Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J11616gsingletonON1181185178e-69
NDAI0F031702.104ON35046606.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11616g
         (118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11616g Chr10 (1130080..1130436) [357 bp, 118 aa] {ON} no s...   203   8e-69
NDAI0F03170 Chr6 complement(761519..762571) [1053 bp, 350 aa] {O...    28   6.7  

>CAGL0J11616g Chr10 (1130080..1130436) [357 bp, 118 aa] {ON} no
           similarity possibly noncoding
          Length = 118

 Score =  203 bits (517), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 101/118 (85%)

Query: 1   MISIFSYSSANNLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYFRKIFEGQLLHRLVVQL 60
           MISIFSYSSANNLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYFRKIFEGQLLHRLVVQL
Sbjct: 1   MISIFSYSSANNLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYFRKIFEGQLLHRLVVQL 60

Query: 61  ENKTVFLLLPEKCILIWPSYLKLQLFRGNDMXXXXXXXXXXXXXXXXXYNYWYRNEMK 118
           ENKTVFLLLPEKCILIWPSYLKLQLFRGNDM                 YNYWYRNEMK
Sbjct: 61  ENKTVFLLLPEKCILIWPSYLKLQLFRGNDMKIIEGRIKIKIKIMIIKYNYWYRNEMK 118

>NDAI0F03170 Chr6 complement(761519..762571) [1053 bp, 350 aa] {ON}
           Anc_2.104 YNL141W
          Length = 350

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 12  NLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYFRKIFEGQLLHRLV 57
           + RD Q  +D Y   T V++  + +F  ++AYF+K+ +  L+H  V
Sbjct: 56  SFRDLQDFLDYYYIGTNVLIKEEDFFDLAWAYFQKVHKQGLVHAEV 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.142    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,343,589
Number of extensions: 414375
Number of successful extensions: 1005
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1004
Number of HSP's successfully gapped: 8
Length of query: 118
Length of database: 53,481,399
Length adjustment: 87
Effective length of query: 31
Effective length of database: 43,505,457
Effective search space: 1348669167
Effective search space used: 1348669167
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)