Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J11594g6.29ON93793747280.0
KLLA0C06182g6.29ON15197499101e-103
SAKL0E01540g6.29ON14157739011e-102
KLTH0C10956g6.29ON14337458589e-97
Kpol_1037.226.29ON14967738457e-95
Kwal_56.224626.29ON15417718183e-91
KNAG0F029206.29ON14927707919e-88
TDEL0G044006.29ON14903766502e-69
ZYRO0C07524g6.29ON16703826492e-69
TPHA0J004006.29ON15123766456e-69
YOL004W (SIN3)6.29ON15364056323e-67
Skud_15.1586.29ON15553866281e-66
Suva_15.1716.29ON15613916271e-66
NDAI0C026606.29ON16573726235e-66
Smik_15.1666.29ON15663926182e-65
KAFR0A051206.29ON14793686163e-65
ACL004W6.29ON13773856136e-65
Ecym_30336.29ON14743846083e-64
CAGL0E02475g6.29ON14933406057e-64
NCAS0D021306.29ON14343666012e-63
TBLA0E031606.29ON17393775311e-54
KNAG0L013507.220ON55868771.5
TPHA0C012707.216ON47595762.3
TDEL0E052306.215ON49070753.2
Smik_14.2362.199ON123287753.5
Skud_14.1192.28ON32692734.1
CAGL0K08844g7.110ON50856725.8
ZYRO0G08866g6.215ON50170726.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J11594g
         (937 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...  1825   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...   355   e-103
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...   351   e-102
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...   335   9e-97
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...   330   7e-95
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...   319   3e-91
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....   309   9e-88
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....   254   2e-69
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...   254   2e-69
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...   253   6e-69
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...   248   3e-67
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...   246   1e-66
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...   246   1e-66
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...   244   5e-66
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...   242   2e-65
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...   241   3e-65
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...   240   6e-65
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...   238   3e-64
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...   237   7e-64
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....   236   2e-63
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....   209   1e-54
KNAG0L01350 Chr12 (242151..243827) [1677 bp, 558 aa] {ON} Anc_7....    34   1.5  
TPHA0C01270 Chr3 (289150..290577) [1428 bp, 475 aa] {ON} Anc_7.2...    34   2.3  
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    33   3.2  
Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL09...    33   3.5  
Skud_14.119 Chr14 (229071..230051) [981 bp, 326 aa] {ON} YNL217W...    33   4.1  
CAGL0K08844g Chr11 (887412..888938) [1527 bp, 508 aa] {ON} simil...    32   5.8  
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    32   6.5  

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score = 1825 bits (4728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 891/937 (95%), Positives = 891/937 (95%)

Query: 1   MVTLEFNNVTDSVVKSYNDLKKNLSHEDYNSLISAIRSDIDEFSNGESSPDNSIERVIKG 60
           MVTLEFNNVTDSVVKSYNDLKKNLSHEDYNSLISAIRSDIDEFSNGESSPDNSIERVIKG
Sbjct: 1   MVTLEFNNVTDSVVKSYNDLKKNLSHEDYNSLISAIRSDIDEFSNGESSPDNSIERVIKG 60

Query: 61  INEQYPHLSSTIRDIFGKDPNEYTTRTCGQNLNVDLIVDELCGILENKQITYIERVLYSD 120
           INEQYPHLSSTIRDIFGKDPNEYTTRTCGQNLNVDLIVDELCGILENKQITYIERVLYSD
Sbjct: 61  INEQYPHLSSTIRDIFGKDPNEYTTRTCGQNLNVDLIVDELCGILENKQITYIERVLYSD 120

Query: 121 LSRDEKISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNEEQISSIRSTLSQNTDNR 180
           LSRDEKISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNEEQISSIRSTLSQNTDNR
Sbjct: 121 LSRDEKISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTEKNEEQISSIRSTLSQNTDNR 180

Query: 181 CAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTF 240
           CAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTF
Sbjct: 181 CAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTF 240

Query: 241 TKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSG 300
           TKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSG
Sbjct: 241 TKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSG 300

Query: 301 FETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF 360
           FETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF
Sbjct: 301 FETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF 360

Query: 361 LLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNI 420
           LLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNI
Sbjct: 361 LLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNI 420

Query: 421 LIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNA 480
           LIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNA
Sbjct: 421 LIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNA 480

Query: 481 EKRFLNDKQLLLEYKSEKQDKLLKEHYDNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTS 540
           EKRFLNDKQLLLEYKSEKQDKLLKEHYDNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTS
Sbjct: 481 EKRFLNDKQLLLEYKSEKQDKLLKEHYDNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTS 540

Query: 541 ESQKNLYCQIFEAFFDLLFEESSFTKHLDFQFCHNPAISSNSQISEDDVEAMFMKGILEE 600
           ESQKNLYCQIFEAFFDLLFEESSFTKHLDFQFCHNPAISSNSQISEDDVEAMFMKGILEE
Sbjct: 541 ESQKNLYCQIFEAFFDLLFEESSFTKHLDFQFCHNPAISSNSQISEDDVEAMFMKGILEE 600

Query: 601 KGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLR 660
           KGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLR
Sbjct: 601 KGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLR 660

Query: 661 TXXXXXXXXXXXXXXXXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRIN 720
           T                MQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRIN
Sbjct: 661 TKKRRPSLLAKSLKLLPMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRIN 720

Query: 721 FENKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVR 780
           FENKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNM            YRTKVR
Sbjct: 721 FENKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVR 780

Query: 781 MLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLD 840
           MLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLD
Sbjct: 781 MLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLD 840

Query: 841 TDGLNTPYYSLNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICXXXXXX 900
           TDGLNTPYYSLNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDIC      
Sbjct: 841 TDGLNTPYYSLNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHIT 900

Query: 901 XXXXXXXXXXXXQMASLISKIAKNRKQQRARTIGTMK 937
                       QMASLISKIAKNRKQQRARTIGTMK
Sbjct: 901 KLKSSLKSSRKTQMASLISKIAKNRKQQRARTIGTMK 937

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score =  355 bits (910), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 244/749 (32%), Positives = 369/749 (49%), Gaps = 69/749 (9%)

Query: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265
            F    +  + ++ +Y EFLK++NL++Q L+  +    +   +  S   L   F + +  Y
Sbjct: 694  FFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG-Y 752

Query: 266  KDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGH 325
            ++  + ++  +      D+ D     GPSYK+L   +T   C GRD +C EVLNDEWVGH
Sbjct: 753  QEKPKHIENIVHEKHRLDL-DLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGH 811

Query: 326  PVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDG 385
            PVWASE+ GFIAH+KNQYE+TLFKVEEERHEYDF++ S    I          +++    
Sbjct: 812  PVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIAN--KIANMTN 869

Query: 386  RRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEK 443
              +N    P  P +   S+T  +KV+R++Y  + G  +IDA+  +P   VP +LK  K+K
Sbjct: 870  EEKNNFKLP--PGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQK 927

Query: 444  YQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLL 503
             ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQLL E  S K D+  
Sbjct: 928  DEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTN 987

Query: 504  KEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLL 558
            K  +        +  +E  D+ VLYD+ D++   +++N+S S S K      F+AF  L 
Sbjct: 988  KRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLF 1047

Query: 559  F------------EESSFTKHLDFQFCHNPAISSNS-QISEDDVEAMFMKGIL------- 598
            F            E SS T   + +   N + S  S + +  D ++  MK IL       
Sbjct: 1048 FSYPIKDVNEAVSERSSITDQENGEEDSNKSDSEKSNKRTLSDEDSYLMKDILRRTKNAK 1107

Query: 599  -----EEKGLGRWFSNDTE----LKKE-------------------FSNRQNINIFCDIN 630
                 E +      SN+ +    L KE                    S+R   N+F +  
Sbjct: 1108 TSNSEENQNSSSVKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTT 1167

Query: 631  IMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXMQLSDNGLELGQD 690
            I   F ++ TLYER  +VK  +  +  +++                  QL+D GL     
Sbjct: 1168 IYVFFRHLNTLYERLLEVKKIDAEVTDEIKN--RKIVQFASDLNLISTQLADMGLAFKDT 1225

Query: 691  DGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPS 750
              Y  +   SK+ ++G+LDHQWFEESLR  ++NKA+K+YTID+V+++++    +I   P 
Sbjct: 1226 KAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPK 1285

Query: 751  LLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDD 810
               ++ L   +             YR KVR  M    +MFR+E   DS+ +  QY+ VDD
Sbjct: 1286 NAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDD 1345

Query: 811  LLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS------LNLLKREEQNIPFM 864
            L   +    K +   Y   Y  +  T+ +  + ++ P+           L  EEQN  F 
Sbjct: 1346 LTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFS 1405

Query: 865  NGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
               + +  L VNI+P  Y +    GS D+
Sbjct: 1406 PEGVSQSKLKVNIHPETYELTFECGSTDV 1434

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score =  351 bits (901), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 246/773 (31%), Positives = 376/773 (48%), Gaps = 95/773 (12%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            P++   ++ E   +F   +  + ++ IY EFLK++NL++Q L+D +   ++   + G + 
Sbjct: 534  PMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNK 593

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F N +  Y+   + ++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 594  ELFDWFKNFVG-YEKKPKHIENIVHEKHRLDL-DLCEACGPSYKKLPKADTFMPCSGRDE 651

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF+          L 
Sbjct: 652  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLE 711

Query: 363  SVEHLIVKFTEYEKS-LQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGN 419
            ++ + I   T  EK+  +LS               P +   S+T  +KVIR++Y  + G 
Sbjct: 712  TIANKIANMTPEEKATFKLS---------------PGLGHTSVTIYKKVIRKVYDKDRGF 756

Query: 420  ILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKN 479
             +IDA+   P   VP +LK  K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK 
Sbjct: 757  EIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQ 816

Query: 480  AEKRFLNDKQLLLEYKSEKQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLR 534
            A+K+ L  KQL+ E  + K D+  K  +        +  Y F D+ VLYD+ ++    + 
Sbjct: 817  ADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFID 876

Query: 535  SNSSTSESQKNLYCQIFEAFFDLLFE------ESSFTKH---LDFQFCHNPAISSNSQIS 585
             N++ S   K       ++F  L F       E++F +    +  Q     +   NS +S
Sbjct: 877  CNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLS 936

Query: 586  EDDV--EAMFMKGILEEKGL--GRWFSNDT------------------------ELKKEF 617
                  E   +K +L       GR F+ +                         E KK +
Sbjct: 937  RKRTREEENLLKDVLRRNKYQKGRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPW 996

Query: 618  ---------------SNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTX 662
                            NR+  N+F + NI   F ++ TLY R ++VK     + ++++  
Sbjct: 997  LLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKN- 1055

Query: 663  XXXXXXXXXXXXXXXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFE 722
                            QLSD GL+    D Y  + T SK+ + G+++HQWFEESLR  ++
Sbjct: 1056 -RKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYK 1114

Query: 723  NKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRML 782
            NKA+K+YTID+V+++++    TI   P  ++I+ L   +             YR +VR  
Sbjct: 1115 NKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSH 1174

Query: 783  MDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTD 842
            M    +MFR+E  R S     Q++ VDDL   +    +     Y   Y  +  T+ +  +
Sbjct: 1175 MTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHE 1234

Query: 843  GLNTPYYSLNLLKREE---QNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSID 892
             L  P+    L K EE   +N  +    +   +L V INP  Y +D+ PGS D
Sbjct: 1235 ELQPPFLEKILEKEEEFQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYD 1287

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score =  335 bits (858), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 231/745 (31%), Positives = 357/745 (47%), Gaps = 90/745 (12%)

Query: 216  DESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPT 275
            ++ +Y EFLK++NLF+Q LI       +   + G    L   F + ++ Y +  + ++  
Sbjct: 596  NKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVN-YVEKPKHIENV 654

Query: 276  LKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGF 335
            +      D+ D      PSYK+L   +T   C GRD +C EVLNDEWVGHPVWASE+ GF
Sbjct: 655  IHEKHRLDL-DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGF 713

Query: 336  IAHKKNQYEETLFKVEEERHEYDFF----------LLSVEHLIVKFTEYEK-SLQLSKDD 384
            IAH+KNQYEETLFK+EEERHEYD++          L ++ + I   T  EK + +L    
Sbjct: 714  IAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGL 773

Query: 385  GRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKY 444
            G              +  +I +KVIR++Y  + G  +IDA+  NP   VP ILK  K+K 
Sbjct: 774  GH-------------TSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKD 820

Query: 445  QQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLK 504
            ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK A+K+ L  KQL+ E  S K D+  K
Sbjct: 821  EEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNK 880

Query: 505  EHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLF 559
              Y        +  Y+  DK VL+D+  ++   +  +S+ S   K      F+ F  + F
Sbjct: 881  RIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFF 940

Query: 560  E------ESSFTKHLDFQFCHNP--------------------------------AISSN 581
                   E+S     D     NP                                +IS +
Sbjct: 941  SISYQEIENSTPADSDAVSNSNPRKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISDD 1000

Query: 582  SQISEDDVEAMFMKGILEEKGLGRWF-------SNDTELKKEFSNRQNINIFCDINIMSL 634
                E   + +  + ++ ++    W        +ND       SNR+  N+F + N+   
Sbjct: 1001 QNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGY---VSNRKIFNLFANTNVYVF 1057

Query: 635  FHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXMQLSDNGLELGQDDGYE 694
            F ++ T+Y+R ++VK     + +++ +                 QLSD GL+    D Y+
Sbjct: 1058 FRHLTTMYQRLSEVKNMNEEVTREINS--RNVVQFAKDLNLVSTQLSDMGLDFKGKDAYD 1115

Query: 695  WIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPSLLQI 754
             + T  K+ +  ++DHQWFEESLR  ++NKA+K+YT+D+VI++++    +I       +I
Sbjct: 1116 QLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEI 1175

Query: 755  LDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHA 814
            + L   +             YR +VR  M    +MFR+EI +DS  +  QY+ +DDL   
Sbjct: 1176 MILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLK 1235

Query: 815  QLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREEQNIPFMNGNIYKP--- 871
            + +  K     Y   Y  +  T+ +  + +  P+    L   EE +          P   
Sbjct: 1236 EPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEAD---EGSEERSPSGH 1292

Query: 872  ---HLSVNINPLDYVVDIAPGSIDI 893
               +L + +NP  Y + I PGS DI
Sbjct: 1293 SLSNLRIQVNPESYELQIEPGSKDI 1317

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score =  330 bits (845), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 230/773 (29%), Positives = 369/773 (47%), Gaps = 93/773 (12%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E   +F   +  + ++ +Y EFLK++NL++Q ++ L+   ++   + GS+ 
Sbjct: 609  PIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYLGSNK 668

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F N +  ++D  + ++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 669  ELFDWFKNFVG-FQDKPKHIENVVHEKHKLDL-DLCEACGPSYKKLPKTDTFMPCSGRDE 726

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS--------- 363
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S         
Sbjct: 727  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE 786

Query: 364  -VEHLIVKFTEYEK-SLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNIL 421
             +   I   TE EK + +L    G              +  +I +KVIR++Y  E G  +
Sbjct: 787  TIASKIANMTEEEKQAFKLPIGLGH-------------TSTTIYQKVIRKVYDKERGFEI 833

Query: 422  IDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAE 481
            IDA+   P   VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK ++
Sbjct: 834  IDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSD 893

Query: 482  KRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSN 536
            K+ L  KQLL E  S K D+  K  H+   + K    YE  DK VL+D+  +    +   
Sbjct: 894  KKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHT 953

Query: 537  SSTSESQKNLYCQIFEAFFDLLF-----------------------------EESSFTKH 567
            SS S   K       +++  L F                             +++S  + 
Sbjct: 954  SSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDENEQNSSKKNSNKRP 1013

Query: 568  LDFQFCHNPAIS---------------------SNSQISEDDVEAMFMKGILEEKGLGRW 606
             D + C +  ++                     S  Q  +DD++ M  +   +   LG  
Sbjct: 1014 RDVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGS- 1072

Query: 607  FSNDTELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXX 666
               +   +    NR+  N+F ++N+      + T+Y+R ++VK     + K++       
Sbjct: 1073 LVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEING--RKV 1130

Query: 667  XXXXXXXXXXXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAY 726
                        QL + GL+    D Y  +   SK+ + G+L+HQWFEESLR  + N+A+
Sbjct: 1131 VQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAF 1190

Query: 727  KLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGV 786
            KLYTID+VI++++     I        ++ L   +             YR + R  M   
Sbjct: 1191 KLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTT 1250

Query: 787  GDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNT 846
              MFR+E     ++I  QYI +DDL   +    + +   Y   Y  +  T+ +  + +  
Sbjct: 1251 EHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKI 1310

Query: 847  PYYSLNL------LKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
            P+    +      ++ E+ N  +    + K +L + I+P  Y +++ PGS DI
Sbjct: 1311 PFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDI 1363

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score =  319 bits (818), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 223/771 (28%), Positives = 362/771 (46%), Gaps = 100/771 (12%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            P++  + + E   +F   +  + ++ +Y EFLK++NLF+Q LID +    +   + G ++
Sbjct: 683  PLENDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNS 742

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F + ++ Y +  + ++  +      D+ D      PSYK+L   +T   C GRD 
Sbjct: 743  ELFDWFKSFVN-YVERPKHIENVVHEKHRLDL-DLCEACCPSYKKLPKADTFMPCCGRDE 800

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYD++          L 
Sbjct: 801  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLE 860

Query: 363  SVEHLIVKFT-EYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNIL 421
            ++ + I   T E +K+ +L    G              +  +I +KVIR++Y  + G  +
Sbjct: 861  TIANKISNMTVEEKKTFKLPPGLGH-------------TSTTIYKKVIRKVYDKDRGFEI 907

Query: 422  IDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAE 481
            IDA+  NP   VP +L+  K+K ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK A+
Sbjct: 908  IDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQAD 967

Query: 482  KRFLNDKQLLLEYKSEKQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSN 536
            K+ L  KQL+ E  S K D+  K  Y        +  ++  DK VL+D+ +++   +  +
Sbjct: 968  KKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHS 1027

Query: 537  SSTSESQKNLYCQIFEAFFDLLF------------------------------------- 559
            ++ S   K      F  F  + F                                     
Sbjct: 1028 TTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEHKVENGDSTRKRSRDDDQFFRDLL 1087

Query: 560  --------------EESSFTKHLDFQFCHNPAISSNSQISEDDVEAMFMKGILEEKGLGR 605
                          E+ S +   D     +P +     +  D  +   +  IL+E     
Sbjct: 1088 KSKHKQAKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHG 1147

Query: 606  WFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXX 665
            + SN    +K ++   N NI+        F ++ T+Y+R ++ K     + K++ +    
Sbjct: 1148 FVSN----RKTYNMFANTNIYV------FFRHLTTMYQRLSEAKNINEEVTKEINS--RK 1195

Query: 666  XXXXXXXXXXXXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKA 725
                         QLSD GL+    D YE +    K+ +  +++HQWFEESLR  ++NKA
Sbjct: 1196 VVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKA 1255

Query: 726  YKLYTIDRVIRNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDG 785
            +K+YT+D+VI++++    +I       +I+ L   +             YR +VR  M  
Sbjct: 1256 FKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGL 1315

Query: 786  VGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLN 845
              +MFR+E+   S  +  Q++ VDDL   Q +  K +   Y   Y  +  T+ +  + + 
Sbjct: 1316 TENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIK 1375

Query: 846  TPYYSLNLLKREEQNIP---FMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
             P+    L    + +     +  G      L + INP  Y + I P S D+
Sbjct: 1376 APFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNSKDL 1426

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score =  309 bits (791), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 234/770 (30%), Positives = 357/770 (46%), Gaps = 91/770 (11%)

Query: 196  PIDRPTNMAEFLIYFRNL---VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   +++E   +F  +   + +  IY EFLK++NLF+Q LI ++    +   +     
Sbjct: 628  PIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQP 687

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F N +  Y+D  + ++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 688  ELFEWFKNFVG-YQDKPKIIENVIHEKHRLDL-DLCEAYGPSYKKLPKSDTFMPCSGRDD 745

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS--------- 363
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S         
Sbjct: 746  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE 805

Query: 364  -VEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNI 420
             +   I   TE EK            N    P  P +   S+T  +K+IR++Y  E G  
Sbjct: 806  TIASKIANMTEEEK------------NMFKLP--PGLGHTSLTIYKKIIRKVYDKERGFE 851

Query: 421  LIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNA 480
            +ID +  +P   VP +LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A
Sbjct: 852  IIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 911

Query: 481  EKRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRS 535
            +K+ L  KQL+ E  S K D+  K  H+   + K    Y+F D  +++D+  +    +  
Sbjct: 912  DKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDH 971

Query: 536  NSSTSESQKNLYCQIFEAFFDLLF--------------------EESSFTKHLDFQFCHN 575
             S+ S   K     +F  F  L F                     ++ F K  D +    
Sbjct: 972  CSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPR 1031

Query: 576  PAI------------------SSNSQISEDD--VEAMFMKGILEEKGLGR-WFSNDTELK 614
            P +                       +SEDD   +       + EK   + W   D   +
Sbjct: 1032 PDVELSLSDILHRAKYQKLKNGEGLGMSEDDDEEKLAKEAEEMSEKNASKPWLVGDIVER 1091

Query: 615  KE----FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXX 670
                   ++R   N+F + N+     +  TLY R  ++K  +  + K++           
Sbjct: 1092 ANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINN--RKVVQFA 1149

Query: 671  XXXXXXXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYT 730
                    QL D GL+    + Y+     SK+ +   L+HQWFEESLR  + NKA+KLYT
Sbjct: 1150 EDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYT 1209

Query: 731  IDRVIRNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMF 790
            +D+V+ +++    T+       ++++L   +             YR   R  M    +MF
Sbjct: 1210 VDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMF 1269

Query: 791  RLEIVRDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS 850
            R++  +D+  +  QYIG+DD+       +    + Y   Y     T+ +  D L  P+  
Sbjct: 1270 RVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLE 1329

Query: 851  LNLLKREEQNIPFMNG-NIYKP------HLSVNINPLDYVVDIAPGSIDI 893
              +L+ E   +    G + Y P       L +NI+P  Y + I  GS DI
Sbjct: 1330 -RILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDI 1378

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
           YOL004W
          Length = 1490

 Score =  254 bits (650), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 214/376 (56%), Gaps = 18/376 (4%)

Query: 195 TPIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSH 251
            PI+    + E   +F   +  + ++ IY EFLK++NLF+Q L+D++    R   + G +
Sbjct: 607 APIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGN 666

Query: 252 NGLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRD 311
             L   F N +  ++D  + ++  +      D+ D     GPSYK+L   +T   C GRD
Sbjct: 667 KELFVWFKNFVG-FQDKPKHIENIVHEKHRLDL-DLCEACGPSYKKLPKSDTFMPCSGRD 724

Query: 312 RLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKF 371
            +C  VLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S    I   
Sbjct: 725 EMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTL 784

Query: 372 -TEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTN 428
            T   K   +S+++     + +    P +   S+T  +KVIR++Y  E G  +IDA+   
Sbjct: 785 ETIASKIANMSEEE-----KATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEY 839

Query: 429 PEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDK 488
           P   VP +LK  K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  K
Sbjct: 840 PAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTK 899

Query: 489 QLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQ 543
           QL+ E  S K D+  K  H+   + K    Y   DKSV +D+  +    +  NSS S   
Sbjct: 900 QLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPD 959

Query: 544 KNLYCQIFEAFFDLLF 559
           K     +F+ F  L F
Sbjct: 960 KIRLKDLFKIFVSLFF 975

 Score =  124 bits (312), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 133/285 (46%), Gaps = 10/285 (3%)

Query: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXX 676
             +NR+  N+F + NI   F ++ TLYER  +VK     + K++ +               
Sbjct: 1083 INNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLIS- 1141

Query: 677  XMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736
              QL + GL+    D YE ++   K+ + G+++HQWFEESLR  + NKA+KLYT+D+VI+
Sbjct: 1142 -QQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQ 1200

Query: 737  NILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVR 796
            +++    TI       +I+     +             YR +VR  M    +MFR+E  +
Sbjct: 1201 SLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNK 1260

Query: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR 856
             S  +  Q+I VDDL  A+    + +   Y   Y  +  T+ +  + L  P+    L   
Sbjct: 1261 QSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETE 1320

Query: 857  EEQNI--------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
            E+            F    + K  L + I+P  Y++DI  GS D+
Sbjct: 1321 EDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDV 1365

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score =  254 bits (649), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 151/382 (39%), Positives = 215/382 (56%), Gaps = 32/382 (8%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E   +F   +  + ++ +Y EFLK++NL++Q L+D++   ++   + G   
Sbjct: 785  PIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSK 844

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L T F N +  Y+D  + ++  +      D+ D    SGPSYK+L   +T   C GRD 
Sbjct: 845  ELFTWFKNFVG-YQDRPKNIENVIHEKHRLDL-DMCEASGPSYKKLPKSDTFMPCSGRDE 902

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS--------- 363
            +C EVLNDEW+GHPVWASE+ GFIAH+KNQYEETLFKVEEERHEYDF++ S         
Sbjct: 903  MCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLE 962

Query: 364  -VEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILI 422
             +   I   TE EK+           N    P     SL +I +KVIR++Y  E G  +I
Sbjct: 963  TIASKIANMTEEEKA-----------NFKLPPGLGHTSL-TIYKKVIRKVYDKERGFEII 1010

Query: 423  DAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEK 482
            DA+  +P   VP +LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K
Sbjct: 1011 DALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADK 1070

Query: 483  RFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNS 537
            + L  KQL+ E  S K D+  K  H+   + K    Y+F D+ +  D+  +    L    
Sbjct: 1071 KLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTG 1130

Query: 538  STSESQKNLYCQIFEAFFDLLF 559
            + S S K       ++F  L F
Sbjct: 1131 NYSNSDKERLKDFLKSFLSLFF 1152

 Score =  122 bits (307), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 135/285 (47%), Gaps = 12/285 (4%)

Query: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXX 676
             SNR++ N+F + +I   F ++ TLYER  +VK  +  + +++ +               
Sbjct: 1264 ISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISE 1323

Query: 677  XMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736
              QL + GL+    D YE +   SK+ + G+++HQWFEESLR  + N+A+K YT+D+V++
Sbjct: 1324 --QLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQ 1381

Query: 737  NILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVR 796
             ++    TI       +I+ L   +             YR + R  M    +MFR+E  R
Sbjct: 1382 ALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNR 1441

Query: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR 856
             S  +  QYI +DDL  A+    + +   Y   Y  +  T+ +  + L  P+  L  +  
Sbjct: 1442 ISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPF--LEKIIE 1499

Query: 857  EEQNIPFMNG--------NIYKPHLSVNINPLDYVVDIAPGSIDI 893
             EQ     NG         + K  L + I+P  Y +++ PGS D+
Sbjct: 1500 SEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDV 1544

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score =  253 bits (645), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 146/376 (38%), Positives = 215/376 (57%), Gaps = 20/376 (5%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E   +F   +  + ++ IY EFLK++NL++Q+++++N   ++   + GS+ 
Sbjct: 642  PIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNK 701

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F   +  Y+D  + ++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 702  ELFDWFKGFVG-YQDKPKHIENIVHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDE 759

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFT 372
            +C EVLND+WVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S    I    
Sbjct: 760  MCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLE 819

Query: 373  EYEKSLQLSKDDGRRRNRVSSPKEPMISLN----SITEKVIRRLYGIEHGNILIDAIKTN 428
                 +    ++ R   ++       I L     +I +KVIR++YG E G  LIDA+   
Sbjct: 820  TIASKIANMTEEERANFKLP------IGLGHTSVTIYQKVIRKVYGKERGFELIDALHEY 873

Query: 429  PEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDK 488
            P   VP ILK  K+K ++W  A+ EWNK WRE++QK YYKSLDHLGL FK A+K+ L  K
Sbjct: 874  PAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTK 933

Query: 489  QLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQ 543
            QL+ E  S K D+  K+ H+   + K    Y+  D+ +LYD+  +    +   S+ S   
Sbjct: 934  QLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPD 993

Query: 544  KNLYCQIFEAFFDLLF 559
            K       ++F  L F
Sbjct: 994  KERLRDFLQSFISLFF 1009

 Score =  120 bits (302), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 129/281 (45%), Gaps = 9/281 (3%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   NIF + NI     ++ TLYER N+ K     + ++++                  
Sbjct: 1119 NRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVS--T 1176

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QL + GL+    D Y+ +   S + + GNL+H WFEESLR  F NKA+KLYTID+V ++I
Sbjct: 1177 QLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSI 1236

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    TI       +I+ L+  +             YR + R  M    +MFR+E  + S
Sbjct: 1237 VKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSS 1296

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858
            + I  QYIG+DDL   +    + +   Y   Y  +  T+ +  + +  P+    L   E 
Sbjct: 1297 DNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEA 1356

Query: 859  Q-------NIPFMNGNIYKPHLSVNINPLDYVVDIAPGSID 892
                    N  +    + +  L + I+P +Y ++I PGS D
Sbjct: 1357 YAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFD 1397

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score =  248 bits (632), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/405 (38%), Positives = 230/405 (56%), Gaps = 56/405 (13%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E + +F   +  + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+ 
Sbjct: 655  PIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNK 714

Query: 253  GLKTAFGNIMSEYKD--------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETR 304
             L T F N +  Y++        +H++ +      D D  E F    GPSYKRL   +T 
Sbjct: 715  ELFTWFKNFVG-YQEKTKCIENIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTF 764

Query: 305  ASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS- 363
              C GRD +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S 
Sbjct: 765  MPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 824

Query: 364  ------VEHLIVK---FTEYEKS-LQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLY 413
                  +E ++ K    TE EK+  +L    G              +  +I +KVIR++Y
Sbjct: 825  LRTIQCLETIVNKIENMTENEKANFKLPPGLGH-------------TSMTIYKKVIRKVY 871

Query: 414  GIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHL 473
              E G  +IDA+  +P    P +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHL
Sbjct: 872  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 931

Query: 474  GLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDV--- 525
            GL FK A+K+ L  KQL+ E  S K D+  K+ H+   + K    ++F DK++ YD+   
Sbjct: 932  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCL 991

Query: 526  KDIILCGLRSNSST-SESQKNLYCQIFEAFFDLLFE--ESSFTKH 567
             D  +    + S+   E  K+L       FF + FE  E S   H
Sbjct: 992  ADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLYSH 1036

 Score =  117 bits (292), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 132/282 (46%), Gaps = 11/282 (3%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F +  T+YER  ++K     + K++ T                 
Sbjct: 1132 NRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSS-- 1189

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QLS+ GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + NKA+KLYTID+V +++
Sbjct: 1190 QLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSL 1249

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    T+       +I+ L V +             YR +VR  M    +MFR+E  + +
Sbjct: 1250 VKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRT 1309

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+  L  L    
Sbjct: 1310 LHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPF--LERLIEFG 1367

Query: 859  QNI-------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
            Q+I        F    I    L + I P+ Y + I  GS D+
Sbjct: 1368 QDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDV 1409

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score =  246 bits (628), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 146/386 (37%), Positives = 221/386 (57%), Gaps = 40/386 (10%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E + +F   +  + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+ 
Sbjct: 673  PIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNK 732

Query: 253  GLKTAFGNIMSEYKD--------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETR 304
             L + F N +  Y++        +H++ +      D D  E F    GPSYKRL   +T 
Sbjct: 733  ELFSWFKNFVG-YQEKTKCIENIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTF 782

Query: 305  ASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF---- 360
              C GRD +C E+LNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF+    
Sbjct: 783  MPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 842

Query: 361  LLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHG 418
            L +++ L     + E   +  K D +          P +   S+T  +KVIR++Y  E G
Sbjct: 843  LRTIQCLETIVNKIENMTESEKSDFKL--------PPGLGHTSMTIYKKVIRKVYDKERG 894

Query: 419  NILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFK 478
              +IDA+  +P    P +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK
Sbjct: 895  FEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFK 954

Query: 479  NAEKRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGL 533
             A+K+ L  KQL+ E  S K D+  K+ H+   + K    ++F DK + YD+  +    +
Sbjct: 955  QADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFI 1014

Query: 534  RSNSSTSESQKNLYCQIFEAFFDLLF 559
               ++ S   K     + + F  L F
Sbjct: 1015 SHTTAYSNPDKERLKDLLKYFISLFF 1040

 Score =  115 bits (288), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 133/285 (46%), Gaps = 17/285 (5%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F +  T+YER  ++K     I K++ T                 
Sbjct: 1150 NRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSN-- 1207

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QL + GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + NKA+KLYTID+V +++
Sbjct: 1208 QLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSL 1267

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    T+       +I+ L V +             YR +VR  M  + +MFR+E+ + S
Sbjct: 1268 VKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRS 1327

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR-- 856
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+     L+R  
Sbjct: 1328 LHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPF-----LERLI 1382

Query: 857  --------EEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
                     E +  F    I    L + I P+ Y + I  GS D+
Sbjct: 1383 EFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDV 1427

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score =  246 bits (627), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 150/391 (38%), Positives = 222/391 (56%), Gaps = 50/391 (12%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E + +F   +  + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+ 
Sbjct: 679  PIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNK 738

Query: 253  GLKTAFGNIMSEYKD--------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETR 304
             L + F N +  Y++        +H++ +      D D  E F    GPSYKRL   +T 
Sbjct: 739  ELFSWFKNFVG-YQEKIKSIENVVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTF 788

Query: 305  ASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS- 363
              C GRD +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S 
Sbjct: 789  MPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 848

Query: 364  ------VEHLIVK---FTEYEKS-LQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLY 413
                  +E ++ K    TE EK+  +L    G              +  +I +KVIR++Y
Sbjct: 849  LRTIQCLETIVNKIENMTENEKANFKLPPGLGH-------------TSMTIYKKVIRKVY 895

Query: 414  GIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHL 473
              E G  +IDA+  +P    P +LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHL
Sbjct: 896  DKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 955

Query: 474  GLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDI 528
            GL FK A+K+ L  KQL+ E  S K D+  K+ H+   + K    ++F DK + YD+  +
Sbjct: 956  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYL 1015

Query: 529  ILCGLRSNSSTSESQKNLYCQIFEAFFDLLF 559
                +   ++ S   K     +   F  L F
Sbjct: 1016 ADSFIAHTTAYSNPDKERLKDLLNYFISLFF 1046

 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 127/281 (45%), Gaps = 9/281 (3%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F +  T+YER  ++K     + K++                   
Sbjct: 1156 NRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSS-- 1213

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QLS+ GL+   +D Y+ +   S++ ++G L+HQWFEE LR  + NKA+KLYTID+VI+ +
Sbjct: 1214 QLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLL 1273

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    T+       +I+ L V +             YR + R  M    +MFR+E  R +
Sbjct: 1274 VKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRN 1333

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY------YSLN 852
              +  QYI +DDL   +   ++ +   Y   Y     T+ +  + L  P+      Y  +
Sbjct: 1334 LHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYGQD 1393

Query: 853  LLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
               RE     F    +    L + I P+ Y + I  GS D+
Sbjct: 1394 TDGREVDE-KFSPEGLSVSTLKIKIQPVTYKLHIESGSYDV 1433

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score =  244 bits (623), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 146/372 (39%), Positives = 206/372 (55%), Gaps = 12/372 (3%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+    + E   +F   +  +  + IY EFLK++NL++Q L+  N    R   + GS+ 
Sbjct: 736  PIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNK 795

Query: 253  GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
             L   F   +  Y +I   ++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 796  ELFDWFKTFVG-YSEIPSTIENIIHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDA 853

Query: 313  LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFT 372
            +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF + S    I    
Sbjct: 854  MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFHIESNLRTIQTLE 913

Query: 373  EYEKSLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKV 432
                 +     + ++  ++  P     + ++I +KVIR++Y  E G  +IDA+  +P   
Sbjct: 914  TIANKINNMTAEEKKNFKL--PVGLGHTSSTIYKKVIRKVYDKERGFEIIDALHEHPAFA 971

Query: 433  VPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLL 492
            VP IL+  KEK ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQL+ 
Sbjct: 972  VPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLIS 1031

Query: 493  EYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLY 547
            E  S + D+  K  H+   + K    + F D  +L D+ D+    +   S+ S S+K   
Sbjct: 1032 EISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDLANVFIDHTSTYSNSEKERL 1091

Query: 548  CQIFEAFFDLLF 559
                  F  L F
Sbjct: 1092 KDFLRVFIGLFF 1103

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 126/288 (43%), Gaps = 15/288 (5%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F +  T+YER  ++K     + +++ +                 
Sbjct: 1227 NRHIFNLFANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLIS--T 1284

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QL+  GL+    D Y+ +   +K+ +  +++HQWFEESLR  + NKA+KLYT D+VI+ +
Sbjct: 1285 QLTMMGLDFKTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQAL 1344

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    +I       +I+ L   +             YR + R  M    +MFR+E   ++
Sbjct: 1345 VKHANSILTDSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENT 1404

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNL----- 853
            N +  QYI V+DL        K     Y   Y     T+ +  +GL  P+   NL     
Sbjct: 1405 NHVCIQYIAVEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELE 1464

Query: 854  ----LKREEQNIPFMNG----NIYKPHLSVNINPLDYVVDIAPGSIDI 893
                L  E +   F+       I    L + I+   Y +D+ PGS D+
Sbjct: 1465 NAQDLDNETEKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDV 1512

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score =  242 bits (618), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/392 (38%), Positives = 223/392 (56%), Gaps = 52/392 (13%)

Query: 196  PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
            PI+   ++ E + +F   +  + ++ +Y EFLK++NL++Q ++DL+   ++   + GS+ 
Sbjct: 687  PIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNK 746

Query: 253  GLKTAFGNIMSEYKD--------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETR 304
             L + F N +  Y++        +H++ +      D D  E F    GPSYKRL   +T 
Sbjct: 747  ELFSWFKNFVG-YQERTKFIENIVHEKHR-----LDLDLCEAF----GPSYKRLPKSDTF 796

Query: 305  ASCHGRDRLCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS- 363
              C GRD +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYDF++ S 
Sbjct: 797  MPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESN 856

Query: 364  ------VEHLIVK---FTEYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRL 412
                  +E ++ K    TE EK              V+    P +   S+T  +KVIR++
Sbjct: 857  LRTIQCLETIVNKIENMTENEK--------------VNFKLPPGLGHTSMTIYKKVIRKV 902

Query: 413  YGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDH 472
            Y  E G  +IDA+  +P    P +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDH
Sbjct: 903  YDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDH 962

Query: 473  LGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDVKD 527
            LGL FK A+K+ L  KQL+ E  S K D+  K+ H+   + K    ++F DK++  D+  
Sbjct: 963  LGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILY 1022

Query: 528  IILCGLRSNSSTSESQKNLYCQIFEAFFDLLF 559
            +    +   ++ S   K     + + F  L F
Sbjct: 1023 LADSFISHTTAYSNPDKERLKDLLKYFISLFF 1054

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 133/282 (47%), Gaps = 11/282 (3%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F +  T+YER  ++K     + K++ T                 
Sbjct: 1164 NRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSN-- 1221

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QLS+ GL+   +D Y+ +   S++ ++G+L+HQWFEESLR  + N+A+KLYTID+V +++
Sbjct: 1222 QLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSL 1281

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    T+       +I+ L V +             YR +VR  M    +MFR+E  + +
Sbjct: 1282 VKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRT 1341

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858
              +  QYI +DDL   +  +++ +   Y   Y     T+ +  + L  P+  L  L    
Sbjct: 1342 LHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPF--LERLIEFG 1399

Query: 859  QNI-------PFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
            Q+I        F    I    L + I P  Y +DI  GS D+
Sbjct: 1400 QDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDV 1441

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON}
           Anc_6.29 YOL004W
          Length = 1479

 Score =  241 bits (616), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 204/368 (55%), Gaps = 27/368 (7%)

Query: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265
           F    +  + ++ IY EFLK++NLF+Q LI ++    +   + GS   L   F N +   
Sbjct: 641 FFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQ 700

Query: 266 KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318
            +       +H++ +  L         D     GPSYKRL   +T   C GRD +C EVL
Sbjct: 701 GNPKIIENIVHEKHRLDL---------DLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVL 751

Query: 319 NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSL 378
           NDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYD+++ S    I         +
Sbjct: 752 NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKI 811

Query: 379 QLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTI 436
               ++ ++  ++    EP +   S+T  +KVIR++Y  E G  +IDA+  +P    P +
Sbjct: 812 SNMSEEEKKNFKL----EPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIV 867

Query: 437 LKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKS 496
           LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K+ L  KQL+ E  S
Sbjct: 868 LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISS 927

Query: 497 EKQDKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIF 551
            K D+  K  H+       +  ++  D  +L+D+  +    +  +S+ S S K       
Sbjct: 928 IKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFL 987

Query: 552 EAFFDLLF 559
           ++F  L F
Sbjct: 988 KSFISLFF 995

 Score =  104 bits (259), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 126/287 (43%), Gaps = 12/287 (4%)

Query: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXX 676
             ++R+  N+F + NI     +  TLYER  ++K     + K++                 
Sbjct: 1111 ITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVS- 1169

Query: 677  XMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736
              QL + GL+    D YE +   SK+ +  +++HQWFEESLR  + N+A+KLYT+D+V++
Sbjct: 1170 -TQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQ 1228

Query: 737  NILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVR 796
             ++    T+       +++ L   +             YR + R  M     MFR+E  +
Sbjct: 1229 ALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNK 1288

Query: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNL--- 853
            D   I  QYI +DDL   + +  + +   Y   Y     T+ +D + L  P+    L   
Sbjct: 1289 DDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFD 1348

Query: 854  -------LKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
                    +  + N  +    +      + I+P +Y +DI  GS DI
Sbjct: 1349 QEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDI 1395

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score =  240 bits (613), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 142/385 (36%), Positives = 211/385 (54%), Gaps = 38/385 (9%)

Query: 196 PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
           P++   N+ E   +F   +  + ++ IY EFLK++NL++Q L++     +    +     
Sbjct: 491 PLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSP 550

Query: 253 GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
            L   F + +  Y++  + ++  +      D+ D     GPSYKRL   +T   C GRD 
Sbjct: 551 ELFDWFKSFVG-YQERPKHIENVIHEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDE 608

Query: 313 LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362
           +C EVLNDEWVGHPVWASE+ GFIAH+KNQYE+TLFK+EEERHEYDF+          L 
Sbjct: 609 MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLE 668

Query: 363 SVEHLIVKFTEYEK-SLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGN 419
           ++ + I   T  EK + +L                P +   S+T  +KVIR++Y  + G 
Sbjct: 669 TIANKIANMTPEEKAAFKLP---------------PGLGHTSVTIYKKVIRKVYDKDRGF 713

Query: 420 ILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKN 479
            +IDA+  +P   VP +LK  K+K ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK 
Sbjct: 714 EIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQ 773

Query: 480 AEKRFLNDKQLLLEYKSEKQDKLLKEHYD-----NYEYKYEFFDKSVLYDVKDIILCGLR 534
           A+K+ L  KQL+ E  S K D+  K  +        +  Y+F +  V  D+  +++  L 
Sbjct: 774 ADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLA 833

Query: 535 SNSSTSESQKNLYCQIFEAFFDLLF 559
           +N++ S S        F+ F  L F
Sbjct: 834 NNNTYSPSDNERLKDFFKGFISLFF 858

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 138/281 (49%), Gaps = 8/281 (2%)

Query: 618  SNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXX 677
            S+R   N+F + NI   F ++ T+YER  +VK     + K++                  
Sbjct: 972  SDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLIS-- 1029

Query: 678  MQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRN 737
             QL+D GL+    D YE +   S+  +SG L+HQWFEESLR  ++NKA+KLYTID+VI+ 
Sbjct: 1030 TQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQA 1089

Query: 738  ILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRD 797
            ++    TI      ++I+ L  ++             YR +VR  M  + +MFR+E    
Sbjct: 1090 LVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTT 1149

Query: 798  SNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKRE 857
            ++    Q++ V+DL   +    + +   Y   Y  +  T+ +  D L TP+    +++R+
Sbjct: 1150 TSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLE-KIIERD 1208

Query: 858  EQNIP-----FMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
            E  I      +    +   ++ V I+PL Y +++ PG  DI
Sbjct: 1209 EGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDI 1249

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
           similar to Ashbya gossypii ACL004W
          Length = 1474

 Score =  238 bits (608), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 211/384 (54%), Gaps = 38/384 (9%)

Query: 196 PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
           P++   N+ E   +F   +  + ++ IY EFLK++NL++Q L+D     ++   +     
Sbjct: 585 PLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCP 644

Query: 253 GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
            L   F + +  Y++  + ++  +      D+ D     GPSYKRL   +T   C GRD 
Sbjct: 645 ELFDWFKSFVG-YQEKPKHIENIVHEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDE 702

Query: 313 LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362
           +C EVLNDEWVGHPVWASE+ GFIAH+KNQYE+TLFK+EEERHEYDF+          L 
Sbjct: 703 MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLE 762

Query: 363 SVEHLIVKFTEYEKS-LQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGN 419
           ++ + I   T  EK+  +L                P +   S+T  +KVIR++Y  + G 
Sbjct: 763 TIANKIANMTPEEKATFKLP---------------PGLGHTSVTIYKKVIRKVYDKDRGY 807

Query: 420 ILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKN 479
            +IDA+   P   VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK 
Sbjct: 808 EIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQ 867

Query: 480 AEKRFLNDKQLLLEYKSEKQDKLLKEHYD-----NYEYKYEFFDKSVLYDVKDIILCGLR 534
           A+K+ L  KQL+ E  S K D+  K  +        +  ++F D  V YD+ ++ +  L 
Sbjct: 868 ADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLE 927

Query: 535 SNSSTSESQKNLYCQIFEAFFDLL 558
           +N++ S   K      F+ F  L 
Sbjct: 928 NNNTYSAPDKERLKDFFKGFISLF 951

 Score =  121 bits (303), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 137/282 (48%), Gaps = 12/282 (4%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR+  N+F + NI   F ++ T+YER  +VK     + K++                   
Sbjct: 1069 NRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEI--ANRKVVQFAKDLNLIST 1126

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QL+D GL+   +D YE +   S+  ++G+L+HQWFEESLR  ++NKA+K+YT+D+VI+ +
Sbjct: 1127 QLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQAL 1186

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +     I      ++I+ L   +             YR +VR  M  + +MFR+E  R +
Sbjct: 1187 VKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLT 1246

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY-------YSL 851
              +  Q++ VDDL   +    K +   Y   Y  +  T+ +  D L +P+          
Sbjct: 1247 AHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEED 1306

Query: 852  NLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
             +  ++E+  P     +   +L V I+P+ Y +++  GS DI
Sbjct: 1307 IIEDKDEKYSP---EGVATSNLKVKIDPITYSMEVEFGSHDI 1345

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar
           to uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
           transcription regulatory protein
          Length = 1493

 Score =  237 bits (605), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 199/340 (58%), Gaps = 16/340 (4%)

Query: 196 PIDRPTNMAEFLIYFRNL---VYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252
           PI+   N+ E   +F  +   + ++ IY EFLK++NLF+  L+ ++    +   + G++ 
Sbjct: 613 PIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANK 672

Query: 253 GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312
            L   F  +   Y+D  +R++  +      D+ D     GPSYK+L   +T   C GRD 
Sbjct: 673 ELFDWF-KVFVGYQDKPKRIENIVHEKHKLDL-DLCEAYGPSYKKLPKTDTFMPCSGRDD 730

Query: 313 LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFT 372
           +C EVLNDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYD+++ S    I    
Sbjct: 731 MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLE 790

Query: 373 EYEKSLQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPE 430
                +    D  + + R+     P +   S+T  +KVIR++Y  E G  +IDA+   P 
Sbjct: 791 TIANKIANMTDAEKAQFRLP----PGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPA 846

Query: 431 KVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQL 490
             VP IL+  K+K ++W  A+ EWNK WR++EQK Y+KSLDHLGL FK A+K+ L  KQL
Sbjct: 847 ISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQL 906

Query: 491 LLEYKSEKQDKLLKE-HYDNYEYK----YEFFDKSVLYDV 525
           + E    K D+  K  H+   + K    Y+F D  +L+D+
Sbjct: 907 ISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDI 946

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 131/281 (46%), Gaps = 8/281 (2%)

Query: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXM 678
            NR   N+F + NI   F ++ TLYER ++VK     I K++++                 
Sbjct: 1106 NRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLIS--T 1163

Query: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738
            QLS+ GL+    D Y+ + T SK+ + G+++HQWFEES+R  + N+A+KLYTID+V+++ 
Sbjct: 1164 QLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSF 1223

Query: 739  LGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDS 798
            +    T+       +I+ L  +              YR + R  M    +MFR+E  R+ 
Sbjct: 1224 VKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREK 1283

Query: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPY------YSLN 852
                 QYI +DDL        +   + Y   Y  ++ T+ +  + L  P+      +   
Sbjct: 1284 RHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQE 1343

Query: 853  LLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
              K    N  +    I K +L ++I+   Y + +  GS D+
Sbjct: 1344 YSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDV 1384

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
           YOL004W
          Length = 1434

 Score =  236 bits (601), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 198/366 (54%), Gaps = 23/366 (6%)

Query: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265
           F    +  +  + +Y EFLK++NL++Q L+  +    +   + GS+  L T F N +   
Sbjct: 611 FFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQ 670

Query: 266 KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318
           +        +H++ K  L         D     GPSYK+L   +T   C GRD +C EVL
Sbjct: 671 EKPLIIENIVHEKHKLDL---------DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVL 721

Query: 319 NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSL 378
           NDEWVGHPVWASE+ GFIAH+KNQYEE+LFK EEERHEYDF + S    I         +
Sbjct: 722 NDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKI 781

Query: 379 QLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILK 438
               ++ ++  ++  P     + ++I +KVIR++Y  + G  +ID +   P   VP +LK
Sbjct: 782 GNMTNEEKKNFKL--PPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLK 839

Query: 439 TAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEK 498
             K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQLL E  S K
Sbjct: 840 RLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIK 899

Query: 499 QDKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEA 553
            D+  K  H+       + +++F D  +  D+  +    +  +S+ S  +K         
Sbjct: 900 VDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRV 959

Query: 554 FFDLLF 559
           F  L F
Sbjct: 960 FVSLFF 965

 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 141/316 (44%), Gaps = 5/316 (1%)

Query: 580  SNSQISEDDVEAMFMKGILEEKGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQ 639
            SN +++E D   + ++ I     LG      +      SNR+  N+F + NI   F    
Sbjct: 1057 SNEELNEQDENEIILEEIKRPWLLGNIIETASN-HGTISNRKVFNMFANTNIYVFFRLWT 1115

Query: 640  TLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXXXXMQLSDNGLELGQDDGYEWIKTT 699
             +YER  ++K     + K++ +                 QL D GL+    + Y+ +   
Sbjct: 1116 VIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLIS--TQLKDMGLDFVGVNSYQELLVL 1173

Query: 700  SKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLV 759
            SK+ +  +++HQWFEESLR  F NKA+KLYT+D+VI++++    TI       +I+ L  
Sbjct: 1174 SKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFE 1233

Query: 760  DNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKN 819
             +             YR + R  M    +MFR+E   + N +  QYI ++DL   Q    
Sbjct: 1234 KDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSM 1293

Query: 820  KLEHSLYCQEYLSADATKYLDTDGLNTPYY--SLNLLKREEQNIPFMNGNIYKPHLSVNI 877
            +     Y   Y     T+ +  D L  P+   +L L   EE +       +    L + I
Sbjct: 1294 EKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDNKSSPEGVSSSKLKIKI 1353

Query: 878  NPLDYVVDIAPGSIDI 893
            +P  Y ++I PGS D+
Sbjct: 1354 DPKSYALEIEPGSFDL 1369

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score =  209 bits (531), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 196/377 (51%), Gaps = 45/377 (11%)

Query: 206  FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265
            F    +  + +++IY EFLK++NL++  L++++   ++   +   +  L + F N +   
Sbjct: 863  FFDKVKKYIGNKTIYAEFLKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYV 922

Query: 266  KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318
            +        +H++ K  L         D     GPSYK+L   +T   C GRD +C E+L
Sbjct: 923  EKPKHIENIVHEKHKLDL---------DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEIL 973

Query: 319  NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLS----------VEHLI 368
            NDEWVGHPVWASE+ GFIAH+K   ++   +++++ HEYDF++ S          +   I
Sbjct: 974  NDEWVGHPVWASEDSGFIAHRKINTKKPYLRLKKKVHEYDFYIESNLRTIQTLETIASKI 1033

Query: 369  VKFTEYEK-SLQLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKT 427
               TE EK + +L    G              + ++I +KVIR++Y  E G  +IDA+  
Sbjct: 1034 ANMTENEKCNFKLPDGLGH-------------TTSTIYKKVIRKVYDKERGFEIIDALHE 1080

Query: 428  NPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLND 487
             P   VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK A+K+ L  
Sbjct: 1081 YPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTT 1140

Query: 488  KQLLLEYKSEKQDKLLKEHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSES 542
            KQL+ E  S K D+  K  +        +  +   DK +++D+   +   +   S+ S  
Sbjct: 1141 KQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSFVEIFVEHTSTYSNP 1200

Query: 543  QKNLYCQIFEAFFDLLF 559
            +K       + F  L F
Sbjct: 1201 EKERLIDFMKYFTSLFF 1217

 Score = 98.2 bits (243), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 128/291 (43%), Gaps = 15/291 (5%)

Query: 616  EFSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTXXXXXXXXXXXXXX 675
            E  +R   N+F + N+     ++ T+YER +++K     + +++                
Sbjct: 1326 EIMHRNIFNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVSREI--SGRKISKFAKDLNL 1383

Query: 676  XXMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVI 735
               QL++ GL+  + D Y+ +    K+ + G+L+HQWFEESLR  F NKA+KLYT+D+V 
Sbjct: 1384 ISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVT 1443

Query: 736  RNILGVITTISQTPSLLQILDLLVDNMXXXXXXXXXXXXYRTKVRMLMDGVGDMFRLEIV 795
            + ++    TI       +I+ L   +             YR + R  M    +MFR+E  
Sbjct: 1444 QALVKHAHTIISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYN 1503

Query: 796  RDSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLL- 854
              +  I  QYI +DDL        + +   Y   Y  +  T+ +  + +  P+    +  
Sbjct: 1504 NTTKHICIQYIALDDLTVKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFLERIIEE 1563

Query: 855  ------------KREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDI 893
                        K+ +  + +    I    L + I+P +Y ++I  GS DI
Sbjct: 1564 EQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDI 1614

>KNAG0L01350 Chr12 (242151..243827) [1677 bp, 558 aa] {ON} Anc_7.220
           YER049W
          Length = 558

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 271 RMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWAS 330
           +++  + S++F +     T+ GP    LSG +T  SCH  D+ CH + +D+ VG     S
Sbjct: 109 QLRQLIYSDEFRNFISTVTQCGP----LSGVKTDLSCHIYDKHCHLLNHDDVVG-----S 159

Query: 331 EEVGFIAH 338
             V FI +
Sbjct: 160 RRVSFILY 167

>TPHA0C01270 Chr3 (289150..290577) [1428 bp, 475 aa] {ON} Anc_7.216
           YIL039W
          Length = 475

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 182 AKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYD-ESIYPEFLKLMNLFAQSLIDLNTF 240
           ++FS L  KD ++   D  T+ A  L+   +L+ D  ++ PEF++    F ++L + N F
Sbjct: 248 SRFSHLFGKDNYWVEYDAGTDHAWRLVVLNSLLLDGPALQPEFVEGTWAFLRALENRN-F 306

Query: 241 TKR----AYIFFGSHNGLKTAFGNIMSEYKDIHQR 271
           T       ++ F    GL  A G + S Y D+++R
Sbjct: 307 TGSTVLLTHVPFYKEAGL-CADGPMFSYYPDVYER 340

>TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {ON}
           Anc_6.215 YPL204W
          Length = 490

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 168 SIRSTLSQNTDNRCAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPEFLKLM 227
            +++T  +   +R  +  + +S +T    +  P   AEF++Y RNL +DE   P++L L 
Sbjct: 215 GLKATTKKQKYDRILEKKLCTSVETLCGGL--PQEFAEFMLYCRNLKFDER--PDYLYLA 270

Query: 228 NLFAQSLIDL 237
            LF    I L
Sbjct: 271 RLFKDLSIKL 280

>Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL091W
           (REAL)
          Length = 1232

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 397 PMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNK 456
           P+IS  S + K+++  +G+     L DA+ TNP    P I++T + + Q           
Sbjct: 901 PLISNGSSSTKLLQNDFGLSSWGGLTDALSTNP-TCEPPIIQTTEMRSQ----------- 948

Query: 457 AWREVEQKAYYKSLDHLGLPFKNAEKR 483
                +Q +   S+   GLP   A ++
Sbjct: 949 ----AQQPSSQPSIPTFGLPNDGAHRK 971

>Skud_14.119 Chr14 (229071..230051) [981 bp, 326 aa] {ON} YNL217W
           (REAL)
          Length = 326

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 411 RLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAY---Y 467
           +L+G+  G +  D IK+N    +P++   +  K+      K  W+K  RE E K Y   +
Sbjct: 206 KLFGVHAGMLPGDFIKSNQ---IPSVSSLSNMKFVN----KKHWSKTSREKENKNYVRWF 258

Query: 468 KSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQ 499
              D  G  F NA+  + +D  + L  + + +
Sbjct: 259 TMWDKYGDSFSNAKVFYGHDASMGLNLRKQTK 290

>CAGL0K08844g Chr11 (887412..888938) [1527 bp, 508 aa] {ON} similar
           to uniprot|P23180 Saccharomyces cerevisiae YHL021c
          Length = 508

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 7/56 (12%)

Query: 459 REVEQKAYYKSLDHLGL--PFKNAEKRFLNDKQLLLEYKSEKQDKLLKEHYDNYEY 512
           RE + +AY ++L H+ +   FKN  KR+   K L+ EY+S + + L+     NYEY
Sbjct: 329 RETDNEAY-EALQHVPINYTFKNKNKRYYQSKPLVEEYESNEHNTLIG----NYEY 379

>ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {ON}
           similar to uniprot|P29295 Saccharomyces cerevisiae
           YPL204W HRR25 Protein kinase involved in regulating
           diverse events including vesicular trafficking gene
           expression DNA repair and chromosome segregation binds
           the CTD of RNA pol II homolog of mammalian casein kinase
           1delta (CK1delta)
          Length = 501

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 168 SIRSTLSQNTDNRCAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDESIYPEFLKLM 227
            +++T  +   +R  +  + +S +T    +  P   AE+++Y RNL +DE   P++L L 
Sbjct: 215 GLKATTKKQKYDRILEKKLCTSVETLCAGL--PQEFAEYMLYCRNLKFDER--PDYLYLA 270

Query: 228 NLFAQSLIDL 237
            LF    I L
Sbjct: 271 RLFKDLSIKL 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,659,905
Number of extensions: 4781576
Number of successful extensions: 18151
Number of sequences better than 10.0: 94
Number of HSP's gapped: 18711
Number of HSP's successfully gapped: 114
Length of query: 937
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 818
Effective length of database: 39,836,145
Effective search space: 32585966610
Effective search space used: 32585966610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)