY         A   S+     N + TPENS
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 53  AVENDQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLF 112
               + SE++    E+   +K +L      S    + +  D   D +E   D N  E  F
Sbjct: 61  ----ESSEAEAADLEKKHRRKRRL-----QSVLGNALDSSDEELDGDEDGTDENDPETQF 111

Query: 113 YRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVN 172
           Y  + KP+H+FEVW    +VNT  +  +++  I Y  + ++E+ A K V K + +     
Sbjct: 112 YESHIKPQHTFEVW----NVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKL 167

Query: 173 KRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEV 232
             YF     G++V  P   +      H+  L Q+L+++V   NW+IAYR FS+LIR+ +V
Sbjct: 168 NMYFQALKFGFDVY-PKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226

Query: 233 DIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTP 292
           D+R++W +G+ IL   G T  +  +L+W++ V+ S+  F Q   +   PVFR GSRTHTP
Sbjct: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286

Query: 293 KYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDK---LTELIDKISEMVL 349
            + LTWLW  L   T                     S  SA+DK   L  LID++ EMVL
Sbjct: 287 TFVLTWLWTRLFIAT---------------------SGSSAVDKEKFLQSLIDRLDEMVL 325

Query: 350 VPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQR--LSGSRRDIARNQVTQHIHYVKTYLQ 407
            PPY+DD EIW+I+ + H+V A  LS KF   +  L GSR DIARNQV QHI+  K  LQ
Sbjct: 326 SPPYMDDSEIWYIFGLTHLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQ 385

Query: 408 NCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQID 467
            C    N+E+P+  I+ +L + E+ +Y DE     + +  + ++   S+ED  E+ +  +
Sbjct: 386 MCKANSNYEFPENVIEHQLVQLERSLYTDE-----LSVNCTDESAKSSDEDGIEHSYPNE 440

Query: 468 ESN 470
           +SN
Sbjct: 441 DSN 443

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  256 bits (654), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 253/489 (51%), Gaps = 52/489 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKY-HAKRRSKRRRQAN----SLPTPENSA-- 53
           MFE PI    +R   +R ++Y+Y++ + RKY      S   +QA+      PTP+NSA  
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 54  ------VENDQSESQLPSREQIKEKKMKLGEDYSDSE-AETSSEGEDTTKDDNEFANDMN 106
                 +E D   +    + +    +  LG    D+E  +  SE ED    D    +   
Sbjct: 106 ASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEED----DLNGGSTAK 161

Query: 107 KFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVV 166
            +EK F+ +Y KPE+++E+W    + + K +  +++  + Y    ++E  + +R++  + 
Sbjct: 162 DYEKQFFARYYKPEYTYELW----ATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLS 217

Query: 167 HMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLL 226
                   Y ++   GYE   P  ++ +Y   H+  L  +L+S++   NW  AYR F+LL
Sbjct: 218 LSTKKAAAYHEVMRLGYETC-PKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALL 276

Query: 227 IRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSG 286
           IR+  VD+R+IW LG+ IL          +FL+WM TV++S   F Q+  +   PVFRSG
Sbjct: 277 IRMKSVDLRSIWNLGSHILSHLNFDMHE-KFLEWMGTVFTSHSVFSQNKVNLIDPVFRSG 335

Query: 287 SRTHTPKYALTWLWNCLIKVT--ELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKI 344
           SR HTP + L WLW  L   T  E++                      +   +  L++K+
Sbjct: 336 SRAHTPNFMLAWLWLVLRGATADEVL---------------------DSTRSMAWLLEKV 374

Query: 345 SEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQ---RLSGSRRDIARNQVTQHIHY 401
           SE+VL PPY+DD EIWF+Y+MC+ + AD LS +       +L GS+ DIA+ QVTQ+I  
Sbjct: 375 SELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICS 434

Query: 402 VKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEE 461
           VK  L++C +KGNF YP++ IQ +L EFE+R+Y    K +      S+D       +  +
Sbjct: 435 VKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDG--NSFDTYESDTGEQND 492

Query: 462 NPFQIDESN 470
           NP  + E++
Sbjct: 493 NPTMVSETD 501

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  254 bits (648), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 175/484 (36%), Positives = 263/484 (54%), Gaps = 56/484 (11%)

Query: 1   MFEVPI-TYNCRRLNVERRVRYQYINILSRKYH----AKRRSK-RRRQANSLPTPENSAV 54
           MFE PI +YN +     R+++Y+YIN L RKY      +  SK   +  + LPTP NSA 
Sbjct: 1   MFESPIISYNSKDRK-RRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAA 59

Query: 55  ENDQSESQ-------LPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFAN---D 104
           E    + +       L  R++    +  LG    + E E  +EG   ++DD+ + +   D
Sbjct: 60  EASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGYLD 119

Query: 105 MNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKN 164
               EK+FY KY  PE ++EVW    S+N +    +++  + Y     +E+ A K+V  +
Sbjct: 120 EKDPEKIFYSKYYVPEETYEVW--TTSINNRIP--IQRRSMSYHVFRTIEKYAHKKVAAS 175

Query: 165 VVHMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFS 224
           +         +F++   GYE   P   I +Y   H+  L  +L+ ++ +G++D AYR FS
Sbjct: 176 LALSSKKLTGFFEVIRSGYETC-PRERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFS 234

Query: 225 LLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFR 284
           LLIR+  VD+R++W LG++IL E         FL+WMSTV +S   F Q+  ++  PVFR
Sbjct: 235 LLIRMNFVDLRSMWNLGSKIL-EHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFR 293

Query: 285 SGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQ---SAMDKLTELI 341
           SGSRTH P + L+WLW  L                      +N  K+   S+   +  L+
Sbjct: 294 SGSRTHIPNFVLSWLWLVL----------------------ENAVKERVFSSGHDINWLL 331

Query: 342 DKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLS------GKFNCQRLSGSRRDIARNQV 395
           DKISE+VL PPY+DD E+WFIY+MC+ + AD LS      G  N   L GS+ DIARNQV
Sbjct: 332 DKISELVLRPPYMDDAEVWFIYAMCYFIKADKLSLQLKQEGSLNG--LKGSQLDIARNQV 389

Query: 396 TQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYS 455
            ++IH+VK +L+ C +KG F+YPK+ I+++L EFEKR+Y + S   N    E++      
Sbjct: 390 IENIHHVKNHLRICEEKGGFQYPKRVIEAQLVEFEKRLYPESSTHINYPGYETFPLEESD 449

Query: 456 NEDD 459
            ED+
Sbjct: 450 TEDN 453

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  249 bits (635), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 164/504 (32%), Positives = 261/504 (51%), Gaps = 56/504 (11%)

Query: 1   MFEVPI---TYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND 57
           MFE+P+   +++  +  V +++RY+Y N +  +Y   +R K   +   L TPE+S  E D
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQY---KRIKIHDENGQL-TPESSHTELD 56

Query: 58  QSESQLPSREQIKEKKMKLGEDYSDSEAET----SSEGEDTTKD-DNEFANDMNKFEKLF 112
             ES    R ++   + +   D  D E       SSE +D   D   +   ++   E+ +
Sbjct: 57  DHES----RSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEEEIGHEERKY 112

Query: 113 YRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVN 172
           ++ +EKPE  +EVW+       ++K  +++  + Y RL  +ER AK+++E  ++H+  V 
Sbjct: 113 FKNHEKPEDLYEVWHVATE---RRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169

Query: 173 KRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEV 232
              F  + +GY+V+    +   +  KHI++L  +L   +S  NW++AY+ F+LLIR+P V
Sbjct: 170 SSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRV 229

Query: 233 DIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRTHTP 292
           DIR +W LG  IL  R  TT +++FL+WM +VYS+K  F+Q+  HR  P FRSGSRTHT 
Sbjct: 230 DIRAVWNLGVAILARRDSTT-AIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTA 288

Query: 293 KYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPP 352
           +Y  TWLW  L   TE                   G+  + ++ L  L DK SE++L PP
Sbjct: 289 QYTTTWLWLSLRAATE---------------QAQEGAP-TTLEPLELLTDKTSELLLTPP 332

Query: 353 YLDDPEIWFIYSMCHMVHADYLSGKF------NCQRLSGSRRDIARNQVTQHIHYVKTYL 406
           Y+DD E+WFIY  C+ V AD LS         N    S S  D+ RN+V Q I   +  L
Sbjct: 333 YMDDSEVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTL 392

Query: 407 QNCSQKGN---------FEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDN-----T 452
               +K +         +E P  +I+ +L++ EKR+    +  +       Y+N     T
Sbjct: 393 HTAEEKSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQSTPRDQPSSPAHYENYGLGDT 452

Query: 453 SYSNEDDEENPFQIDESNSFLGNL 476
             + +  + + F I+E NSFL  L
Sbjct: 453 ELAEDQADIDAFPIEEDNSFLQAL 476

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  229 bits (585), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 153/487 (31%), Positives = 249/487 (51%), Gaps = 51/487 (10%)

Query: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYH---------AKRRSKRRRQANSLPTPEN 51
           MFE P+  + + L  ER++RYQYIN  +++Y          +   S R R   +LPTPE 
Sbjct: 1   MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQLYGDTIPSSSLESNRSRTPITLPTPEA 60

Query: 52  SAVENDQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKL 111
           SA E+  S +                 D SDS + T++  +D    D   +      E  
Sbjct: 61  SAHEHSDSNTNY--------------NDDSDSISNTNTLSDDEYNSD---STGTTNEETK 103

Query: 112 FYRKYEKPEHSFEVWYDG-NSVNTKKKHE------LKKTHIHYTRLNRVERIAKKRVEKN 164
           F+ +Y++P+ SFEVW    +++N+K K +      + +  I + RLNRV++   K++E  
Sbjct: 104 FFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEAR 163

Query: 165 VVHMPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFS 224
           + H     K +    SEGYE         S+   HIE L  +L+ ++ + N++ AY  FS
Sbjct: 164 LQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIFS 223

Query: 225 LLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFR 284
           L+IR+P +DIRN W LG+ IL+++     SL FL W+ ++YSS Q +  S  ++ AP F 
Sbjct: 224 LIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYNNSINYKTAPAFT 283

Query: 285 SGSRTHTPKYALTWLWNCL----IKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTEL 340
             SR HT K+  ++LW  L     K ++L S                        KL + 
Sbjct: 284 QSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNY---------LKKKLKKF 334

Query: 341 IDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGS--RRDIARNQVTQH 398
           ++K+SEMVL PP+++D EIW+IYS+ H++ A  L  +     +S +   +DI +N++  +
Sbjct: 335 VEKLSEMVLAPPFIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISN 394

Query: 399 IHYVKTYLQNCSQKGN-FEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNE 457
           I + K++LQ   +  N + +  Q I+  L++ EK++Y+  S  E +  +E  DN      
Sbjct: 395 IQHCKSHLQKVRENQNDYNFKFQKIEIELKDMEKKLYDTSSDEEILNEEEFLDNEDVL-- 452

Query: 458 DDEENPF 464
           D+EEN F
Sbjct: 453 DNEENNF 459

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  207 bits (528), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 151/478 (31%), Positives = 250/478 (52%), Gaps = 78/478 (16%)

Query: 1   MFEVPITYNC--RRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND- 57
           MFE+P++ N      N+ +++RYQYIN ++ K++   +       N LPTP  S  END 
Sbjct: 1   MFELPVSSNITINAFNL-KKLRYQYINDINAKHNELSK-------NELPTPVTS--ENDT 50

Query: 58  -------QSESQLPSRE-------QIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFAN 103
                   SE  L S +       +I+  K  +GE   D E + + + +   + ++    
Sbjct: 51  GGEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDNGPT 110

Query: 104 DMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEK 163
           D    EK ++ +Y+KP+ SFE W    S N K++  + K  I Y R  +  +   K+ + 
Sbjct: 111 DE---EKKYFLRYDKPQESFEKW---ESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKV 164

Query: 164 NVVHMPLVNKRYFDIKSEGYEVLEPLVD--------IDSYLLKHIEILTQILFSSVSQGN 215
             +H+    K  F++  +G+E   P+ D        + +Y   H+ +LT +++S++ +  
Sbjct: 165 KTMHLNKNVKNNFELMIDGFE---PINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQK 221

Query: 216 WDIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSK-QNFVQS 274
           WDIAY+ F+ L+RIP+VDIR +W LG+ I+++   TT+ ++FL+W+S VYS+K ++FVQ 
Sbjct: 222 WDIAYKCFTFLLRIPDVDIRRVWNLGS-IILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280

Query: 275 HCHRKAPV-FRSGSRTHTPKYALTWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSA 333
             +R     F  GSR  TP Y  T LW+ L                      D+ + +S 
Sbjct: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKL------------------TLSSDSETCESE 322

Query: 334 MDKLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGSRRD---- 389
           +D    LI++I+EMV++PPY +D EIW+I+++CH+V AD LS K           D    
Sbjct: 323 ID---SLIEQIAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDT 379

Query: 390 ------IARNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPE 441
                 I  N++T  I+  K YL+  +Q  NF+YP + I+++L+  E R ++ ES PE
Sbjct: 380 YPYDTEIYNNKITICINNCKKYLRKATQDKNFDYPARTIETKLKTIETRTFDFESMPE 437

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  184 bits (467), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/440 (28%), Positives = 234/440 (53%), Gaps = 48/440 (10%)

Query: 1   MFEVPITYNCRRLNVE-RRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVENDQS 59
           MFEVP   + +R  V  +++RYQY+N      H   R++  +    LPTP +S  E + S
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMN------HMYERNRYNKNGQGLPTPVSSENEMNAS 54

Query: 60  ESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKP 119
           E ++ S ++++++  ++  +   S+ E   E ED  + + +         K ++ +Y+KP
Sbjct: 55  EDEV-SHKRVRKRWRRIVGESVSSDEEEEEEEEDEQEQEGDEE-------KKYFSRYDKP 106

Query: 120 EHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIK 179
           E SFE W    + NTK +  + +  + Y + N++ + ++K+++  ++      +  F   
Sbjct: 107 EDSFERW----ASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSV 162

Query: 180 SEGYEVLEPLVDI-DSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVDIRNIW 238
            +GYE+++  +++ +++ + ++++LT +++ S+ + NW IAYR F+LLIR+P+  IR IW
Sbjct: 163 IDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIW 222

Query: 239 GLGTRILMERGQTTRSLEFLKWMSTVYS--SKQNFVQSHCHRKAPVFRSGSRTHTPKYAL 296
            LG+ I+       +++EFLK  + ++S   K+ F Q+  +R+APVF  GSR  TP Y  
Sbjct: 223 NLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIK 282

Query: 297 TWLWNCLIKVTELISIXXXXXXXXXXXXXDNGSKQSAMDKLTELIDKISEMVLVPPYLDD 356
           T LW  +   +                     +         ELI+ +SE+ L+PP+++D
Sbjct: 283 TLLWKEITTTS---------------------TSSRTSSNYNELIEYLSELTLIPPFMED 321

Query: 357 PEIWFIYSMCHMVHADYLSGKFNCQRL---SGSRRDIARNQVTQHIHYVKTYLQNCSQKG 413
            EIW+IY + H+  A+ LS   N +     S S +DIA N+V Q+I   + +L+   +  
Sbjct: 322 SEIWYIYGIVHLQRANELS--MNLEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAKELS 379

Query: 414 NFEYPKQFIQSRLEEFEKRM 433
             E P++ I   ++  E RM
Sbjct: 380 KIEVPERQITLMIKNIEGRM 399

>ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL047C (EDE1)
          Length = 1226

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 20  RYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVENDQSESQLPSRE-----QIKEKK 73
           R Q +N+ +R  ++   + R   A S   TP+N A+ +    S LP+       Q+ E+ 
Sbjct: 432 RSQPVNVANRGINSAENTSRSIPALSPQGTPQNQAMRHSSYISTLPTVPDFASLQVSEQL 491

Query: 74  MKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPEHSFEVWYDGNSVN 133
             + + Y DSE  TS +    T D    +N ++       +  E+ EH+ +     N + 
Sbjct: 492 APVKDIYMDSE--TSGQLSQATTDVANLSNQVSSLTTQVSKTTERKEHAQQELSRINELK 549

Query: 134 TKKKHELKKTHIHY----TRLNRVER-IAKKRVEKNVVHMPLVN 172
              + +L   H  Y     ++  VE+ + K R E  V+   L N
Sbjct: 550 ASLEAKLTTLHSSYQQETQQMEEVEQLLTKARAETEVLTQQLQN 593

>Ecym_8383 Chr8 (779290..783729) [4440 bp, 1479 aa] {ON} similar to
            Ashbya gossypii ADL046C
          Length = 1479

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 6/96 (6%)

Query: 368  MVHADYLSGKFNCQRLSGSRRDIARNQVT-QHIHYVKTYLQNCSQKGNFEYPKQFIQSRL 426
             V  + L G+   +R  G       N    Q I++ K  ++   Q GNF+ PK      L
Sbjct: 1206 FVAGNTLGGRLTTKRGIGLDSSFLLNITNRQFIYHSKASIKTVGQTGNFKQPKVQSDHTL 1265

Query: 427  EEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEEN 462
               +++M     K E +K +++++  S   +DD++N
Sbjct: 1266 TTVQQKM-----KMEELKKRQAHEMLSMIKKDDQKN 1296

>Suva_10.532 Chr10 (914757..916487) [1731 bp, 576 aa] {ON} YLR417W
           (REAL)
          Length = 576

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 10/62 (16%)

Query: 164 NVVHMPLVNKRYFDIKSEGYEVL-EPLVDI-----DSYLLKHIEILTQILFSSVSQGNWD 217
           N + +  VNKR   + SE ++V+ + LVD+      S LLK    LTQIL S+ SQ NW 
Sbjct: 478 NELRLVKVNKRILCLTSEKFDVVKDKLVDLINENPGSDLLK----LTQILSSNNSQSNWT 533

Query: 218 IA 219
           + 
Sbjct: 534 LG 535

>Smik_12.504 Chr12 (887706..889418) [1713 bp, 570 aa] {ON} YLR417W
           (REAL)
          Length = 570

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 164 NVVHMPLVNKRYFDIKSEGYEVL-EPLVD-IDSYLLKHIEILTQILFSSVSQGNWDIA 219
           N + +  VNKR   + SE ++V+ + LVD I  Y    +  LTQIL SS S+ NW + 
Sbjct: 477 NELRLVKVNKRILCLTSEKFDVVKDKLVDLIGEYPGSDLLKLTQILSSSNSKSNWTLG 534

>YJL039C Chr10 complement(368748..373799) [5052 bp, 1683 aa] {ON}
           NUP192Essential subunit of the inner ring of the nuclear
           pore complex (NPC); contributes to nucleocytoplasmic
           transport; homologous to human NUP205
          Length = 1683

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 82  DSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKY-EKPEHSFEVWYDGNS 131
           D+E ++   GED T DD     D+ +F    Y  Y  +PE+S   W D  S
Sbjct: 455 DAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSCTFWSDKES 505

>Smik_10.215 Chr10 (350516..355567) [5052 bp, 1683 aa] {ON} YJL039C
           (REAL)
          Length = 1683

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 82  DSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKY-EKPEHSFEVWYDGNS 131
           D+E ++   GED T DD     D+ +F    Y  Y  +PE+S   W D  S
Sbjct: 455 DAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSSAFWSDKES 505

>Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}
           YJL162C (REAL)
          Length = 559

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 71/173 (41%), Gaps = 35/173 (20%)

Query: 78  EDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKYEKPEHSFEVWYDGNSVNTKKK 137
           E+Y     E+  E  + +K+D E        E++ Y++++ P+    V+ +G+S    + 
Sbjct: 242 EEYQKYNEESKKERRNLSKEDTE--------EEMEYKQFKLPK--INVFSNGSSEPNLQS 291

Query: 138 HELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNKRYFDIKSEGYEVLEPLVDIDSYLL 197
                 + HY R     R   +R       MP  +K      +EG+ +L  +V+      
Sbjct: 292 PFYNHEYRHYARSKFQNRNQNRRSVSPTKEMPTTSK-----TAEGWNILRDIVE------ 340

Query: 198 KHIEILTQILFSSVSQGNWDIAYR-------TFSLLIRIPEVDIRNIWGLGTR 243
                  ++  SSV  GN D + R       ++S  I I E+ IR   G+  R
Sbjct: 341 -------KLNISSVDDGNKDTSLRKSQTNEKSYSETINIEELSIREPKGIKRR 386

>KLTH0D14762g Chr4 complement(1209483..1212617) [3135 bp, 1044 aa]
           {ON} similar to uniprot|Q07454 Saccharomyces cerevisiae
           YDL073W Hypothetical ORF
          Length = 1044

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 33  AKRRSKRRRQA-NSLPTPENSAVENDQSESQLPSR 66
           AK+ + RRR+A N+ PTP++SA+  D   +   SR
Sbjct: 628 AKKAATRRREAINANPTPKDSAISRDNRSTSFSSR 662

>Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON}
           YJL039C (REAL)
          Length = 1683

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 82  DSEAETSSEGEDTTKDDNEFANDMNKFEKLFYRKY-EKPEHSFEVWYDGNS 131
           D+E ++   GED T DD     D+ +F    Y  Y  +PE+S   W D  S
Sbjct: 455 DAEEDSLLSGEDLTLDDISLKADLERFFLSIYFFYASRPEYSRAFWSDKES 505

>YLR417W Chr12 (955010..956710) [1701 bp, 566 aa] {ON}
           VPS36Component of the ESCRT-II complex; contains the
           GLUE (GRAM Like Ubiquitin binding in EAP45) domain which
           is involved in interactions with ESCRT-I and
           ubiquitin-dependent sorting of proteins into the
           endosome
          Length = 566

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 10/55 (18%)

Query: 171 VNKRYFDIKSEGYEVL-EPLVDI-----DSYLLKHIEILTQILFSSVSQGNWDIA 219
           VNKR   + SE ++V+ E LVD+      S LL+    LTQIL S+ S+ NW + 
Sbjct: 480 VNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLR----LTQILSSNNSKSNWTLG 530

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 52/123 (42%), Gaps = 12/123 (9%)

Query: 107 KFEKLFYRKYEK--PEHSFEVWYDGNSVNTKKKHE-------LKKTHIHYTRLNRVERIA 157
           K   LF RK +K  P++     + G  + +K+  +         KT +     +RVE   
Sbjct: 663 KIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPVKLRSESRVEEHL 722

Query: 158 KKRVEKNVV-HMPLVNKRYFDIKS--EGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQG 214
           +  V K+VV    +V       KS  E    L+P V + S    H+ + + ++  SV + 
Sbjct: 723 RNSVSKDVVPDTAIVAGEVIPSKSKAEDLPALQPAVSVTSTKSAHVPLASSVVIESVKEL 782

Query: 215 NWD 217
           + D
Sbjct: 783 DGD 785

>KAFR0K00380 Chr11 (82200..85001) [2802 bp, 933 aa] {ON} Anc_6.201
           YPL195W
          Length = 933

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 437 ESKPENMKLQESYDNTSYSNEDDEENPFQIDESNSFLGN 475
           +S   +++L+ES D TS+ NE++E N   I  +  F GN
Sbjct: 681 DSDETDIELKESTDFTSFGNENEENNGIDISSTEKFSGN 719

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,312,977
Number of extensions: 2783180
Number of successful extensions: 22117
Number of sequences better than 10.0: 438
Number of HSP's gapped: 22976
Number of HSP's successfully gapped: 457
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)