Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J10802g5.353ON57573001e-37
KAFR0C018405.353ON58562741e-33
KLLA0C16753g5.353ON57562732e-33
TDEL0E027405.353ON58562698e-33
KNAG0C054905.353ON56562671e-32
TBLA0H019605.353ON58562662e-32
NCAS0H016305.353ON58562645e-32
SAKL0G08800g5.353ON59562611e-31
KLTH0H14894g5.353ON59562602e-31
Kwal_34.159765.353ON59562593e-31
Kpol_1051.65.353ON58562566e-31
ZYRO0D10208g5.353ON64562569e-31
YHR072W-A (NOP10)5.353ON58562551e-30
Smik_8.1495.353ON58562542e-30
TPHA0D020805.353ON59562542e-30
Ecym_81795.353ON58562523e-30
Suva_15.2635.353ON58562507e-30
Skud_8.1325.353ON58562481e-29
AGR354W5.353ON69572454e-29
Suva_16.4453.443ON249629670.13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J10802g
         (57 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   120   1e-37
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   110   1e-33
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   109   2e-33
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   108   8e-33
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   107   1e-32
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   107   2e-32
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   106   5e-32
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   105   1e-31
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   104   2e-31
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   104   3e-31
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   103   6e-31
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   103   9e-31
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   102   1e-30
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   102   2e-30
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   102   2e-30
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   101   3e-30
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   100   7e-30
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   100   1e-29
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...    99   4e-29
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    30   0.13 

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  120 bits (300), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/57 (100%), Positives = 57/57 (100%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPQ 57
          MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPQ
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPQ 57

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (274), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 54/56 (96%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLD +GKRVYTLKK+TEEGEITKSAHPARFSPDDKYSRQRVTLKKRY LLP
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP 56

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  109 bits (273), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLD +GKR+YTLKKMTE+ EITKSAHPARFSPDDKYSRQRVTLKKRYNLLP
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKRVYTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  107 bits (267), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTLDNEGKR+YTLKK T +GEITKSAHPARFSPDDKYSRQRVTLKKR+ +LP
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  107 bits (266), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKRVYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  106 bits (264), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK+TE+GEITKSAHPARFSPDDKYSRQRVTLKKRY LLP
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLP 56

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  105 bits (261), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK TEEGEITKSAHPARFSPDDKYSRQRVTLKKR+N+LP
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLP 56

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  104 bits (260), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIP 56

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  104 bits (259), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIP 56

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  103 bits (256), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKRVYTLKK TEEGEITKSAHPARFSPDDK+SRQRVTLKKR+ LLP
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLP 56

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  103 bits (256), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR YTL+K+TEEGEITKSAHPARFSPDDKYSRQRVTLK+RY LLP
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLP 56

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  102 bits (255), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK+TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  102 bits (254), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK+TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  102 bits (254), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 53/56 (94%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLM+TL  +GKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR++LLP
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLP 56

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  101 bits (252), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLM+TL  +GKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+N+LP
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  100 bits (250), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 51/56 (91%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  100 bits (248), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
          MHLMYTL  +GKR+YTL K+TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score = 99.0 bits (245), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 45/57 (78%), Positives = 53/57 (92%)

Query: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPQ 57
          MHLMYTL  +GKRVYTL+K+T  GEITKSAHPARFSPDDKYSRQRVTLK+R+++LP+
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLPR 69

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
            (REAL)
          Length = 2496

 Score = 30.4 bits (67), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 10   EGKRVYTLKKMTEEGEITKSAHPARFSPD 38
            +G  ++TL  + E+G+I+K+    RF PD
Sbjct: 1291 DGNVIWTLGLLFEQGDISKAGDEERFLPD 1319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,335,643
Number of extensions: 193054
Number of successful extensions: 564
Number of sequences better than 10.0: 21
Number of HSP's gapped: 564
Number of HSP's successfully gapped: 21
Length of query: 57
Length of database: 53,481,399
Length adjustment: 30
Effective length of query: 27
Effective length of database: 50,041,419
Effective search space: 1351118313
Effective search space used: 1351118313
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)