Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J08206g1.82ON1898187887730.0
Smik_14.661.82ON1952110629820.0
YNL271C (BNI1)1.82ON1953115629790.0
Skud_14.691.82ON1946110429570.0
Suva_14.711.82ON1948109829070.0
NCAS0A005901.82ON1946111328280.0
KAFR0D039501.82ON1957112327630.0
NDAI0F042201.82ON2022113826490.0
TDEL0C061901.82ON1879106925940.0
Kpol_2000.661.82ON1930107725110.0
KNAG0F004701.82ON2028109124760.0
ZYRO0F16676g1.82ON1994103623740.0
TPHA0B044901.82ON1940110721940.0
TBLA0A054401.82ON217062920490.0
SAKL0C02618g1.82ON1988113820080.0
Kwal_33.133921.82ON196861519180.0
KLTH0F02376g1.82ON197661118610.0
AFR669W1.82ON191858518210.0
Ecym_10861.82ON209161818220.0
KLLA0C02321g1.82ON184261216890.0
NCAS0G001205.717ON13144828422e-91
SAKL0E15224g5.717ON13354208244e-89
Kpol_416.105.717ON14914268204e-88
CAGL0H06765g5.717ON12944278056e-87
TDEL0F055605.717ON12924318048e-87
Ecym_5679na 1ON13064108022e-86
AGL364Cna 1ON12604297932e-85
AFR301C5.717ON16554268002e-85
KNAG0L022505.717ON13674777909e-85
Ecym_40045.717ON14544207776e-83
Skud_9.85.717ON13744917721e-82
Smik_9.95.717ON13744927722e-82
ZYRO0B16654g5.717ON14244207651e-81
NDAI0F001605.717ON13494237551e-80
Kwal_55.196205.717ON13894287561e-80
TPHA0E001205.717ON16424817484e-79
YIL159W (BNR1)5.717ON13754907382e-78
KLTH0E00704g5.717ON13894217364e-78
TBLA0E018105.717ON14514757171e-75
KLLA0F10912g5.717ON12834367131e-75
Suva_9.265.717ON13754237142e-75
KAFR0D021205.717ON13244176981e-73
CAGL0B04477g2.179ON283152801.1
Ecym_3545na 2ON67095773.9
KAFR0E025508.426ON1108111774.4
TPHA0A026401.151ON825184765.3
KLTH0D09152g2.172ON60884755.8
YDL139C (SCM3)7.312ON223105729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J08206g
         (1898 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...  3383   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...  1153   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...  1152   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...  1143   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...  1124   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1093   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....  1068   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}          1025   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...  1003   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   971   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     958   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   919   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   849   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   793   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   778   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   743   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   721   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   706   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   706   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   655   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      328   2e-91
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   322   4e-89
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   320   4e-88
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   314   6e-87
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   314   8e-87
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   313   2e-86
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   310   2e-85
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   312   2e-85
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   308   9e-85
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   303   6e-83
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   301   1e-82
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   301   2e-82
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   299   1e-81
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     295   1e-80
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   295   1e-80
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   292   4e-79
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   288   2e-78
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   288   4e-78
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   280   1e-75
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   279   1e-75
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   279   2e-75
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   273   1e-73
CAGL0B04477g Chr2 complement(437357..438208) [852 bp, 283 aa] {O...    35   1.1  
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...    34   3.9  
KAFR0E02550 Chr5 complement(522127..525453) [3327 bp, 1108 aa] {...    34   4.4  
TPHA0A02640 Chr1 (566643..569120) [2478 bp, 825 aa] {ON} Anc_1.1...    34   5.3  
KLTH0D09152g Chr4 (760328..762154) [1827 bp, 608 aa] {ON} highly...    33   5.8  
YDL139C Chr4 complement(211375..212046) [672 bp, 223 aa] {ON}  S...    32   9.3  

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score = 3383 bits (8773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1679/1878 (89%), Positives = 1679/1878 (89%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80
            LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK
Sbjct: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80

Query: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINL 140
            STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINL
Sbjct: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINL 140

Query: 141  TRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQS 200
            TRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQS
Sbjct: 141  TRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQS 200

Query: 201  LPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDXXXXXXXX 260
            LPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSD        
Sbjct: 201  LPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPP 260

Query: 261  XXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSD 320
                              APSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSD
Sbjct: 261  GPISSSGSSIFSSDVTSTAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSD 320

Query: 321  KANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYK 380
            KANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYK
Sbjct: 321  KANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYK 380

Query: 381  TTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMA 440
            TTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMA
Sbjct: 381  TTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMA 440

Query: 441  TEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQA 500
            TEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQA
Sbjct: 441  TEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQA 500

Query: 501  WLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTL 560
            WLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTL
Sbjct: 501  WLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTL 560

Query: 561  LRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVS 620
            LRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVS
Sbjct: 561  LRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVS 620

Query: 621  LMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTS 680
            LMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTS
Sbjct: 621  LMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTS 680

Query: 681  TEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV 740
            TEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV
Sbjct: 681  TEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV 740

Query: 741  GQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNSRPAKT 800
            GQLEMEVKERDRILAKNQRVM                         RKMLTILNSRPAKT
Sbjct: 741  GQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPAKT 800

Query: 801  KEQKKKIGSIEASEKEDLQRALQSGLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESI 860
            KEQKKKIGSIEASEKEDLQRALQSGLQ             GMTIQPNQRLKVLRMQMESI
Sbjct: 801  KEQKKKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESI 860

Query: 861  ENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESN 920
            ENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESN
Sbjct: 861  ENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESN 920

Query: 921  DVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSL 980
            DVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSL
Sbjct: 921  DVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSL 980

Query: 981  DPKVYQDKLDEITKISEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDI 1040
            DPKVYQDKLDEITKISEELLQQKNELETTQT                     ALTNNKDI
Sbjct: 981  DPKVYQDKLDEITKISEELLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDI 1040

Query: 1041 NGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYV 1100
            NGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYV
Sbjct: 1041 NGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYV 1100

Query: 1101 EELSKKMRGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLLXXXXXXXXXXXXXXXX 1160
            EELSKKMRGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLL                
Sbjct: 1101 EELSKKMRGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLLATSAVSPTTSAPPPPP 1160

Query: 1161 XXXXXGLFGANNDNNTGDSDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1220
                 GLFGANNDNNTGDSDA                                       
Sbjct: 1161 PPMPAGLFGANNDNNTGDSDAISVSGTPAPPPPPPPPPFLKDSSPIPPPPMPTMLTPSES 1220

Query: 1221 XXXXXXXXXAPPMMTKDSKKKVVXXXXXXXXXXXFENYPRPQKKLKQLHWEKVESTDNSI 1280
                     APPMMTKDSKKKVV           FENYPRPQKKLKQLHWEKVESTDNSI
Sbjct: 1221 TTSLSSIPPAPPMMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSI 1280

Query: 1281 WGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINL 1340
            WGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINL
Sbjct: 1281 WGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINL 1340

Query: 1341 HMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKK 1400
            HMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKK
Sbjct: 1341 HMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKK 1400

Query: 1401 IEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVD 1460
            IEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVD
Sbjct: 1401 IEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVD 1460

Query: 1461 KAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYV 1520
            KAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYV
Sbjct: 1461 KAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYV 1520

Query: 1521 EKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSK 1580
            EKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSK
Sbjct: 1521 EKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSK 1580

Query: 1581 FHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKF 1640
            FHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKF
Sbjct: 1581 FHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKF 1640

Query: 1641 ADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXX 1700
            ADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGN      
Sbjct: 1641 ADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEE 1700

Query: 1701 XXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHXXXXXXXXPLAEMQVGGDSLI 1760
                 AVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIH        PLAEMQVGGDSLI
Sbjct: 1701 SEDRRAVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLI 1760

Query: 1761 YSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMEL 1820
            YSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMEL
Sbjct: 1761 YSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMEL 1820

Query: 1821 RGSDALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDEKXXXXXXXXXXXXXXXT 1880
            RGSDALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDEK               T
Sbjct: 1821 RGSDALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDEKSPDEEQEEVSSSSIST 1880

Query: 1881 TGIVTAQESPVQIDENED 1898
            TGIVTAQESPVQIDENED
Sbjct: 1881 TGIVTAQESPVQIDENED 1898

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score = 1153 bits (2982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/1106 (56%), Positives = 774/1106 (69%), Gaps = 69/1106 (6%)

Query: 73   QSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAP 132
            ++RPLNKKSTLN+QNLSQY+N   +      S H R+ S QS  KYSYS+R+S Q S   
Sbjct: 82   EARPLNKKSTLNTQNLSQYMNGKISADVPVSSQHARSHSMQS--KYSYSKRNSSQASN-- 137

Query: 133  SSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIM 192
                   LTR +T  S S +S+LS GS+TNLS+F TPDGKI+L MPSDPYEVE LFEDIM
Sbjct: 138  ------KLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIM 191

Query: 193  YKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSM------ 246
            YKRNI QSL  +KQ  LMSYS EKKWLIVKQDLQNE K+++A+    S    +       
Sbjct: 192  YKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTSIASDHH 251

Query: 247  PDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTE--- 303
            P L ++                            ST   S   +   SK +   S +   
Sbjct: 252  PILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQP 311

Query: 304  -LYHI----AERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWV 358
             L +I    +E NTS+ST+  D+ NRPPIHYV++I+ DKL+ DEMKDLWVTLRTEQLDWV
Sbjct: 312  SLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWV 371

Query: 359  DAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIH 418
            DAF+++QGHIAMAN+LM SIYKT P+D +++ LL+KEN+FFKCFRVL++LSQGL+EF+ H
Sbjct: 372  DAFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRVLSMLSQGLYEFSTH 431

Query: 419  SLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNES 478
             LMTDT+A+GLFS RLATRKMATEIFV +LEKKNK RFE+VL++LDK F IGQN HM ++
Sbjct: 432  RLMTDTVAEGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQN 491

Query: 479  YKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYC 538
            +KK+PQYF+HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+++KN GGENAILEYC
Sbjct: 492  FKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYC 551

Query: 539  QWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLD 598
            QWTMVFINHLCS S+NINQR LLR KLENCG+LRIMNKIKLLDY+KV+DQIELY+NNKLD
Sbjct: 552  QWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLD 611

Query: 599  DFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQD 658
            DFN  LE+N K  NVDLQDP+SL+KNL D CKGTENEK LVSLVQH+FL +SKL++E Q+
Sbjct: 612  DFNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQN 671

Query: 659  PNKVTKQLKLMDSLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKK 717
            P+K+TKQLK+MDSLVT+VS+ ST +E SN+NMAIQRLYD+MQTDEVARRAILESR LTKK
Sbjct: 672  PSKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEVARRAILESRALTKK 731

Query: 718  LEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXX 777
            LEE++AERD L EKLSKAEHGLVGQLE E+  RDRILAKNQRVM                
Sbjct: 732  LEEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQLEAELEELKKKHLL 791

Query: 778  XXXXXXXXXRKMLTILNSRPAKTKEQKKKI----GSIEASEKEDLQRALQSGLQXXXXXX 833
                     RKMLTILNSRP +     + I     S+ +SEK ++Q+ LQ GL       
Sbjct: 792  EKHQQEVELRKMLTILNSRPEENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDY 851

Query: 834  XXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPP---------- 883
                   GMT+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK  L+PP          
Sbjct: 852  KDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKK 911

Query: 884  ---ANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKR 940
                + +  S+P     +E  + KLN+LR  L  IQMESND+SKFNV+ERVNELFN+KK 
Sbjct: 912  IKHKDKKLISRP-----QEVDMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKS 966

Query: 941  TALQRLKELETKYKGFGIDFKVEDFTHES-TDSSNE------GYSSLDPKVYQDKLDEIT 993
             AL+RLKELETKYKGFGIDF VE+       +S+NE       YSSLDP+ YQ+KLDEI 
Sbjct: 967  LALKRLKELETKYKGFGIDFNVEEIMESPKKNSANERKEDGANYSSLDPRTYQNKLDEIN 1026

Query: 994  KISEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVS-DLAS 1052
            +I+++LL    + +T Q                           +++   +S +S +  S
Sbjct: 1027 RITDQLLDL--QAQTKQDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGS 1084

Query: 1053 GSFLDTLTQKYGTGQAEPIQ---------SPVGHYSNRNEKSFVDRMKRN--SRVPSYVE 1101
            GSFLD L+QKYGTGQ   +          S +GH  ++ EK+F+++++++  S  P Y+E
Sbjct: 1085 GSFLDALSQKYGTGQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKSTASSAP-YLE 1143

Query: 1102 ELSKKMRGNKDHEFEEDDHKNGNQSS 1127
            EL++K+   + +E +ED+ ++   SS
Sbjct: 1144 ELTQKVNKVESYEQDEDEVRSKESSS 1169

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/594 (68%), Positives = 483/594 (81%), Gaps = 2/594 (0%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP KKLKQLHWEK++STDNSIWG+ KAEKFADDLYEKGVL++LEKAFAAREIKSL
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            AT++KEDL+KI+FLS DISQQFGINLHMYS+L+V   V+K+L C+RDF+ TPSV+EFLSK
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI+EVS NLARNYAPYSTDWEG+K ++DAK PEKDPN+LQRADQIYLQLMVNL+SYW S
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+ ++TSYE+EYNELL KL +VDKAVG+LQ SDNL+N+FNVILAVGNFMND++KQA+
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD +NSMTFLNYVEKI+R NYP FN+FL ELEPVL+VVKVSIEQLVN
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC DF Q I NVERS+EIGNLSDSSKFHPLDK+L+K LP L EARKKG+LL DE+KLTIM
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +M TYGED GDKFAKISFF+KFADFI EYKKAQ+QN+  EEEE  YE+HKK+VEEQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q++AQE   +   ++S +             AVMDKLLEQLKNAG  K+DP+SARKRAL+
Sbjct: 1767 QKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGPGKSDPSSARKRALV 1826

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKE-QIELEIHMASPTPKTKEDGKLGTGEN 1793
            RK+           L ++     S++YSP+A +   +  IH  SPTP T   G L   E+
Sbjct: 1827 RKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTTR-GTLNIPED 1885

Query: 1794 SNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRT 1847
                S    + + EEI DRAK LL ELRGSD  + +N+ LDEH E+LRAR++RT
Sbjct: 1886 LPSPSKASTLEDQEEISDRAKMLLKELRGSDTPVKQNSILDEHLEKLRARKERT 1939

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/1156 (54%), Positives = 792/1156 (68%), Gaps = 71/1156 (6%)

Query: 21   LFQNLRRLTTKDRDNRN------KSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQS 74
            +FQNL+RL   +  N N       S ++ S   + +S     + +  +  +    +  ++
Sbjct: 23   IFQNLKRLANSNATNSNTGSPTYASQQQHSPVGNEVSTSPASSSSFRKLNAPSRSTSTEA 82

Query: 75   RPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSS 134
            RPLNKKSTLN+QNLSQY+N   +      S H R+ S QS  KYSYS+R+S Q S     
Sbjct: 83   RPLNKKSTLNTQNLSQYMNGKLSGDVPVSSQHARSHSMQS--KYSYSKRNSSQASN---- 136

Query: 135  MGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYK 194
                 LTR +T  S S++S+LS GS+TNLS+F TPDGKI L MPSDPYEVE LFEDIMYK
Sbjct: 137  ----KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVEVLFEDIMYK 192

Query: 195  RNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSM------PD 248
            RNI QSL ++KQ  LM YSIEKKWLIVKQDLQNE K+++A+    S    +       P 
Sbjct: 193  RNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRTSMASDHHPI 252

Query: 249  LGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRS-------GKKNIPISKPIAATS 301
            L ++                            ST   S       GKK +  S     + 
Sbjct: 253  LTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKGKKLVSGSLKKQPSL 312

Query: 302  TELYHI-AERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDA 360
              +Y   AE NTS+ST+  D+ NRPPIHYV++I+ DKL+ DEMKDLWVTLRTEQLDWVDA
Sbjct: 313  NNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWVTLRTEQLDWVDA 372

Query: 361  FLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSL 420
            F+++QGHIAMAN+LM SIYKT P++ +++ LL+KEN+FFKCFRVL++LSQGL+EF+ H L
Sbjct: 373  FIDHQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRL 432

Query: 421  MTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYK 480
            MTDT+A+GLFS +LATRKMATEIFV +LEKKNK RFE+VL+SLDK F IGQN HM +++K
Sbjct: 433  MTDTVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFK 492

Query: 481  KLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQW 540
            K+PQYF+HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+++KN GGENAILEYCQW
Sbjct: 493  KMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQW 552

Query: 541  TMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDF 600
            TMVFINHLCS S+NINQR LLR KLENCGILRIMNKIKLLDY+KVIDQIELY+NNKLDDF
Sbjct: 553  TMVFINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNNKLDDF 612

Query: 601  NALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPN 660
            N  LE+N K  NVDL DP+SL+KNL D CKGTENEK LVSLVQH+FL +SKL++E Q+ +
Sbjct: 613  NVKLEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLSSSKLIEENQNSS 672

Query: 661  KVTKQLKLMDSLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLE 719
            K+TKQLKLMDSLVTNVSV ST +E +N+NMAIQRLYD+MQTDEVARRAILESR LTKKLE
Sbjct: 673  KLTKQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRAILESRALTKKLE 732

Query: 720  EMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXX 779
            E++AERD L EKLSKAEHGLVGQLE E+ ERDRILAKNQRVM                  
Sbjct: 733  EIQAERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAELEELKKKHLLEK 792

Query: 780  XXXXXXXRKMLTILNSRPA----KTKEQKKKIGSIEASEKEDLQRALQSGLQXXXXXXXX 835
                   RKMLTILNSRP     K +  +    S+ +SEK ++Q+ LQ GL         
Sbjct: 793  HQQEVELRKMLTILNSRPEESFNKNEGTRGMNSSLNSSEKANIQKVLQDGLSRAKKDYKD 852

Query: 836  XXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKS----- 890
                 GMT+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK  L+PP +++K       
Sbjct: 853  DSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMK 912

Query: 891  ----KPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRL 946
                KP+ +  +E  + KLN+LR  L  IQMESND+SKFNV+ERVNELFN+KK  AL+RL
Sbjct: 913  NKDRKPLVK-PQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRL 971

Query: 947  KELETKYKGFGIDFKVEDF-------THESTDSSNEGYSSLDPKVYQDKLDEITKISEEL 999
            KELETKYKGFGIDF V++        T +     +  Y+SLDPK YQ KLDEI +I+++L
Sbjct: 972  KELETKYKGFGIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQKKLDEINRITDQL 1031

Query: 1000 L----QQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVSDLAS-GS 1054
            L    Q ++E++  +                      + T  +++    S +S  +  GS
Sbjct: 1032 LDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDASPT--QELRSEHSELSSGSGPGS 1089

Query: 1055 FLDTLTQKYGTGQAEPIQSPVGHYSN---------RNEKSFVDRMKRN--SRVPSYVEEL 1103
            FLD L+QKYGTGQ     +  G  +N         + EK+F++R++++  S  P Y+EEL
Sbjct: 1090 FLDALSQKYGTGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAP-YLEEL 1148

Query: 1104 SKKMRGNKDHEFEEDD 1119
            ++K+   + +E  ED+
Sbjct: 1149 TQKVNKVEPYEQNEDE 1164

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/607 (68%), Positives = 486/607 (80%), Gaps = 3/607 (0%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP KKLKQLHWEK++ TDNSIWG+ KAEKFADDLYEKGVL++LEKAFAAREIKSL
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A+++KEDLQKI+FLS DISQQFGINLHMYS+L+V   V+K+L C+RDF+ TPSV+EFLSK
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI+EVS NLARNYAPYSTDWEG++ +EDAK PEKDPN+LQRADQIYLQLMVNL+SYW S
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+ ++TSYEREYNELLAKL +VDKAV +LQ SDNL+N+FNVILAVGNFMND++KQA+
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD  NSMTFLNYVEKIVR NYP FN+FL ELEPVL+VVKVSIEQLVN
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC DF Q I NVERS+EIGNLSDSSKFHPLDKVL+K LP L EARKKG+LL DE+KLTIM
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +M TYGED GDKFAKISFF+KFADFI EYKKAQAQN+  EEEE  Y +HKK+VEEQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q++AQE   +   ++S +             AVMDKLLEQLKNAG  K+DP+SARKRAL+
Sbjct: 1768 QKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALV 1827

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQI-ELEIHMASPTPKTKEDGKLGTGEN 1793
            RKK           L ++     S++YSP+A +   +  IH  SPTP     G + T E+
Sbjct: 1828 RKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLATR-GVMNTSED 1886

Query: 1794 SNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIP 1853
                S    + + EEI DRA+ LL ELRGSD  + +N+ LDEH E+LRAR++R+   +  
Sbjct: 1887 LPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRARKERS-IGEAS 1945

Query: 1854 SSNRLKF 1860
            + NRL F
Sbjct: 1946 TGNRLSF 1952

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1104 (56%), Positives = 768/1104 (69%), Gaps = 60/1104 (5%)

Query: 66   SRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSS 125
            SR  SI ++RPLNKKSTLN+QNLSQY++   +      S H R+ S QS  KYSYS+R+S
Sbjct: 74   SRTTSI-EARPLNKKSTLNTQNLSQYMSGKMSADVPISSQHARSHSVQS--KYSYSKRNS 130

Query: 126  GQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVE 185
             Q S          LTR +T  S S++S+LS GS+TNLS+F TPDGKI+L MPSDPYEVE
Sbjct: 131  SQASN--------KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVE 182

Query: 186  SLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMS 245
             LFEDIMYKRNI QSL  +KQ  LM YS EKKWLIVKQDLQNE K+++A+    S    +
Sbjct: 183  ILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRT 242

Query: 246  ------MPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAA 299
                  +P L ++                            ST   S   +   SK I  
Sbjct: 243  SVASDHLPILTANSSLSSPKSILMTSASSPTSTVYSNNLNHSTTLSSAGTSTSKSKKIVT 302

Query: 300  TSTE----LYHI----AERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLR 351
             S +    L +I    +E N S+ST+  D+ NRPPIHYV++I+ DKL+ DEMKDLWVTLR
Sbjct: 303  GSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLR 362

Query: 352  TEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQG 411
            TEQLDWVDAF+E+QGHIAMAN+LM S+YKT P+D +++ LL+KEN+FFKCFRVL++LSQG
Sbjct: 363  TEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLSQG 422

Query: 412  LHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQ 471
            L+EF+ H LMTDT+A+GLFS +LAT+KMATEIFV +LEKKNK RFE+VL++LDK F IGQ
Sbjct: 423  LYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQ 482

Query: 472  NSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGE 531
            N HM +++KK+PQYF+HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+D+KN GGE
Sbjct: 483  NLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGGGE 542

Query: 532  NAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIEL 591
            NAILEYCQWTMVFINHLCS S+NINQR LLR KLENCG+LRIMNKIKLLDY+KVIDQI+L
Sbjct: 543  NAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQIDL 602

Query: 592  YENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSK 651
            Y+NNKLDDFN  LE+N +  NVDLQDP+SL+KNL   CKGTENEK LVSLVQH+FL +SK
Sbjct: 603  YDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSSSK 662

Query: 652  LLDEKQDPNKVTKQLKLMDSLVTNVSVTS-TEEGSNVNMAIQRLYDSMQTDEVARRAILE 710
            L++E Q+ +K+TKQLKLMDSLVTNVS+ S  +E SN+NMAIQRLYD+MQTDEVARRAILE
Sbjct: 663  LIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAILE 722

Query: 711  SRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXX 770
            SR LTKKLEE++AERD L EKLSKAEHGLVGQLE E+ ERD ILAKNQRVM         
Sbjct: 723  SRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESELEE 782

Query: 771  XXXXXXXXXXXXXXXXRKMLTILNSRPAKTK---EQKKKIG-SIEASEKEDLQRALQSGL 826
                            RKMLTILNSRP ++    E  + I  S+  SEK ++Q+ LQ GL
Sbjct: 783  LKKKHLLEKHQQEVELRKMLTILNSRPEESSDINEGTRNIDPSLNFSEKANIQKVLQDGL 842

Query: 827  QXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANV 886
                          GMT+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK+ L+PP  +
Sbjct: 843  SRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIQI 902

Query: 887  QKKSKPISELN--------KEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDK 938
            +K     ++          +E  + KLN+LR  L  IQMESN++SKFNV+ERVNELFN+K
Sbjct: 903  KKPKLKKNKHKDKNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNELFNEK 962

Query: 939  KRTALQRLKELETKYKGFGIDFKVEDFTHE----STDSSNEG---YSSLDPKVYQDKLDE 991
            K  AL+RLKELETKYKGFGIDF VE         S     EG   YSSLDPK YQ KLDE
Sbjct: 963  KSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQKKLDE 1022

Query: 992  ITKISEEL--LQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVS- 1048
            I +I++EL  LQ + + ET +                        +   +I   +S +S 
Sbjct: 1023 INRITDELLDLQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENSELSA 1082

Query: 1049 DLASGSFLDTLTQKYGTGQAEPIQ---------SPVGHYSNRNEKSFVDRMKRNS-RVPS 1098
                GSFLD L+QKYGTGQ              S +GH  ++ EK+F++R+KR++     
Sbjct: 1083 GSGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRSTVNSAP 1142

Query: 1099 YVEELSKKMRGNKDHEFEEDDHKN 1122
            Y+EEL++K+  NK    E+++H N
Sbjct: 1143 YLEELTQKV--NKVEPCEQNEHVN 1164

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/607 (68%), Positives = 489/607 (80%), Gaps = 3/607 (0%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP KKLKQLHWEK++STDNSIWGS KAEKFADDLYEKGVL++LEKAFAAREIKSL
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            AT++KEDLQKI+FLS DISQQFGINLHMYS+L+V   V+KVL C+RDF+ TPSV+EFLSK
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI+EVS NLARNYAPYSTDWEG++ ++DAK PEKDPN+LQRADQ+YLQLM+NL+SYW S
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+ ++TSYEREYNELLAKL +VDKAVG+LQGSDNL+N+FNVILAVGNFMND++KQA+
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYP FN+FL ELEPVL+VVKVSIEQLVN
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC DF Q I NVERS+EIGNLSDSSKFHPLDKVL+K LP L EAR+KG+LL DE+KLTIM
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +MQTYGED GDKFAKISFF+KFADFI EYKKAQAQN+  EEEE  YE+HKK+VEEQ
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q+KAQE   +   ++S +              VMDKLLEQLKNAG  KTDP+SARKRAL+
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPAKTDPSSARKRALV 1820

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDA-KEQIELEIHMASPTPKTKEDGKLGTGEN 1793
            RKK           L ++     S++YSP+A        +H  SPTP     G + T E+
Sbjct: 1821 RKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATR-GLMNTPED 1879

Query: 1794 SNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIP 1853
                S    + + EEI DRA+ LL ELRGS+  + +N+ LDEH E+LRAR++R  S++  
Sbjct: 1880 LPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRARKERA-SSETN 1938

Query: 1854 SSNRLKF 1860
            + N+L F
Sbjct: 1939 TGNKLSF 1945

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1098 (55%), Positives = 763/1098 (69%), Gaps = 63/1098 (5%)

Query: 73   QSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAP 132
            ++RPLNKK+TLN+QNLSQY+N   +    + S H R+ S QS  KYSYS+R+S Q S   
Sbjct: 81   EARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQS--KYSYSKRTSSQASN-- 136

Query: 133  SSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIM 192
                   LTR +T  S S+ S+LS GS+TNLS+F TPDGKI+L MPSDPYEVE LFEDIM
Sbjct: 137  ------KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIM 190

Query: 193  YKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSM------ 246
            YKRNI QSL  +KQ ELMSYS EKKWLIVKQDLQNE K+I+A+    S    +       
Sbjct: 191  YKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQH 250

Query: 247  PDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPIS----KPIAA--- 299
            P L ++                            ST   S   + P      K IA    
Sbjct: 251  PILTANSTLSSPKSALMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGLK 310

Query: 300  ---TSTELYHIAERNTSSST-IQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQL 355
               +   +Y       +S++ +  D+ NRPPIHYV++I+ DKL+ DEMKDLWVTLRTEQL
Sbjct: 311  KQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 370

Query: 356  DWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEF 415
            DWVDAF+++QGHIAMAN+LM SIYKT P++ +++ LL+KEN+FFKCFRVL++LSQGL+EF
Sbjct: 371  DWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEF 430

Query: 416  TIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHM 475
            + H LMTDT+A+GLFS +L TRKMATEIFV +LEKKNK RFE+VL++LDK F IGQN HM
Sbjct: 431  STHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHM 490

Query: 476  NESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAIL 535
             +++KK+PQYF+HLT  S+LK+IQAWLFAVEQTLDGRGKMGSLVGAS+++KN GGENAIL
Sbjct: 491  IQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAIL 550

Query: 536  EYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENN 595
            EYCQWTMVFINHLCS S+N+NQR LLR KLENCGILRIMNKIKLLDY+KVIDQIELY+NN
Sbjct: 551  EYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNN 610

Query: 596  KLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDE 655
            KLDDFN  LE++ K  NVDL+DP+SL+KNL + CKGT+NEK LVSLVQH+FL +SKL++E
Sbjct: 611  KLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEE 670

Query: 656  KQDPNKVTKQLKLMDSLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTL 714
             Q+P+K++KQLKLMDSLVTNVSV ST +E SN+NMAIQRLYD+MQTDEVARRAILESRTL
Sbjct: 671  NQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTL 730

Query: 715  TKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXX 774
            TKKLEE++AERD L EKL KAEHGLVGQLE E+  RDRILAKNQRVM             
Sbjct: 731  TKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKK 790

Query: 775  XXXXXXXXXXXXRKMLTILNSRPAKTKEQKKKI----GSIEASEKEDLQRALQSGLQXXX 830
                        RKMLTILNSRP ++ +  K       S+ +SEK ++Q+ LQ GL    
Sbjct: 791  HLLEKHQQEVELRKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKVLQDGLSRAK 850

Query: 831  XXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKS 890
                      GMT+QPN+RLK+LRMQME+IENEAR+LEMTNFAE+EK+ L+PP  ++K  
Sbjct: 851  KDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIKKPK 910

Query: 891  KPI--------SELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTA 942
                       S   +   + KLN+LR  L  IQMESND+SKFNV+ERVNELFN+KK  A
Sbjct: 911  IKHKKHKIKKSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKKSLA 970

Query: 943  LQRLKELETKYKGFGIDFKVEDFTHE----STDSSNE-GYSSLDPKVYQDKLDEITKISE 997
            L+RLKELETKYKGFGIDF VE+F       S D  N+  Y SLDPK YQ KLDEI +I++
Sbjct: 971  LKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQSKLDEINRITD 1030

Query: 998  ELLQQKNELE--TTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVS-DLASGS 1054
            ELL  + +++  T +                        + +++  G  S +S     GS
Sbjct: 1031 ELLDLQTQVKQETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYSELSAGSGPGS 1090

Query: 1055 FLDTLTQKYGTGQAEPIQSPV------GHYSNRNEKSFVDRMKRN--SRVPSYVEELSKK 1106
            FLD L+QKYGTGQ     + +      GH  +  EKSF++R++++  S  P Y+EEL++K
Sbjct: 1091 FLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSAP-YLEELTQK 1149

Query: 1107 M------RGNKDHEFEED 1118
            +      + NKD +  +D
Sbjct: 1150 VNKVEPFKQNKDEDLVKD 1167

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/607 (68%), Positives = 490/607 (80%), Gaps = 5/607 (0%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP KKLKQLHWEK++STDNSIWGS KAEKFADDLYEKGVL++LEKAFAAREIKSL
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            AT++KEDLQK++FLS DISQQFGINLHMYS+L+V   V+K+LKC+RDF+ TPSV+EFLSK
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI EVS NLARNYAPYSTDWEGI+ +EDAK PEKDPN+LQRADQIYLQLMVNL+ YW S
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+ ++TSYE+EYNELLAKL +VD+AVG+LQ SDNL+N+FNVILAVGNFMND++KQA+
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD +NSMTFLNYVEKI+R NYP FN+FL ELEPVL+VVKVSIEQLVN
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC DF Q I NVERS+EIGNLSDSSKFHPLDKVL+K LP L EAR+KG+LL DE+KLTIM
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +MQTYGED GDKFAKISFF+KFADF+ EYK+AQ+QN+  EEEE  YE+HKKMVEEQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q++AQ D  K  E+S+               AVMDKLLEQLKNAG  K+DP+SARKRAL+
Sbjct: 1765 QKRAQ-DKEKHREHSA-LPEGNEEEETEDRRAVMDKLLEQLKNAGPAKSDPSSARKRALV 1822

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDA-KEQIELEIHMASPTPKTKEDGKLGTGEN 1793
            RKK           L ++     S++YSP+A     +  IH  SPTP     G + T E+
Sbjct: 1823 RKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATR-GFMNTPED 1881

Query: 1794 SNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIP 1853
                S    + + EEI DRA+ LL ELRGSDA + +N+ LDEH E+LRAR++R +  +  
Sbjct: 1882 LPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRARKERANG-ETN 1940

Query: 1854 SSNRLKF 1860
            + N+L F
Sbjct: 1941 TGNKLSF 1947

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1113 (52%), Positives = 761/1113 (68%), Gaps = 52/1113 (4%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80
            +FQNLRRLT    ++ NKSP  +S       +R         + ++R    +  +PLNKK
Sbjct: 25   IFQNLRRLTNPSSNHTNKSPSGSSPRTSYSPERD--------STTTRESHTNSLKPLNKK 76

Query: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNIN- 139
            ++LN+QNLSQY+N+            H    T+S    S S+ S  + S + +    +N 
Sbjct: 77   TSLNTQNLSQYIND-----------KHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLNQ 125

Query: 140  LTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQ 199
            + R +TN S  SAS+LS GS TNLS+F+ PDGKINL MP DP EVE LFEDIM KRNILQ
Sbjct: 126  IARQHTNQS--SASILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQ 183

Query: 200  SLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIK--------ASNKGDSRTGMSMPDLGS 251
            SLP +KQNELMSY +EKKWLIVKQDLQNE K+++         +N  ++R+ MS  +  +
Sbjct: 184  SLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSMSPENSST 243

Query: 252  DXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTELYHIAERN 311
                                         +  + S +   PIS PI   + ++Y ++ RN
Sbjct: 244  INLNSPATMQMSPHHHIGSNSNSSINSHHTPITISKRPTGPISNPIP--NADMYKLSMRN 301

Query: 312  TSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMA 371
            TSSS++ SDK NRPPIHYVK+I+ D ++ +EMKDLWVTLRTEQ+DWVDAF+E+QGHIAMA
Sbjct: 302  TSSSSM-SDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMA 360

Query: 372  NILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFS 431
            NILMKS+YKT+     +  LL+KENAFFKCFRVL++LSQGL EFT H +M+ T+A+GLFS
Sbjct: 361  NILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFS 420

Query: 432  GRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTS 491
              L+TR+MATEIFV +LEKKN +RF+ +L++LD+ F IG N+HM ++ K  P YFTHLT 
Sbjct: 421  ITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTL 480

Query: 492  NSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSS 551
            +S LKV QAWLFAVE TLDGRGKMGSLVGAS+D+KN+GGENAILEYCQW+M+FINHLCS 
Sbjct: 481  DSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSC 540

Query: 552  SENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNI 611
            S NINQR LLR KLENCGILRIMNK+K LDY+KVI+QI+LYENNKLDD N LLESN KN 
Sbjct: 541  SSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNA 600

Query: 612  NVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDS 671
            N++LQDP S+++NL DACKGTENEK L+SL+QH+FL +S+ ++EK+DP K+++QLKL+DS
Sbjct: 601  NINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDS 660

Query: 672  LVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEK 731
            LVTNVSV+ST++ +++NMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE++AERD+L +K
Sbjct: 661  LVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQK 720

Query: 732  LSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLT 791
            L  AEHGLVGQL+ E+ +RDRIL+KNQRVM                         RKMLT
Sbjct: 721  LKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLT 780

Query: 792  ILNSRP-------AKTKEQKKKIGSIEASEKEDLQRALQSGLQXXXXXXXXXXXXXGMTI 844
            ILN+RP          K + K   +++ S+K+ +Q+ALQ GL              GMTI
Sbjct: 781  ILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTI 840

Query: 845  QPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQK 904
            QPN+RLK+LRMQME IENEAR+LEMTNF EYEK+ L+ P+ ++K  K  ++   +  I K
Sbjct: 841  QPNKRLKLLRMQMEDIENEARELEMTNFTEYEKRKLEAPSKIKKPKKVATKKEIDPSINK 900

Query: 905  LNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVED 964
            LN+LR  L  IQMESND+SKFNVDERVNELFN K+ TAL+RL++LETKYK FGIDF +++
Sbjct: 901  LNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDE 960

Query: 965  FTHESTDSSNEG------YSSLDPKVYQDKLDEITKISEELLQQKNELETTQTXXXXXXX 1018
                ++   N        YSSLDPK YQ KLDE+ ++++ELL+ KN++  +         
Sbjct: 961  LVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRP 1020

Query: 1019 XXXXXXXXXXXXXXALTNNKDI--NGTSSNVSDLAS--GSFLDTLTQKYGTGQAEPIQSP 1074
                          +      I    T SN S  ++  GSFL+ LTQKY TGQ     SP
Sbjct: 1021 SASSSSESASSSSDSDDGESLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKS--ASP 1078

Query: 1075 VGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107
                +   +  F++R+K+ +  P +++EL+ K+
Sbjct: 1079 RDQSTRMKDNIFINRIKQTNVAPPFLDELTDKV 1111

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/631 (66%), Positives = 499/631 (79%), Gaps = 8/631 (1%)

Query: 1235 TKDSKKKVVXXXXXXXXXXXFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLY 1294
            T   +KKV+           FENYPRPQKKLKQLHWEK+++TDNSIW + KAEKFADDLY
Sbjct: 1268 TDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLY 1327

Query: 1295 EKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEK 1354
            EKGVL++LEKAFAAREIKSLA++KKEDL KISFLS DISQQFGINLHMY+NL V+  V+K
Sbjct: 1328 EKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKK 1387

Query: 1355 VLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNEL 1414
            +LKC+RDF++TPSVIEFLSK EIVEVS NLARNYAPYSTDWEG+K +EDAKAPEKDPNEL
Sbjct: 1388 ILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNEL 1447

Query: 1415 QRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKN 1474
            QRADQ+YLQL++NLQSYW SRMRA+ +IT++++EYNELL KL +VDKAV SLQ S+NLKN
Sbjct: 1448 QRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKN 1507

Query: 1475 IFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNF 1534
            +FNVILAVGN+MND++KQA+GFKL+TLQRLTFIKD+ NSMTFLNYVEKIVRSNYP FN+F
Sbjct: 1508 VFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDF 1567

Query: 1535 LIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPN 1594
            L ELEPVL+VVK+SIEQLV+DC +F Q I NVERS+E GNLSDSSKFHP D+VL KVLP 
Sbjct: 1568 LTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPI 1627

Query: 1595 LSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQN 1654
            L +ARKKGELL DE+KLTIMEF ++MQ YGED  DKFAK SFF+KFADFI EYKKAQ QN
Sbjct: 1628 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQN 1687

Query: 1655 IKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQ 1714
            IK EEEE  YERHKKMVE+QQ+K QE  +    N S+ G            A+MDKLL+Q
Sbjct: 1688 IKAEEEEQVYERHKKMVEDQQKKLQEQEN--GSNGSENGEEGSGDDSGDRRAMMDKLLDQ 1745

Query: 1715 LKNAGQVKTDPTSARKRALLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEIH 1774
            LKNAG  KTDP+SARKRAL+RKK+          L +++   DS+IYSP+ K      + 
Sbjct: 1746 LKNAGPSKTDPSSARKRALVRKKLMTESTAL---LKDIETEDDSIIYSPEGKNPFVNPVD 1802

Query: 1775 MASPTPKTKEDGKLGTGENSNGESPLKKINED--EEIGDRAKTLLMELRGSDALMDRNTA 1832
            + +P  +++ D      + S   S    +  D  +E+ DRAK LLMELRGS+    RN+ 
Sbjct: 1803 LDTPHDESEMDVSSSPIQRSLSPSRNSTLLSDDQDEVTDRAKALLMELRGSNTPSKRNSL 1862

Query: 1833 LDEHKERLRARRKRTDSNKIPSSNRLKFVDE 1863
            LDEHKE+LRARR++T+S+ + S  RL+FV E
Sbjct: 1863 LDEHKEKLRARRRKTNSD-LHSGTRLQFVGE 1892

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score = 1068 bits (2763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1123 (52%), Positives = 762/1123 (67%), Gaps = 65/1123 (5%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNIS---QRSTKNINVSQAVSSRHGS---IDQS 74
            LFQNL+RLT+ + +N +K  +  S++  +IS   Q+   N+  S + S    +      +
Sbjct: 23   LFQNLKRLTSNNSNNTSKYTESYSINKSSISSPLQKHDTNLPPSSSSSPSSNASAITTTN 82

Query: 75   RPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSS 134
            +PLNKKSTLN+QNLSQY++             H   S+ +    S    S    +   +S
Sbjct: 83   KPLNKKSTLNTQNLSQYMD-------------HARSSSTNSASASKYSSSRRSSTQVSTS 129

Query: 135  MGNINLTRHNTNTSFSSASVLS-HGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMY 193
                 L+R +T  S SSAS+ S + S  N S+F+TPDGK NL MP DP E+E+LFE+IMY
Sbjct: 130  ESLRRLSRQHTGQS-SSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMY 188

Query: 194  KRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGM-SMPDLGSD 252
            KRNILQ+L  EKQ ELM+Y + KKWLIVKQD+QNEFKRI+A+  G   + + ++  L   
Sbjct: 189  KRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQLVYS 248

Query: 253  XXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIA--ATSTELYHIAER 310
                                      A + Y        P++ P     TS ELY + E 
Sbjct: 249  PTTTTTNNNNNNNNSNYNNTSPMASVASNEY-------YPMTSPQTKKPTSHELYQLTES 301

Query: 311  NTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAM 370
            N S+ST+ SDK NRPP  YV+KI+ DKLS DEM+DLWVTLRTEQLDWVD+FLENQGHIAM
Sbjct: 302  NASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAM 361

Query: 371  ANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLF 430
            ANILMK IYKTTPKD +S  LL+KEN+FFKCF+VL++LSQG++EF+ H LMTDTIA+GLF
Sbjct: 362  ANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLF 421

Query: 431  SGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLT 490
            S RL TRKMA EIFV +LEK+NK RFE++L+SLD+NF IG N HM ++ KKLPQYF HLT
Sbjct: 422  STRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLT 481

Query: 491  SNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCS 550
             +S+LKV+QAWLF++E T+DGRGKMGSLVGAS D KN+GGENAILEYC WTMVF+N LC+
Sbjct: 482  PDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCN 541

Query: 551  SSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKN 610
            +S  I QR LLR KLEN G LRIMNKIKLL+YEKVID+IE YENNKLDDFN +LES  KN
Sbjct: 542  ASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKN 601

Query: 611  INVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMD 670
             NV+LQDPVSL+ NL  +CKGTENEK L+SL+QH+FL +S+L++E  DP K++KQLKLMD
Sbjct: 602  SNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMD 661

Query: 671  SLVTNVSVTST-EEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLV 729
            SLVTNVS +ST +E S +NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE++AE+D+L 
Sbjct: 662  SLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLH 721

Query: 730  EKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKM 789
            EKLSKAE+GLVGQLE ++ ERD+ILAKNQRV                          RKM
Sbjct: 722  EKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKM 781

Query: 790  LTILNSRP-----AKTKEQ-KKKIGSIEASEKEDLQRALQSGLQXXXXXXXXXXXXXGMT 843
            LTILN+R      AKT ++ K  I  +   + E++Q+ LQ GL              GMT
Sbjct: 782  LTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMT 841

Query: 844  IQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANV-----QKKSKPISELNK 898
            +QPN+RLK+LRMQME IENEAR+LEMTNF E+E+K L+PP  V     + K   I ++N+
Sbjct: 842  VQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKINQ 901

Query: 899  EQ------RIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETK 952
            ++      RI KLN+LR+ L  IQ ESN++SKFN++ERVNELFN+KK  ALQRLKELETK
Sbjct: 902  QESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELETK 961

Query: 953  YKGFGIDFKVEDFT-HESTDSSNEG-----YSSLDPKVYQDKLDEITKISEELLQQKNEL 1006
            YK FGI+F+++DF  ++  D + EG     Y SLDPK+Y+ KLD+I +++E+LL     L
Sbjct: 962  YKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLN----L 1017

Query: 1007 ETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVSDLASGSFLDTLTQKYGTG 1066
            + TQ                       +     +  +SS  +   + SFL+TL++KYGTG
Sbjct: 1018 QKTQELREESSSSYSSSESDEENDDDEIF----VASSSSKPAGSGTRSFLETLSEKYGTG 1073

Query: 1067 Q--AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107
            Q       +P      ++EK F+DRM+R+S    +++EL++K+
Sbjct: 1074 QKNVAMTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEKV 1116

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/636 (64%), Positives = 489/636 (76%), Gaps = 16/636 (2%)

Query: 1231 PPMMTKDSKKKVVXXXXXXXXXXXFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFA 1290
            PP +     K V            FE YPR QKK+KQLHWEK+E+TDNSIW + KAE+FA
Sbjct: 1276 PPALPLMGGKSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFA 1335

Query: 1291 DDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQ 1350
            DDL+EKGV S LEKAFAARE+KSLA+++K+DL KI+FLS DISQQFGINLHMYS+L+V  
Sbjct: 1336 DDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVED 1395

Query: 1351 FVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKD 1410
             V K+LKC+RDF++TPSVIEFLSK EI EVS NLARNY+PY+TDWEG+K IEDAK PEKD
Sbjct: 1396 LVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKD 1455

Query: 1411 PNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSD 1470
            PN+LQRADQIYLQLMVNLQ YWASRMRA+++IT+YE+EYNELL KL +VDKAVGSLQ S+
Sbjct: 1456 PNDLQRADQIYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESE 1515

Query: 1471 NLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPE 1530
            NL+N+FNVILAVGN+MND++KQA+GFKLSTLQRLTFIKD+ NSMTFLNYVEKI+R NYP 
Sbjct: 1516 NLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPS 1575

Query: 1531 FNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLK 1590
            FN+FL ELEPVLEVVK+SIEQL NDC +F Q + NVERSIEIGNLSDSSKFHPLD+VL K
Sbjct: 1576 FNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAK 1635

Query: 1591 VLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKA 1650
            VLP L + RKKG+LL DE+ LT+MEF+ +MQ YGED  DKFA+ SFF+KFADFI EY+KA
Sbjct: 1636 VLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKA 1695

Query: 1651 QAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDK 1710
            Q QNIKVEEEE AYERHK+MVEEQQRKA+   +K   N  +  N             MDK
Sbjct: 1696 QEQNIKVEEEEEAYERHKRMVEEQQRKAERKEAKNQNNIDE--NEDDDQERTDRRGTMDK 1753

Query: 1711 LLEQLKNAGQVKTDPTSARKRALLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIE 1770
            LLEQLKN G  + DP+SARKRAL RKK+          + +++   DS+IYSPD K    
Sbjct: 1754 LLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNK---- 1809

Query: 1771 LEIHMASPTPKTKEDGKLGTGENSNGESPLKKINED---EEIGDRAKTLLMELRGSDALM 1827
                    TP    +G     +NSN  SP K   +D   EEI +RAKTLLM LRG+ +  
Sbjct: 1810 ----AIGSTP-FGANGASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPS 1864

Query: 1828 DRNTALDEHKERLRARRKRTDSNKIPS-SNRLKFVD 1862
             RN+ LDEHKE+LRARR+RT+ N +PS SN+LKF D
Sbjct: 1865 KRNSMLDEHKEKLRARRRRTN-NDLPSGSNKLKFYD 1899

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/1138 (50%), Positives = 745/1138 (65%), Gaps = 67/1138 (5%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRS-TKNINVSQAVSSRHGSIDQSRPLNK 79
            LFQNL+R  T    + N +  RTS    N S+ S  K  ++ Q  +S   S ++ +PL K
Sbjct: 28   LFQNLKRFATNSTGSSNNTSPRTS----NSSEPSQVKRESIPQGSTSSLHSSNEIKPLIK 83

Query: 80   KSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNIN 139
             +TLN+QNLSQY+N+     P+     H    +                   PS  G   
Sbjct: 84   NTTLNTQNLSQYINSKNI--PD-----HSRSQSIQSSSKYSYSSRRASSQTNPSVTG-YK 135

Query: 140  LTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQ 199
            L R  TN S S+ SVLS GS +NLS+FMT DGK+NL MP+DP E+E L+++IM KRNILQ
Sbjct: 136  LDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQ 194

Query: 200  SLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPD----------- 248
            SLP  KQ+ELMSY I KKWLIVKQDLQNE+K+ K+  KG   +    PD           
Sbjct: 195  SLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS--KGAKASHSIGPDNNNNNNNNYNN 252

Query: 249  ---LGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAA------ 299
               LGS                             +T +   + N   SK  A+      
Sbjct: 253  HLILGSPSKSNNMISPKSNLNNFESPSSSLSASTQTTTNNYKQYNNKPSKRSASNISQPK 312

Query: 300  TSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVD 359
            ++TE+Y  +  N+S++T+ +DK NR PI YVKKI+ D L+ +EMKDLWVTLRTEQLDWVD
Sbjct: 313  STTEVYSNSHSNSSNTTL-TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVD 371

Query: 360  AFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHS 419
            AF+E+QGHIAMAN+LMKSIYKTTP +K++  LL+KEN+FFKCFRVL++LSQGL EFT H 
Sbjct: 372  AFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHE 431

Query: 420  LMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESY 479
            LM  TIA+GLFS  L+TRKMATEIFV +L KKN +RF+ +L+ LD+ F IGQN HM  + 
Sbjct: 432  LMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNL 491

Query: 480  KKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQ 539
            KK  +YF  LT +SNLKV +AWLFAVE +LDGRGKMGS VGAS+DYKN+GGENA LEYCQ
Sbjct: 492  KKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQ 551

Query: 540  WTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDD 599
            W+M+FINHLC  S+NINQR LLR KLE CGI+RIMN+IK L YEKVI+QI++YEN+KLDD
Sbjct: 552  WSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDD 611

Query: 600  FNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDP 659
             N LLE + KN N++L DP SL+KNL DACKGTENEK L+SLVQH+FL +S+L+++KQD 
Sbjct: 612  INKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDA 671

Query: 660  NKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLE 719
             +++KQLKLMDSLVTNVSV ST++ S +NMAIQRLYD+MQTDEVARR+ILESRTLTKKLE
Sbjct: 672  TQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLE 731

Query: 720  EMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXX 779
            E +AE D+L +KL  AEHGLVGQL+ E+++RDR+ AKNQR+                   
Sbjct: 732  ESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEK 791

Query: 780  XXXXXXXRKMLTILNSRPAK-------TKEQKKKIGSIEASEKEDLQRALQSGLQXXXXX 832
                   RKMLTILN+R  K       +K+ K+  GS E+S+K+++Q+ LQ GL      
Sbjct: 792  HEQEVELRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKD 851

Query: 833  XXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKP 892
                    GMT+QPN+RLK LRMQME IENEAR+LEMTNFAE+EKK L+P   ++K  + 
Sbjct: 852  FTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLEPAPKIKKLKQK 911

Query: 893  ISELNKEQRIQK----LNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKE 948
                N+++        LNELR  L  IQ ESND+SKFNV+ERVNELFN+K+ TALQRLKE
Sbjct: 912  KQNKNEKKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKE 971

Query: 949  LETKYKGFGIDFKVEDFTHESTDSSNEG-----YSSLDPKVYQDKLDEITKISEELLQQK 1003
            LETKYK FGI+F ++D + ++T   N G     YSSLDP  YQ KLDE+ +I+E+LL  +
Sbjct: 972  LETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQ 1031

Query: 1004 ---NE--LETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGT---------SSNVSD 1049
               NE  L+ +                       + ++ ++I+           S+  + 
Sbjct: 1032 AKLNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQSEISAQSTS 1091

Query: 1050 LASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107
             A+GSFL+ L+QKY  GQ  P           ++  F++R+++N+  P ++EELS K+
Sbjct: 1092 SAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKV 1149

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/639 (65%), Positives = 505/639 (79%), Gaps = 17/639 (2%)

Query: 1233 MMTKDSKKKVVXXXXXXXXXXXFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADD 1292
            M+  +  KKV+           FENYPRP KKLKQLHWEKVE+TDNSIW + KAE+FADD
Sbjct: 1324 MLPTNGPKKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADD 1383

Query: 1293 LYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFV 1352
            LYEKGVLSELE AFAAREIKSLA+++K+DLQKI+FLSHD+SQQFGINLHMY++L V   +
Sbjct: 1384 LYEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLI 1443

Query: 1353 EKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPN 1412
             K+LKC+RDF+ TPSVIEFLS+ EIV+VS NLARNYAPY  DWEGIK +EDAK PEK+PN
Sbjct: 1444 TKILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPN 1503

Query: 1413 ELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNL 1472
            ELQRADQIYLQLMVNLQSYW SRMRA+++IT++E+EYNELL KL +VD+AV SLQ S+NL
Sbjct: 1504 ELQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENL 1563

Query: 1473 KNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFN 1532
            KN+F VILAVGN+MND++KQA+GFKL+TLQRLTFIKD+ N+MTFLNYVEKIVR+NYP FN
Sbjct: 1564 KNVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFN 1623

Query: 1533 NFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVL 1592
             FL+ELEPVL+VVK+SIEQLV+DC +F Q I NVERSIEIGNLSDSSKFHP D+VL KVL
Sbjct: 1624 KFLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVL 1683

Query: 1593 PNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQA 1652
            P+L +ARKKGELL DE+KLTIMEF ++MQ YGED GDKFAK SFF+KFADFI EYKKAQ 
Sbjct: 1684 PSLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQT 1743

Query: 1653 QNIKVEEEEAAYERHKKMVEEQQRKAQE-DASKLNENSSQTGNXXXXXXXXXXXAVMDKL 1711
            QN+++EEEE  YERHKKMVEEQQRKAQE + S++  NS   G            A+MD L
Sbjct: 1744 QNLRLEEEEKVYERHKKMVEEQQRKAQEAEISRV--NSGTDGTKDDEDGPGDGRAIMDTL 1801

Query: 1712 LEQLKNAGQV-KTDPTSARKRALLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIE 1770
            LEQLKN     KTDP+SARKRAL+RKK+          L ++    DS+IYSPDAK+ + 
Sbjct: 1802 LEQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNI--LKDIDTEDDSIIYSPDAKKPMA 1859

Query: 1771 LEIHMASPTPKTKEDGKLGTGENSNGESPLK---KIN---EDEEIGDRAKTLLMELRGSD 1824
              + MA+ T +++ D    T  NS   SP+K    +N   E+EEIG+RA+ LL++L GS 
Sbjct: 1860 TTVDMANTTLESELDVSSPTRHNS---SPIKNEISMNVDEEEEEIGNRAQALLIQLTGSH 1916

Query: 1825 ALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDE 1863
            +   R++ L+EHKERLRARR+RT +  +  S +L+FV E
Sbjct: 1917 SPTKRHSLLNEHKERLRARRRRTTNEFV--SGKLQFVGE 1953

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1069 (52%), Positives = 726/1069 (67%), Gaps = 50/1069 (4%)

Query: 63   AVSSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSR 122
            +V SR  + +  RPLNKKST+N+QNLS Y+N GK+ +    SNH R+ S QS  KY+YSR
Sbjct: 58   SVPSRVSNANDLRPLNKKSTMNTQNLSHYMN-GKSSAESLSSNHSRSPSVQSSTKYTYSR 116

Query: 123  RSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPY 182
            RSS  +S  P    N  LTR  TN S SS+SVLS  S +NL+ FMTPDGKI L MPS  +
Sbjct: 117  RSSSHLS-TPGV--NSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPSS-H 172

Query: 183  EVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRT 242
            EVE+LFED+MYKRNILQ+L  +KQ ELM Y ++KKWLIVKQDLQN+FK++ A  KG    
Sbjct: 173  EVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLA--KG---- 226

Query: 243  GMSMPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATST 302
               +P   +                                  +   N   S P +   +
Sbjct: 227  ---VPAAHAAISSSNSDSLPSSLKVSSPRSSMTYESIQQAIKFNKTNNGSSSGPASNNKS 283

Query: 303  ELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFL 362
            +L  ++++N+S+ST+ ++K NRPPIHYVK+I+ DKL+ +EM DLWVTLRTEQLDWVD FL
Sbjct: 284  KLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFL 343

Query: 363  ENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMT 422
            E+QGHIAMAN+L  SIYKT P+  +S  LL+KE+AFF+CFRVL+VL+QGL+E + H++M 
Sbjct: 344  EHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMA 403

Query: 423  DTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKL 482
            +T+A GLFS RLATRKMATEIFV +LEKKNK RFE+VL++LDK F IG+N HM    K  
Sbjct: 404  ETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNS 463

Query: 483  PQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTM 542
            PQ+F+H T +S  K++Q+WLFAVEQ+L+GRGKMGSLVGASED+K +GGENAILEY QWTM
Sbjct: 464  PQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTM 523

Query: 543  VFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNA 602
            VFINH C+ ++ INQR LLR +LEN G LRIMN+ KLLDY+KV++ +E YEN KLDD N+
Sbjct: 524  VFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNS 583

Query: 603  LLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKV 662
            +LE+     ++D+ D  SL+K L D CKGTE+EK L SLV+H+FL TS+L+++ QDP K+
Sbjct: 584  VLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKL 643

Query: 663  TKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEME 722
            +KQL+LMDSLVTNVSV++ +E S++NMAIQRLYDSMQTDEVARRAILESRTLTKKLEE +
Sbjct: 644  SKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQ 703

Query: 723  AERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXX 782
            AERD L +KLSK  +GLVGQLE EV++RD IL KNQRV                      
Sbjct: 704  AERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEH 763

Query: 783  XXXXRKMLTILNSRPAKTKEQKKKI------GSIEASEKEDLQRALQSGLQXXXXXXXXX 836
                RKMLTILNSRP     +K  +      G ++  +K  +Q+ALQ GL          
Sbjct: 764  EVELRKMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVD 823

Query: 837  XXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKS--KPIS 894
                G+T+QPN+RLK+LR+QME IE EAR+LEMTNFA++ K  L+ P  V+  +  +  +
Sbjct: 824  SKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVESSNYVRKEN 883

Query: 895  ELN-KEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKY 953
            EL  KE +  KL+ELR  L  IQ ESN VSKFNV+ERVNELF  KK +AL RL +LE  Y
Sbjct: 884  ELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMY 943

Query: 954  KGFGID----FKVEDFTHESTDSSN--EGYSSLDPKVYQDKLDEITKISEELLQQKNELE 1007
            K +GID    F ++D   ES +S    EG S+LDP+ YQ KLDEI +IS+EL++ K+EL+
Sbjct: 944  KEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEMKSELK 1003

Query: 1008 TTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVS-DLAS---GSFLDTLTQKY 1063
              +                        T++ +I  T S V+ DL S    SFL++L+QKY
Sbjct: 1004 NDKALRRHESPSKQD------------TDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKY 1051

Query: 1064 GTGQ--AEPIQSPVGHYSNR---NEKSFVDRMKRNSRVPSYVEELSKKM 1107
            GTG+     + + + + S R   + +SF++RMK+ S VP+Y+EEL  K+
Sbjct: 1052 GTGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKV 1100

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/604 (65%), Positives = 471/604 (77%), Gaps = 20/604 (3%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            F +YPR +KKLKQLHWEK+++TDNSIW S KAEKFA DLYEKGVL +LEKAFAAREIKSL
Sbjct: 1251 FSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSL 1310

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            AT+K+EDL KI+FLS D+SQQFGINLHMYS L+V + V K+LKCERDFM+TPSV+EFLSK
Sbjct: 1311 ATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSK 1370

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI+EVSTNLARNY+PYSTDW+G+ K+EDAK+PEKDP ELQRADQ+YLQL+ NLQ YW S
Sbjct: 1371 PEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGS 1430

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+R+ITSYEREY+EL+ KL +VDKAV  +Q S NL+N+FNVILAVGN+MNDSAKQA+
Sbjct: 1431 RMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQ 1490

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKDA+NSMTFLNYVEKIVR NYP FN+FL +L+PVL+VVK+SIEQL++
Sbjct: 1491 GFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F Q I NVERSI+IGNL+DSSKFHPLDKVL+KVLP L EA K+ ELL +E+KL+IM
Sbjct: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIM 1610

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +MQ YGED  DKFAK SFF+KFADFI EYK+AQAQN+K EEEE  Y+ HKKMVEEQ
Sbjct: 1611 EFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQ 1670

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q++A+E      E S                A+MDKLLEQLKNAG VK DP SARKRA++
Sbjct: 1671 QKRAEE-----KERSENATEEDASEENEDRRAMMDKLLEQLKNAGPVKADPLSARKRAMI 1725

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGENS 1794
            RKK+          L  +Q   DS+IYSP+ +E I       +PT  + +    G   N 
Sbjct: 1726 RKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGI------TNPTGDSSQSPSKGAANNQ 1779

Query: 1795 NGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIPS 1854
              E         EEI DRAK LLM LRG ++   RN  L+ HKE+LRARR++T+++  P 
Sbjct: 1780 QDE---------EEITDRAKALLMGLRGGESPSKRNNVLNGHKEKLRARRRKTNTDMSPE 1830

Query: 1855 SNRL 1858
             + L
Sbjct: 1831 GSFL 1834

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1077 (50%), Positives = 706/1077 (65%), Gaps = 66/1077 (6%)

Query: 75   RPLNKKSTLNSQNLSQYVNNGKALS------PESGSNHHRTDSTQSGFKYSYSRRSSGQV 128
            RPLNKKSTLN+QNLSQYV+  K         P + ++H R  S+QS  KYSYSRRSS   
Sbjct: 63   RPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSS--- 119

Query: 129  SMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLF 188
                ++ G I L+R  T  S  S+SVLS GS TNL +++  DGKINL MP DP+EVE+LF
Sbjct: 120  ----TATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALF 175

Query: 189  EDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPD 248
            ED+MYKRNI Q+LPQ+KQ ELMSY + KKW +VKQDLQNE K++       S++    P 
Sbjct: 176  EDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLM------SKSSSYHPT 229

Query: 249  LGS-DXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTY---SRSG----------KKNIPI- 293
             GS                            +P T    S SG            NIP+ 
Sbjct: 230  EGSYSSASNSNGNLNSYSSSLRSSATSQDSNSPQTAIFTSNSGTMQNNTINLNNGNIPVG 289

Query: 294  --SKPIAATSTE------LYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKD 345
              S+P+ ++ST       +Y  +E N S S+I +D+ NRPPIHYVKKI+ D+L+ +EM D
Sbjct: 290  GKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMND 349

Query: 346  LWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVL 405
            LWVTLRTEQLDWVDAFLE+QGHIAMAN+LM +IYK  P  +++  L +KE++FFKCFRVL
Sbjct: 350  LWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVL 409

Query: 406  AVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDK 465
            ++LSQGL+EF  H LM+DTIA GLFS RLATRKMATE+ V ++EK+N  RFE VL+SLD+
Sbjct: 410  SMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDR 469

Query: 466  NFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDY 525
             F   +N +M    K LP  +   T N+  K+IQAWL A+++TL+GRGKMGSLVGAS+DY
Sbjct: 470  YFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDY 529

Query: 526  KNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKV 585
            ++AG ENAILEYC WTMVFINHLCS+S  +NQR LLR KLEN G LRIM K+K LDYEK+
Sbjct: 530  RSAG-ENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKL 588

Query: 586  IDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHI 645
             +QIELY+NNKLDDFN +LE+  KN  V++Q+P SL++NL ++CKG++NEK L+SL+QH+
Sbjct: 589  TEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHL 648

Query: 646  FLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVAR 705
            +L +SKL+ EK+DP K++KQLKL+DSL+TNV+ +  +E S++N+AIQRLYDSMQTDEVAR
Sbjct: 649  YLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVAR 708

Query: 706  RAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXX 765
            RAILESRTLTKKLEE  AERD L  KLS AE+GLVGQLE ++K+RD IL KNQRVM    
Sbjct: 709  RAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLE 768

Query: 766  XXXXXXXXXXXXXXXXXXXXXRKMLTILNSRPAKTKEQKKKIG-SIEASEKEDLQRALQS 824
                                 RKMLTILNSR          +  +++ ++K D+Q+AL+ 
Sbjct: 769  SELEDLKKKHLLEKHEHEVELRKMLTILNSRNGTQNPDVDDVTITLDPNKKLDIQKALEL 828

Query: 825  GLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPA 884
             L              G+T+QPN+RLK+LRMQME IENEAR+LEMTNFA++++  LK P 
Sbjct: 829  ELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPV 888

Query: 885  NVQKKSKP-------ISELNK--EQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELF 935
             V+K+ K          E +K  E + +KL +LR  L  IQ E+ND+SKFNV+ RVNE+F
Sbjct: 889  IVKKEKKLRKKKKINTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMF 948

Query: 936  NDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQDKLDEITKI 995
             DKK  ALQRLK+LE KYK F I F       +      + +S+LDP   Q K++E+ +I
Sbjct: 949  QDKKLKALQRLKQLEAKYKDFEIPFDELQDLDDRELDDEQQHSTLDPTYLQKKINELDEI 1008

Query: 996  SEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVSDLASGSF 1055
            S+EL     + +                                 N  S  +S+  +GSF
Sbjct: 1009 SDELYLMNYDSDANNGNTSDSSSSSEADGDGTDSMRSV------SNAPSKGISE--AGSF 1060

Query: 1056 LDTLTQKYGTGQ---AEP--IQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107
            L++L+QKYGTGQ   + P  I SP    +++ EKSF++R+KR +    ++EEL++K+
Sbjct: 1061 LESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKV 1117

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/671 (60%), Positives = 487/671 (72%), Gaps = 29/671 (4%)

Query: 1233 MMTKDSKKKVVXXXXXXXXXXXFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADD 1292
            MM K    K V            +  PRPQKKLKQLHW+K++STD+SIW    AE+FADD
Sbjct: 1246 MMGKKEPYKSVVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADD 1305

Query: 1293 LYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFV 1352
            LYEKGVL  LEKAFAAREIKS+ TRKKEDL KISFLSHDISQQFGINLHMY +L V + +
Sbjct: 1306 LYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELI 1365

Query: 1353 EKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPN 1412
            EKVLKC+R+ +NTPSVIEFL+K EIVEVS NLARNYAPY+TDWEG+K ++  K       
Sbjct: 1366 EKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK------- 1418

Query: 1413 ELQRADQI-YLQL------MVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGS 1465
              QR  Q+ Y +L      MVNLQSYWASRMRA+++ITSYEREYNEL+ KL +VDKAVG+
Sbjct: 1419 -FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGA 1477

Query: 1466 LQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVR 1525
            +Q S+NLKN+FNVILAVGN+MND++KQA+GFKLSTLQRLTFIKDA NSMTFLNYVEKIVR
Sbjct: 1478 VQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVR 1537

Query: 1526 SNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLD 1585
             NYP FN+F+ +LEPVL+VVK+S+EQL++DCN+F Q I NVERS+EIGNLSDSSKFHP D
Sbjct: 1538 DNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSD 1597

Query: 1586 KVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIA 1645
            KVL KVLP L EA KK  LL DE+KLTIMEFE +M+ YGED GDKFAK SFF+KFADFI 
Sbjct: 1598 KVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFIT 1657

Query: 1646 EYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXX 1705
            EYKKAQ+QN+K EEEE AYE+HK+M+EEQQ K   +  +  E   + G            
Sbjct: 1658 EYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREVEGEPG-----EEQSDRR 1712

Query: 1706 AVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDA 1765
            A+MDKLLE+LKNAG  K DP+SARKRAL+RKK+          L ++  G DS++YSP+ 
Sbjct: 1713 AMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNT 1772

Query: 1766 KEQIEL-EIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSD 1824
              Q    +IH+ASPTP  K D  L +  +   ES    I EDE I DRAK LL+ELRGS+
Sbjct: 1773 PTQEGPNDIHLASPTPSGKSDLVLASV-SPTKESTADGIAEDEFISDRAKALLLELRGSE 1831

Query: 1825 ALMDRNTALDEHKERLRAR--RKRTDSNKIPSSNRLKFVDEKXXXXXXXXXXXXXXXTTG 1882
              M RN+ L+E KE+L+AR  R+RT +  I SSN+L F DE+                T 
Sbjct: 1832 N-MKRNSQLEEQKEKLKARRSRRRTQTESI-SSNKLFFTDEESHSTSPSESKGTEYEMT- 1888

Query: 1883 IVTAQESPVQI 1893
              TA E P +I
Sbjct: 1889 --TANEEPEEI 1897

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  958 bits (2476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1091 (48%), Positives = 713/1091 (65%), Gaps = 79/1091 (7%)

Query: 75   RPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVS----M 130
            +PL+KK+T+NSQNLS Y +   A S +        D   +  +Y++SR  SGQ S     
Sbjct: 152  KPLSKKATMNSQNLSHYTSGVSATSSDG-------DGGMASPEYTHSRTQSGQTSRFSYT 204

Query: 131  APS--SMGNINLTRHNTNTSFSSASVLSHGSITNL-SRFMTP-DGKINLTMPSDPYEVES 186
            +PS  S  +  L +++T  S S  S+ S GS++ L +RF++P DGK+ L MP DP EVE 
Sbjct: 205  SPSRRSSSDAKLAKYHTAQS-SQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVEL 263

Query: 187  LFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKAS----------- 235
            L+EDIMYKRNILQ+LP +KQ ELM+Y ++KKWLIVKQDLQNE K++K             
Sbjct: 264  LYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKTSSHQQTVQSA 323

Query: 236  ---NKGDSRTGMSMPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIP 292
               N  D+ +  S+P  G                             PS    S +K   
Sbjct: 324  PFMNLQDTSSSASLPGQGFHDQQSVVSETSSRVPTTNDAASILSSATPSLRHPSRRKQQY 383

Query: 293  ISKPIAATSTELYHIAERN-TSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLR 351
                   T       AER+ +SSST+ SDK NR PIHYVKKI+ D+LS+DE+ DLWVTLR
Sbjct: 384  TLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLR 443

Query: 352  TEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQG 411
            TEQLDWVDAFL+NQGHIAMAN+LMKS+YKT+P   +S PLLDKE ++FKCF+VL++L+QG
Sbjct: 444  TEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQG 503

Query: 412  LHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQ 471
            L EFT H L+TDTIA+GLFS RL TRKMATEIFV +LE KN+ RF++V++SLD+NF IG 
Sbjct: 504  LREFTDHRLITDTIARGLFSSRLPTRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGS 563

Query: 472  NSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGE 531
            N+HM  + +K+P YF HL   S LKV+QAWLFA++QTLDGRGKMGSLVGAS+++K   GE
Sbjct: 564  NAHMVNNLQKMPDYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGE 623

Query: 532  NAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIEL 591
            N++LEYCQWT+VF+N  C SS N+NQR LLR KLEN G LRIMNK+KLLDYEK+ DQIE 
Sbjct: 624  NSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEF 683

Query: 592  YENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSK 651
            YE  KLDDFN+LLES  K+ N+D+Q+P+SL++NL DAC+GT++E  LVSLVQH+FL +++
Sbjct: 684  YEAGKLDDFNSLLESQNKHANIDMQNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTR 743

Query: 652  LLDEKQDPNKVTKQLKLMDSLVTNV--SVTST-EEGSNVNMAIQRLYDSMQTDEVARRAI 708
            L+   +DP ++ KQLKL+DSLVTNV  SV++  +E + ++M IQRL+DSMQTDEVARRAI
Sbjct: 744  LIQNNKDPTQLAKQLKLIDSLVTNVGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAI 803

Query: 709  LESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXX 768
            +ESRTLTKK+EE++AE+D L +KLSKAE GLVG+L+ +++ERD ILAKNQRV        
Sbjct: 804  IESRTLTKKMEELQAEKDRLGDKLSKAEGGLVGELQRDIRERDAILAKNQRVNKQLENEL 863

Query: 769  XXXXXXXXXXXXXXXXXXRKMLTILNSRPA------------KTKEQKKKIGSIEASEKE 816
                              RKMLTI+NS+ +            K+ + K K  S+ + ++ 
Sbjct: 864  EELKRKTLMEKHEHEVELRKMLTIINSKASPNLAQNPSASVLKSHDPKNK-ESLLSEQQS 922

Query: 817  DLQRALQSGLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYE 876
             +Q+ LQ GL              GMT+QPN+RL++LRM++E IENEAR+LEMTNFA+ E
Sbjct: 923  KIQKVLQDGLTRTKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIE 982

Query: 877  KKGL----------------KPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESN 920
            K                      A   KK +  ++ N+ Q+I+ LN+LR  L  IQ ESN
Sbjct: 983  KNATPVILTKGTKKKKSKKKLKTAQPDKKQR-ANQRNENQKIEALNKLRMALTAIQSESN 1041

Query: 921  DVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDF---THESTDSSNEGY 977
            D+SKFNV+E VNELF ++K  ALQRL++LE+K+ G   +F ++D    T ++  ++++GY
Sbjct: 1042 DISKFNVEEHVNELFTERKFKALQRLRDLESKFNGLNTNFNIDDIIASTEKALTATDDGY 1101

Query: 978  SSLDPKVYQDKLDEITKISEELLQQKNEL-ETTQTXXXXXXXXXXXXXXXXXXXXXALTN 1036
             SLDP+   +KLDEI +++ +L +  + + E  Q                        T 
Sbjct: 1102 -SLDPRRADNKLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSESSDSESVESDNEGSTV 1160

Query: 1037 NKDINGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRV 1096
              D++  +     + SGSFL +L+QKY TGQ +P  SPV      N+K+F+ R+KR+S  
Sbjct: 1161 QSDVSEPT-----VGSGSFLASLSQKYETGQKQP-NSPV----TVNQKAFMTRLKRSSGA 1210

Query: 1097 PSYVEELSKKM 1107
            P Y++ELSKK+
Sbjct: 1211 PLYLQELSKKI 1221

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/587 (65%), Positives = 460/587 (78%), Gaps = 10/587 (1%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRPQKKLKQLHWEK++ST+NSIW + KAEKFADDLYEKGVLS LEKAFAARE+KSL
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            +++K +D  KI+FL+ D+SQQFGINLHM+ NL+V + V K+LKC+R+ +N+PSVIEFLSK
Sbjct: 1433 SSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSK 1491

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
            QE+VEVS NLARNY+PYSTDWEG+K+IEDAKAPEKDPNELQRADQ+Y+ LMVNLQ YW+S
Sbjct: 1492 QEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSS 1551

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+++IT+YEREY ELL KL +VDKAVGSLQ S+NLKN+ NVILAVGN+MND++KQA+
Sbjct: 1552 RMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQ 1611

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKL+TLQRLTFIKD  NSMTFLNYVEKIVR NYP FN+FL EL+PVL+VVK+SI+QLV+
Sbjct: 1612 GFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVS 1671

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F   + NVERSIEIGNLSDSSKFHP D+VL+KVLP L EARKK +LL DE+KLT++
Sbjct: 1672 DCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTML 1731

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EF  +MQTYGED  DKFAK SFF+KFADFI EYKKAQ QN+  EEEE  YERHKK+VEEQ
Sbjct: 1732 EFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQ 1791

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXX----XXXXXAVMDKLLEQLKNAGQVKTDPTSARK 1730
            QR+ +E   +L   S    N               A+MDKLLEQLKNAG VK DP+SARK
Sbjct: 1792 QRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSSARK 1851

Query: 1731 RALLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGT 1790
            RAL R+K+          L ++    DSL+YSPD K Q    +   SPTP  K  G   T
Sbjct: 1852 RALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSPTPGDKLLGSTPT 1911

Query: 1791 GENSNGESPLKKINEDEEIGDRAKTLLMELRGS-DALMDRNTALDEH 1836
             E S   SP     +DE++ DRAK LLMELRG   + M +N  LDE 
Sbjct: 1912 KELS---SPTAG-QDDEDVTDRAKALLMELRGGQSSPMKKNAFLDEQ 1954

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1036 (48%), Positives = 673/1036 (64%), Gaps = 74/1036 (7%)

Query: 108  RTDSTQS-GFKYSYSRRSS-----GQVSMAPSSMGNI-------NLTRHNTNTSF----- 149
            RT S QS G KY+Y +R+S     G  S+  SS   I        L+R  TN S      
Sbjct: 96   RTPSQQSTGSKYTYPKRTSSSITGGNPSLPSSSATPIPAPVTPGQLSRQQTNHSHANSQS 155

Query: 150  SSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNEL 209
            S+ASVLS GS+TNL RFM PDGK+ L MP D +EVESLFEDIMYKRNI+Q+LP EKQ EL
Sbjct: 156  SAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQEL 215

Query: 210  MSYSIEKKWLIVKQDLQNEFKRI------KASNKGDSRTGMSMPDLGSDXXXXXXXXXXX 263
             +Y I+KKWLIV+QDL ++ K++       A+    + T +S+ +  S            
Sbjct: 216  RNYDIDKKWLIVRQDLSSDLKKMMAKSSSSATQASANTTDLSLTNTIS------------ 263

Query: 264  XXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKAN 323
                           + +T  R  K N   SK +   ++ LY  A  N+S++T+ ++K N
Sbjct: 264  -----------SHDYSDATSIRHMKTNAS-SKSL---NSNLYSNANANSSNTTVNTEKIN 308

Query: 324  RPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTP 383
            RPP +YVKKI+ D L+ DE+ DLWVTLRTEQLDWVDAFLE+QGHIAMAN+LMKS+YKTT 
Sbjct: 309  RPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQ 368

Query: 384  KDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEI 443
            + K++E  L++E ++FKCFRVL +L+QGL+EFT H++M +T+A  LFS RL TRKMATEI
Sbjct: 369  EVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEI 428

Query: 444  FVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLF 503
            FV +LEKKNK RF+ +L++LDK F+IG+N HM +  K  PQ F HL  +S  K++QAWL 
Sbjct: 429  FVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLT 488

Query: 504  AVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRR 563
             +E  L GRGKMGSLVGASE+ + AGGEN+ILEY QWTMVFINHLC  ++ +NQR LLR 
Sbjct: 489  GLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRT 548

Query: 564  KLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMK 623
            +LEN G LRIMN+ KLLDY+K+  QIE YEN KLDD N LLES  +N  V++QDP+ +++
Sbjct: 549  RLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQ 608

Query: 624  NLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEE 683
             + D CKGTENEKT +SL++H+FL +SK+ D++ DP+K+ KQLKLMDSLV NVSV++ +E
Sbjct: 609  TMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDE 668

Query: 684  GSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQL 743
             S+VN+AIQRLYD+MQTDEVARRAILESR LTK+LEE++AERD L +KL+    G+VG+L
Sbjct: 669  ESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRL 728

Query: 744  EMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKMLTILNSRP-----A 798
            E E+K+RD ILAKNQRV                          RKMLTILN+RP     A
Sbjct: 729  EEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPDDENLA 788

Query: 799  KTKEQKKKIGSIEASEKEDLQRALQSGLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQME 858
            K+ +  K +  ++   +  +Q+ALQ GLQ             G+T+QPN+RL++LRM+ME
Sbjct: 789  KSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKME 848

Query: 859  SIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQME 918
             IE EAR+LEMTNFAE+E+K L+ P     K        K+  ++KL+ELR +L  IQ E
Sbjct: 849  GIEQEARELEMTNFAEHEEKQLEEPVGTGTK--------KKAGVRKLSELRKQLSDIQKE 900

Query: 919  SNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDS---SNE 975
            +N+V+KFNV+ERV ELFN K+  AL+RLKELET YKGFGIDF               +++
Sbjct: 901  TNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGIDFNANALLESKGGDIHWNDD 960

Query: 976  GYSSLDPKVYQDKLDEITKISEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALT 1035
                 D +  Q+K+DE+ +I+ EL   K ++E                         + T
Sbjct: 961  EIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQQHTDSSSTESSSEDDDGATGSRT 1020

Query: 1036 NNKDINGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQ-SP---VGHYSNRNEKSFVDRMK 1091
            +        S  S   +GSFL+ L+QKYG GQ   I  SP   V   S+ +  SF +RMK
Sbjct: 1021 DTASEFSQKSFGS--GAGSFLEALSQKYGAGQNTTISNSPFPGVDRKSSNHRTSFANRMK 1078

Query: 1092 RNSRVPSYVEELSKKM 1107
            +++  P Y +EL++K+
Sbjct: 1079 KSNATP-YFDELTRKV 1093

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/625 (63%), Positives = 482/625 (77%), Gaps = 25/625 (4%)

Query: 1256 ENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLA 1315
            +NYP+P KKLKQLHWEK+++T++SIW S  AEKFA DLYEKGVL+ LEKAFAAREIK+LA
Sbjct: 1257 DNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316

Query: 1316 TRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQ 1375
            T+KKEDL+KI+FLSHD SQQFGINLHMYS+++VN  V K+LKC+RDFM TPSVIEFLSK 
Sbjct: 1317 TKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376

Query: 1376 EIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASR 1435
            EI EVS NLARN++PYSTDW+GIK +EDAK PEKDPN+LQRADQIYLQL+ NLQ+YW SR
Sbjct: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436

Query: 1436 MRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKG 1495
            MRAI++ITSY++EY EL+ KL +VDKAVG++  S+NL NIFNVILAVGNFMND+AK+A+G
Sbjct: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496

Query: 1496 FKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVND 1555
            FKLSTLQRLTFIKD +NSMTFLNYVEKI+R NYP FN+FL ELEPVL V K+SI+QLVND
Sbjct: 1497 FKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556

Query: 1556 CNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIME 1615
            CN++ Q + NVERSIEIGNLSDSSKFHPLD+VL+KVLP L EARKK +LL DE++L+IME
Sbjct: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616

Query: 1616 FEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQ 1675
            FE +MQ YGED GDKFAK SFF+KFADF+ EYKKAQ QN+KVEEEE  YERHKKMVEEQQ
Sbjct: 1617 FENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQ 1676

Query: 1676 RKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALLR 1735
            R+ Q   SK  +                  A+MDKLL+QLKNAG   +DP+SARKRAL+R
Sbjct: 1677 RREQT-PSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTTSDPSSARKRALMR 1735

Query: 1736 KKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSN 1795
            +K+          ++++    DS++YSP+A +        ASPT        +  G N N
Sbjct: 1736 RKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPT--------VHKGSNKN 1787

Query: 1796 G-------ESPLKKI-NEDE-------EIGDRAKTLLMELRGSDALMDRNTALDEHKERL 1840
                    ESP+K   N D        EI D+AK LLMEL G+ A   R   L+ HKERL
Sbjct: 1788 NKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAPTRREELLNGHKERL 1847

Query: 1841 RARRKRTDSN-KIPSSNRLKFVDEK 1864
            RARR+RT  + ++ SSN+L F+D++
Sbjct: 1848 RARRRRTQGHGELISSNKLAFLDDE 1872

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1107 (43%), Positives = 681/1107 (61%), Gaps = 84/1107 (7%)

Query: 70   SIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNH-------HR---TDSTQSGFKYS 119
            S+D  +PLNK+++LN+QNLSQY+N GK    +S S+H       H+    ++ Q G   +
Sbjct: 64   SMDDLKPLNKRTSLNNQNLSQYIN-GKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPN 122

Query: 120  YSRRSSGQVSM-------APSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGK 172
            ++R +S Q S        + +S     L+R +TN S S+ SV S GS  NLS++M  +G+
Sbjct: 123  HNRSASVQSSAKYSYSRRSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGR 182

Query: 173  INLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRI 232
            +NL MP+D +E+ESLFE++MYKRNILQ+L  +KQ ++M+Y  +KKW+IVKQDLQNE KRI
Sbjct: 183  LNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRI 242

Query: 233  KASNKGDSRTGMSMPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIP 292
            K  N   + +  ++  + S                           +     R G+K++ 
Sbjct: 243  KLKNNNINNSDTTI--IPSSMPSSNISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMS 300

Query: 293  ISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRT 352
                   T+    +       S +  SDK N  PIHYV+KI+ D LSK+E+ DLWVTLRT
Sbjct: 301  SLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRT 360

Query: 353  EQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGL 412
            EQLDWVDAFLE+QGHIA+AN L++ IYKT P   +S+ L++KE  FFKCFRVLA+L QGL
Sbjct: 361  EQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGL 420

Query: 413  HEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQN 472
            +EFT H LM DT+A GLFS R++TRKMA EI V+++ KKN +RFESV+ SLD+ F + +N
Sbjct: 421  YEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRFFRLSEN 480

Query: 473  SHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGEN 532
             +M +   +    F+  + ++  K+ QA++ ++E TL+GRGKMGS VGAS+D+K +GGEN
Sbjct: 481  LNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGEN 540

Query: 533  AILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELY 592
            AILEYC W ++FIN LC+ S+ +NQR +LR K EN G LR+M K+KL+DYEK+  Q+E Y
Sbjct: 541  AILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENY 600

Query: 593  ENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKL 652
            E++KLDDFN+LLE    +  +++QDP SL+ +L + CKGTENEK L+SL+QH+FL +SKL
Sbjct: 601  EDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKL 660

Query: 653  LDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESR 712
            +D+K++P K++KQLKLMDSL+TN++ +  +E +++N+AIQRLYDSMQTD+VARRAILE+R
Sbjct: 661  VDDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETR 720

Query: 713  TLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXX 772
            TL+KKLEE+ AE++ L EKLSKAE+GLVGQLE+E+++RD IL K+QRV            
Sbjct: 721  TLSKKLEEVTAEKEYLKEKLSKAENGLVGQLELELEQRDNILTKSQRVTKQLQAELEDLK 780

Query: 773  XXXXXXXXXXXXXXRKMLTILNSRPAKTKEQKKKIGSIEASEKEDLQRALQSGLQXXXXX 832
                          RK+LTI+N+                + +K ++Q+AL++ L      
Sbjct: 781  KKHLLEKHEHEVELRKILTIVNTNTDADASLNN-----SSDKKHNIQKALETELSRTKKD 835

Query: 833  XXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPA-------- 884
                    G+++QPN+RL++LR+QME IE EAR+LEMTNF+E++K  L+ PA        
Sbjct: 836  LNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKE 895

Query: 885  -----------------NVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNV 927
                             N +K++  I +       QKL ELR  L  IQ E+NDVSKFNV
Sbjct: 896  TKKKSKKKSKSSKSKEENNRKRANAIKK-------QKLLELRRDLAMIQAETNDVSKFNV 948

Query: 928  DERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQD 987
            D+RVNELF +KK  AL RL+ LE KYK F IDF   DF     D SN  Y SLDP     
Sbjct: 949  DKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQAQLD-SNASYESLDPNFVTK 1007

Query: 988  KLDEITKISEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNV 1047
            K+ +I +I++EL                                   +N     G    +
Sbjct: 1008 KITDIDRIADEL----------DAFSGDGTSSYSSSSLSDSEKNYYESNAVPTIGPQKGL 1057

Query: 1048 SDLASGSFLDTLTQKYGTGQ------AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVE 1101
             D    SFL++L++KYGT Q        P+ SP    ++  EKSF++R KR      ++E
Sbjct: 1058 ID--GSSFLESLSEKYGTAQNTEGTSLSPL-SPQNRIASLGEKSFMNRFKRKPSSMQFLE 1114

Query: 1102 ELSKKMRGNKDHEFEEDDHKNGNQSSD 1128
            ELS+K+ G       E   K+ N++SD
Sbjct: 1115 ELSQKVGG-------EALGKDNNETSD 1134

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/648 (61%), Positives = 480/648 (74%), Gaps = 45/648 (6%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            +  YPRPQKKLKQLHW+K++ ++ SIW S  AE+FADDLYEKGVL  LEKAFAAREIKSL
Sbjct: 1260 YSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSL 1319

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A +KKEDL KISFLS DISQQFGINLHM+ +LTV++ V K+LKC RD MNTPSVIEFLSK
Sbjct: 1320 ANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSK 1379

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EI +VS NLARNYAPY TDWEG+K +EDAKAPEK  + LQRADQIY+QLMVNLQSYW S
Sbjct: 1380 PEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPS 1439

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRAI++ITSYE+EY EL+ KL R+D AV ++Q SDNL N+FNVILAVGN+MNDS+KQA+
Sbjct: 1440 RMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQ 1499

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPEFN F+ ELEPVL+VVK+S+EQLVN
Sbjct: 1500 GFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVN 1559

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DCN+F Q I NVERS+EIGNLSDSSKFHPLDKV+ KVLP L EA KK +LL DE+KLT M
Sbjct: 1560 DCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFM 1619

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +MQ +GED GDKFA+ SFF+KFADFI EYKKA+AQN+K EEE   YERHK+MVEEQ
Sbjct: 1620 EFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQ 1679

Query: 1675 QRKAQEDASKLNENSSQTG--NXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRA 1732
            QRKA+E      +N  +TG  +             MDKLL QLKNAG  ++DP+SARKRA
Sbjct: 1680 QRKAKEQE----KNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARKRA 1735

Query: 1733 LLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQI-----ELEIHMASPTPKTKEDGK 1787
            ++RKK+          L ++  G  S+IYSP   + +     E E+ + SPTPK+K++  
Sbjct: 1736 VMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPKSKDN-- 1793

Query: 1788 LGTGENS-------------------NGESPLKK------INEDEEIGDRAKTLLMELRG 1822
            L T  NS                   N E+ +          EDE I DRAK LLMELRG
Sbjct: 1794 LETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDRAKALLMELRG 1853

Query: 1823 SDALMDRNTALDEHKERLRARRKRT------DSNKIPSSNRLKFVDEK 1864
            S     +N+ LD+ +E+LR+RR R       +SN  P SNRL FV ++
Sbjct: 1854 SQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTP-SNRLTFVSDE 1900

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/629 (62%), Positives = 486/629 (77%), Gaps = 34/629 (5%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPR QKKLKQLHWEK++ TDNSIW + KAE+FADDL+EKGVL  LE AFAAREIKSL
Sbjct: 1436 FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSL 1495

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A++KKED  KI++LS DISQQFGINLHM+SNLTV+Q +EK+++C+R  +NTPSVI+FLSK
Sbjct: 1496 ASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSK 1555

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
            QEIVEVS NLAR+YAPYSTDWEG+K ++DAK PEKDPNELQRADQIYLQLMVNLQSYW S
Sbjct: 1556 QEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGS 1615

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RM A++++TSYE++++EL+ KL RVD AVGS+Q S+NLKN+FNVILAVGNFMND++KQA+
Sbjct: 1616 RMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQ 1675

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKL+TLQRLTFIKD+ N+MTFLNYVE I+R NYPEFN+FL EL+PVL+VVKVSIEQLV 
Sbjct: 1676 GFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVR 1735

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F QGI NV RS+EIG LSDSSKFHP DKVL+KVLP L EA KK +LL+DE+KL+IM
Sbjct: 1736 DCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIM 1795

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +MQ +GED  DKFAK SFF+KFADFI EYK+AQ QN+KVEEEE  YE HKK +EEQ
Sbjct: 1796 EFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQ 1855

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            Q++ ++   K + + +   +            VMDKLLEQLKN G VKTDPTSARKRA++
Sbjct: 1856 QKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTDPTSARKRAMV 1915

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSP-DAK---EQIELEIHMASPTPKTKE------ 1784
            RKK+          L E + G DS++YSP D+K   +++  E ++ SPTP  K       
Sbjct: 1916 RKKLQNEKETASQILKEFETGEDSIVYSPTDSKITPKKVSNE-YLQSPTPGEKSSLADMT 1974

Query: 1785 ------------DGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTA 1832
                        DGK+ T ++SN +        D+EI DRAK+LL ELRGS     +N+ 
Sbjct: 1975 STPNPTTITTTTDGKV-TNDSSNDDL-------DQEIVDRAKSLLFELRGSQTPTRKNSV 2026

Query: 1833 LDEHKERLRARRKRTDSNKIPSSNRLKFV 1861
            L+E KE+LRARR+ T      +SN+LKFV
Sbjct: 2027 LEERKEKLRARRRNTSD---LTSNKLKFV 2052

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/886 (49%), Positives = 580/886 (65%), Gaps = 62/886 (6%)

Query: 293  ISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRT 352
            ISKP     T+L +    N  +S +  D+ NR P  Y+K+I++D+LS DEM DLWVTLRT
Sbjct: 393  ISKP----KTKLKNSNNINNKASALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRT 448

Query: 353  EQLDWVDAFLENQGHIAMANILMKSIYK-TTPKDKVSEPLLDKENAFFKCFRVLAVLSQG 411
            EQL WV+ FLE+QGHIAMAN LMKSIY+  T ++ +S  L+DKE  FFKCFRVL++LSQG
Sbjct: 449  EQLTWVNTFLEDQGHIAMANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQG 508

Query: 412  LHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQ 471
            L EF  H LMTDT+ QGLFS RLATRK+ATEIFV +L+K N      +L++ DK F I +
Sbjct: 509  LTEFIKHKLMTDTLVQGLFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINE 568

Query: 472  NSHMNESYKKLPQYFTHL--TSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAG 529
            N +M    K +P  + +L  T+ + +KV+ +WL+AVE TLDGRGKMGSLVGAS+D+K  G
Sbjct: 569  NLNMVYLLKNVPDKYHYLNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITG 628

Query: 530  GENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQI 589
            GENAILEYCQWTMV IN LC++S  INQR LLR KLEN G +RIMNK+K LDYEK+ +Q+
Sbjct: 629  GENAILEYCQWTMVLINRLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQL 688

Query: 590  ELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPT 649
            E YEN KLDD N LLE + K+ +VDL +P+SL+ +LL+ CK TE E++L S++QH++L +
Sbjct: 689  EDYENKKLDDLNTLLEQDTKS-SVDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSS 747

Query: 650  SKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAIL 709
            SKL D+K DP K++KQLKLMDSL+T+ ++++ +  S +NMAIQ LYDSM TD+VARRAIL
Sbjct: 748  SKLFDDKDDPTKLSKQLKLMDSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAIL 807

Query: 710  ESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXX 769
            ESR LTKKLEE++AERD L  +LS+AE+GLVG+LE E+ +RD ILAKNQRV         
Sbjct: 808  ESRNLTKKLEEVQAERDFLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELD 867

Query: 770  XXXXXXXXXXXXXXXXXRKMLTILNSRP-----------AKTKEQKKKIGSIE-ASEKED 817
                             RKMLTILNSRP           ++TK  K +I  +E    K+ 
Sbjct: 868  ELKKKHLMEKHDHEVELRKMLTILNSRPETELDNTMSSISRTKRNKHEIEKLELLKRKKV 927

Query: 818  LQRALQSGLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAE--- 874
            +++ALQ GLQ             G+T+QPN+RL+ LR+QME IENEAR+LEMTNF +   
Sbjct: 928  IEKALQDGLQKTKKDLSLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVR 987

Query: 875  YEKKG------------LKPPANVQKKSKPIS-ELNKEQRIQKLNELRDKLRRIQMESND 921
              KKG            LKP   + KK+K  S E+ K+Q  QKL ELR  L  IQ E+ND
Sbjct: 988  TPKKGQEKRDSHNKHPSLKPGIPIAKKNKDRSEEMAKKQ--QKLAELRKALADIQQETND 1045

Query: 922  VSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNE------ 975
            +S+FNV+E VNELFN KK  A++RLKELET Y+ FG+DF +E+F  ++  S+ E      
Sbjct: 1046 ISRFNVEEHVNELFNAKKIQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSP 1105

Query: 976  GYSSLDPKVYQDKLDEITKISEELLQ-----------QKNELETTQTXXXXXXXXXXXX- 1023
             Y +LDP ++ DK+DE+ K S +L Q           ++N L TT +             
Sbjct: 1106 AYETLDPNLFIDKMDELDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSD 1165

Query: 1024 -XXXXXXXXXALTNNKDINGTSSNVSDLASG--SFLDTLTQKYGTGQ--AEPIQSPVGHY 1078
                      AL+NN + N ++ +     SG  SFL++L+QKYGTGQ  + P+ S   + 
Sbjct: 1166 FESDEENENTALSNNVNDNSSTFSHQSTTSGGSSFLESLSQKYGTGQNASGPMSSNTPNV 1225

Query: 1079 SNRN-EKSFVDRMKRNSRVPSYVEELSKKMRGNKDHEFEEDDHKNG 1123
            S+ N E+ F+ RMK+    P+Y+ EL++K+        EE D+++ 
Sbjct: 1226 SHYNPERKFMSRMKKQHATPNYIRELNQKVSVTHSLSEEETDYEDA 1271

 Score =  156 bits (394), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 120/179 (67%), Gaps = 23/179 (12%)

Query: 76  PLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQS------GFKYSYSRRSSGQVS 129
           PLN +++L + N++QYV +    + E  ++H R  S  S        KYSYSRR S Q+ 
Sbjct: 95  PLNMRNSLTNPNMNQYVTS--PYTHEYNNSHSRNTSINSVNSNPLSTKYSYSRRGSNQI- 151

Query: 130 MAPSSMGNIN------------LTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTM 177
           ++PS  GN +             + H+ N +  S+S+LS GS+ NL +FMTPDGK+NL M
Sbjct: 152 LSPSPTGNSSNNNTSNINPQQRYSVHSNNPN--SSSILSQGSLHNLMKFMTPDGKVNLEM 209

Query: 178 PSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASN 236
           P++P EVE+L+EDIMYKRNILQ+LP +KQ ELMSY + KKWLIVKQDLQ+E K++++ N
Sbjct: 210 PNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRSKN 268

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1138 (41%), Positives = 677/1138 (59%), Gaps = 100/1138 (8%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80
            LF NL++LT    +N N S K   ++  +IS   +  I  + AV    G     +PL+K+
Sbjct: 27   LFSNLKKLTGSG-NNANTSNK---IEPSDIS---SPKIVSTPAVPEFSG-----KPLSKQ 74

Query: 81   STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSG--FKYSYSRRSSGQVSMAPSSMGNI 138
            +TLN+QNLS YV+     +P    +H+R+ S  SG   KYSYSRRSS Q S   +     
Sbjct: 75   TTLNTQNLSSYVDMN---TP----HHNRSPSGMSGSPTKYSYSRRSS-QWSNGNNIGNGG 126

Query: 139  NLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNIL 198
             L+R  TN S SSAS+ S GS+TNL++FM  DGK+ L  PS+P E+E LF ++M+KRN  
Sbjct: 127  RLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFF 186

Query: 199  QSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDXXXXXX 258
            QSLP   Q ELM+Y ++KKWL+VKQDLQ+E K++  +NK ++    +             
Sbjct: 187  QSLPAAGQKELMNYDLDKKWLLVKQDLQSELKKL--ANKKNTHVAPAG----------AA 234

Query: 259  XXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQ 318
                                         K +   S PI       Y    +N+S++T+ 
Sbjct: 235  GLAATISAATQGTSGAGGVGGVDGTQAGSKGHNSTSSPILGGGG-FYESGNQNSSTATLS 293

Query: 319  SDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSI 378
             D  +  P +YV+KI+ DK+S  ++KDLWV+LRTEQLDWV  FL+ QG +A+AN+L++  
Sbjct: 294  QDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFF 353

Query: 379  YKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRK 438
            +K +P   +++  LDKE AFFKC + L  L +G +E     L+   I  GL S R++TR+
Sbjct: 354  HKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRR 413

Query: 439  MATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHM-------NESYKKLPQ-YFTHLT 490
            +A+E+ VF+ +         V+  LD+   +  N H+       N+    L Q +   LT
Sbjct: 414  IASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLT 473

Query: 491  SNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCS 550
             +   K  + WLF VE TLDGRGKMGSLVGASED+K+AGGENAILEY   T++ +N LC+
Sbjct: 474  RDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCN 533

Query: 551  SSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKN 610
            +  ++NQRTLLR + ++CG+ RIM K++LL+Y+K+ +Q+ ++E+   DD+N ++ S   N
Sbjct: 534  TPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSIN 593

Query: 611  INVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMD 670
             NVD+++P+SL++NL ++ KGT  EK LVSLVQH+F+ +SK+ DE  DP + +KQLKL+D
Sbjct: 594  HNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLID 653

Query: 671  SLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVE 730
            SLV+NV+++S +  S+ N AIQRLYDSMQTDEVARRAI+E+R LT+K EE++AERD L E
Sbjct: 654  SLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGE 713

Query: 731  KLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKML 790
            KLSKAE GLVGQL+ E+ +RDRIL KNQRV                          RK+L
Sbjct: 714  KLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLL 773

Query: 791  TILNSRP-AKTKEQKKKIGS--------IEASEKEDLQRALQSGLQXX----XXXXXXXX 837
            TILNSRP   +  Q+++ G+        + A  K  +Q+ALQ  LQ              
Sbjct: 774  TILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLG 833

Query: 838  XXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQK--------- 888
               G T++PN+RLK+LR +ME IENEAR+LEMTNFA+ +++ ++    V           
Sbjct: 834  TTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVL 893

Query: 889  -KSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLK 947
             ++    +  KE +++KL ELR +L  +Q ESNDVSKFNV+ER+NELFNDKK +AL RLK
Sbjct: 894  DRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLK 953

Query: 948  ELETKYKGFGIDFKVE-DFTHESTDSSNE--------GYSSLDPKVYQDKLDEITKISEE 998
            ELETKYKGFGIDF+ + + +   +D+  E         + SLDPK    K++E++KI +E
Sbjct: 954  ELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDE 1013

Query: 999  LLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVSDLASGSFLDT 1058
            L   K E+E                          L  +   +  S N S   +GSFL+T
Sbjct: 1014 LTAFKKEIENGPPSSSSSSSDEE------------LEQDDRASIHSGNAS---TGSFLET 1058

Query: 1059 LTQKYGTGQ-AEPIQSP---VGHYSN-----RNEKSFVDRMKRNSRVPSYVEELSKKM 1107
            L+QKYGTGQ A P  S    VG  SN      + +SF++R+K++   P ++ EL++K+
Sbjct: 1059 LSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP-FLSELTQKV 1115

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/618 (60%), Positives = 472/618 (76%), Gaps = 16/618 (2%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP+KKLKQLHWEK+E T NSIW   KAEK+ADDLYE+GVL++LEKAFAAREIK L
Sbjct: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A R+KEDL K++FLS D+SQQFGINLHMY+ L+V + V K+L+C++DF+ + SVI+FL K
Sbjct: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EIVEVS NLARN+APYST+WEG+  +++AK PEKDP ELQRADQ+YL++MVNLQ YWAS
Sbjct: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+++IT+YE+EY++LL KL  +DKAV S+Q SDNL+++F VILAVGN+MNDS+KQA 
Sbjct: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NY EFN+FL ELEPVL+VVK+S+EQL  
Sbjct: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F Q I NVERSIE+GNLSDSSKFHP D+VL+KVLP L EARK+ +LL+DE+KLT+M
Sbjct: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EF+ +MQ +GED  DKFAK SFF+KFADFI EYKKAQA NIK+EEEE AYER KKMVEEQ
Sbjct: 1667 EFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQ 1726

Query: 1675 QRKAQEDASK--LNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRA 1732
             ++A+ +A K  +++ S   G             VMDKLLE+LKNAG  K+DP+SARKRA
Sbjct: 1727 HKRARLEAEKGGVDDGSEAEG---VTAVSRGERDVMDKLLEKLKNAGPGKSDPSSARKRA 1783

Query: 1733 LLRKKIHXXXXXXXXPLAEMQVG-----GDSLIYSPDAKEQIELEIHMASPTPKTKEDGK 1787
            L RKK+          L   +V        SL+YSP+   +     H  SPTPK    G 
Sbjct: 1784 LARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKAANAAHAESPTPKASRQGS 1843

Query: 1788 L-GTGENSNG--ESPLKKINED-EEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRAR 1843
            + G+G  +    ESP K+ +   E++ DRA+ LL ELRG ++   R   L++H+E++RAR
Sbjct: 1844 VAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHREKMRAR 1902

Query: 1844 RKRTDSNKIPSSNRLKFV 1861
            R+R +     S N+L FV
Sbjct: 1903 RRRVNEG-ASSENKLVFV 1919

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/615 (60%), Positives = 465/615 (75%), Gaps = 19/615 (3%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP KKLKQLHWEK++  ++SIW + KAE+FADDLYEKG+LS LEKAFAAREIKSL
Sbjct: 1315 FERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSL 1374

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
             +RKK+D  K++FLS D+SQQFGINLHMYS+L+V + V K+LKC++DF+ TPSVIEFLSK
Sbjct: 1375 TSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSK 1434

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
            QEIVEVS NLARN+APY+TDWEGI  ++DAK PEKDP+ELQRAD++YL+L VNLQ YW+S
Sbjct: 1435 QEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSS 1494

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+++ITSYE+EY++L+ KL  +DKA  ++Q S+NL+N+ +VILAVGNFMNDS+KQA+
Sbjct: 1495 RMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1554

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GF+L+TLQRLTFIKD  NSMTFLNYVEKIVR  YPEFN FL ELEPV+  VK+SIEQ+  
Sbjct: 1555 GFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQ 1614

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F Q + NVERS++IGNLSDSSKFHPLD+ LLKVLP L EARKKG+LL DEMKLT++
Sbjct: 1615 DCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLL 1674

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EF+ +M+ +GED  DKF++ SFF+KFADF+ EYKKAQ  N+K+EEEE AYER KKMVEEQ
Sbjct: 1675 EFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQ 1734

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            QR+A+E   + N   S  GN            VMD+LLE+LKNAG  K+DP+SARKRA+ 
Sbjct: 1735 QRRARESNEQEN---SVDGNADDNTAASGDRDVMDRLLEKLKNAGPGKSDPSSARKRAIA 1791

Query: 1735 RKKIHXXXXXXXXPLAEMQV---GGDSLIYSPDAKEQIELEIHM-ASPTPKT-KEDGKLG 1789
            R+K+          L   ++    G SL+YSP   EQ+ L   +  SPTP   K +G+  
Sbjct: 1792 RRKLLQGSSSNSTILDNFEIEKPEGKSLVYSP---EQVTLSNSVDHSPTPDVRKREGQST 1848

Query: 1790 TGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDS 1849
              E    ES         ++ DRA+ LL+ELRG ++   R ++ D+   +LRARRK   S
Sbjct: 1849 ASEVQTSES--------SDLTDRARNLLIELRGPESPSRRASSKDQRISKLRARRKNDGS 1900

Query: 1850 NKIPSSNRLKFVDEK 1864
                S N L FV ++
Sbjct: 1901 GNSGSDNHLNFVGQE 1915

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1154 (38%), Positives = 648/1154 (56%), Gaps = 135/1154 (11%)

Query: 21   LFQNLRRLTTKDRDNRNKSPKRT--SLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLN 78
            +F NL+RLT     N N S  +T   +D  +IS  S K IN+       H      +PL+
Sbjct: 27   IFSNLKRLT----GNANNSSSQTLQKVDISDIS--SPKKINLPDTGEFSH------KPLS 74

Query: 79   KKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGF---KYSYSRRSSGQVSMAPSSM 135
            K+STLN  NLS Y         +  S H+R+ S  S     KYSYSRR+S Q S    + 
Sbjct: 75   KQSTLNIANLSAYT--------DVASTHNRSSSAASNSSPTKYSYSRRAS-QWSSNGGTA 125

Query: 136  GNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKR 195
             +  L+R  TN S SSAS+ S GS +NLS+F+ PDG I L  P DP E+E LFE+++YKR
Sbjct: 126  PSTKLSRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKR 185

Query: 196  NILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSR------TGMSM--- 246
            N+ QSLP   Q EL +Y +EKKWL+V+QDLQ+E K+   +NK  S+      TG+S+   
Sbjct: 186  NVYQSLPPSAQKELNNYDLEKKWLMVRQDLQSEVKKF-MNNKSVSKSPAAASTGISLIAP 244

Query: 247  --PDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTEL 304
              P  G                            + +  SRS  +N         TS + 
Sbjct: 245  ESPSTG------------------HFASNSSINESLAGSSRSRAQN-------PGTSDQF 279

Query: 305  YHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLEN 364
            Y      +S++T+  D ++  P +YV+KI+ + +S   + DLWV+LRTEQLDWV  FLE 
Sbjct: 280  YGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEA 339

Query: 365  QGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDT 424
            QG +A+AN+++K+ Y+ +P + + + +LDKE A+FKC +    L +G  E  + +     
Sbjct: 340  QGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAKII 399

Query: 425  IA---QGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHMNE---- 477
            I+   +GL S R+ATR++A+E+ V L +      F  V+++LD+      N H+      
Sbjct: 400  ISAIIEGLLSLRVATRRIASELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLS 459

Query: 478  --SYKKLPQYF-THLTSNSN----LKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGG 530
              S K++     + L +++N    ++  + W+  VE TLDGRGKMGSLVGASED++ +GG
Sbjct: 460  QTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGG 519

Query: 531  ENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIE 590
            ENAI+EY   T++ +NHLC +  ++ QRT+LR +L+N G+ RI+NK+K L+YEKV +Q+ 
Sbjct: 520  ENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLA 579

Query: 591  LYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTS 650
            ++E++  DDF+ L         +++QDPVS+ +NL D CKGTE E+ L+SL+Q++ + T 
Sbjct: 580  IFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTG 639

Query: 651  KLLD-EKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAIL 709
            +L    K+DP + TKQLKL+D+LV+NVS+ S +  S+ N AIQRLYD+MQTDE+ARRAIL
Sbjct: 640  ELGGTSKEDPAQRTKQLKLIDALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAIL 699

Query: 710  ESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXX 769
            E+R   K+ EE++AER+ L EKLS AE GLVGQL+ E+K+RD IL K+QRV         
Sbjct: 700  ENRDWVKRYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELD 759

Query: 770  XXXXXXXXXXXXXXXXXRKMLTILNSRPAKTK--EQKKKIGSIEASEKEDLQRALQSGLQ 827
                             RK LT LNS+    +  E   +   ++      +QRALQ  L+
Sbjct: 760  ESKKKLILAKHQHEVELRKTLTALNSKGGDIQLTEDGGQPKPLKPERMLAIQRALQIKLE 819

Query: 828  XXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKP----- 882
                         G++++PN+RL++LR +ME IEN+AR+LEMTNF+EY +   K      
Sbjct: 820  KTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDADKEIEMAH 879

Query: 883  ------PANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFN 936
                  P++V   +   S L       KL +LR KL  +Q ESND+SKFNV+ R +E+F+
Sbjct: 880  EGTHMYPSDVDVGTTQDSNL-------KLEQLRRKLASLQNESNDISKFNVEGRFHEMFS 932

Query: 937  DKKRTALQRLKELETKYKGFGIDFKVED---FTHESTDSSNEGYSSLDPKVYQDKLDEIT 993
            D+K  AL RLK+LE  Y GFGI++   +      E     N+   +LDPK   + +DE  
Sbjct: 933  DQKIQALDRLKKLENDYSGFGINYDPAESPSLKQEQGQDVNKS-RTLDPKGPNNSVDE-- 989

Query: 994  KISEELLQQKNELETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTSSNVSDLASG 1053
                      ++LET +                           +D++ T S   ++  G
Sbjct: 990  ----------SQLETDRANASIDSSPASESLEE-----------EDVHLTKSTTEEIG-G 1027

Query: 1054 SFLDTLTQKYGTGQA--EPIQSPVGHY-----SNRNEKSFVDRMKRNSRVPSYVEELSKK 1106
            SFL+ L+QKYG GQA      S VG       S  + KSF++R+K++  VP Y+EELS K
Sbjct: 1028 SFLERLSQKYGKGQANLSNRNSVVGRENSYPGSGYHRKSFMNRVKKSDNVP-YLEELSGK 1086

Query: 1107 MRGNKDHEFEEDDH 1120
              G   HE E +++
Sbjct: 1087 F-GTATHENESEEN 1099

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/611 (58%), Positives = 464/611 (75%), Gaps = 13/611 (2%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            F+ YPRP KKLKQLHWEK++  ++SIW   KAEKFADDLYEKGVLS LEKAFAAREIKSL
Sbjct: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSL 1391

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A+RKK+D  K+SFLS D+SQQFGINLHMYS+L+V + V K+L+C+RDF++TPSVI+FLSK
Sbjct: 1392 ASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
            QEIVEVS NLARN+APY+ DWEG+  +E+AK PEKDP ELQRAD++YL+L VNLQ+YW+S
Sbjct: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+++IT+YE++Y++L+ KL  +DKA  S+Q S+NL+N+ +VILAVGNFMNDS+KQA+
Sbjct: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GF+L+TLQRLTFIKD  NSMTFLNYVEKI+R  YPEFN+FL ELEPV+  VK+SIEQ+  
Sbjct: 1572 GFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F Q + NVERS++IGNLSD +KFHP D+VLLKVLP L EARKKG+LL DEMKLT++
Sbjct: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EF+ +M+ +GED  DKFA+ SFF+KFADF+ EYKKAQ  N+K+EEEE AYER KK+VE+Q
Sbjct: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQ 1751

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
             ++ +E  SK N+ ++  G             VMD+LLE+LKNAG  K+DP+SARKRA+ 
Sbjct: 1752 LKRTRESESK-NKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRAVA 1810

Query: 1735 RKKIHXXXXXXXXPLAEMQV---GGDSLIYSPD-AKEQIELEIHMASPTPKTKEDGKLGT 1790
            RK++          L    +    G SL+YSPD    +++L     SPTP+ +       
Sbjct: 1811 RKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRV------ 1864

Query: 1791 GENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDSN 1850
              +SN  SP        ++ DRA+ LL+ELRG ++   + +A  +   +LRARRK  DS+
Sbjct: 1865 -RDSNATSPASHDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKLRARRK-NDSS 1922

Query: 1851 KIPSSNRLKFV 1861
               S NRL FV
Sbjct: 1923 SSGSENRLNFV 1933

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1132 (38%), Positives = 644/1132 (56%), Gaps = 101/1132 (8%)

Query: 24   NLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKKSTL 83
            NL+RLTT    N + S     LD  +IS  S K IN+       H      +PL+K+STL
Sbjct: 30   NLKRLTTGS-GNSSVSHNTQKLDISDIS--SPKKINLPDTGEFSH------KPLSKQSTL 80

Query: 84   NSQNLSQYVNNGKALSPESGSNHHRTDSTQS---GFKYSYSRRSSGQVSMAPSSMGNINL 140
            N  +LS Y +   A        H+R+ S  S     KYSYSRR+S Q S   S++    L
Sbjct: 81   NMASLSAYTDAVGA--------HNRSASNASVGSPTKYSYSRRAS-QWSNNNSAVSGSKL 131

Query: 141  TRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQS 200
            +R  TN S SSAS+ S GS +NLS+F+ PDG + L  P DP E+E LFE+++YKRN+ QS
Sbjct: 132  SRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQS 191

Query: 201  LPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGD------SRTGMSMPDLGSDXX 254
            LP   Q EL +Y +EKKWL+V+QDLQ+E K+   S            +  ++PD  S   
Sbjct: 192  LPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPS--- 248

Query: 255  XXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSS 314
                                    +P+  S +G     IS     TS + Y      +S+
Sbjct: 249  ----------------ASNFTSSTSPNG-SFTGLSRPKISTSSVNTSEQFYSSNLGTSST 291

Query: 315  STIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANIL 374
            +T+  D ++  P +YV+KI+ + +S   + DLWV+LRTEQLDWV  FLE QG +A+AN++
Sbjct: 292  TTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVI 351

Query: 375  MKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHS---LMTDTIAQGLFS 431
            +K+ Y+ +P + + + +LDKE A+FKC +    L +G  E  + +   ++   I +GL S
Sbjct: 352  LKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLS 411

Query: 432  GRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQNSHM-----NESYKKLPQYF 486
             R+ATR++A+E+ + L +      F  V+ +LD+      N H+      +S  K P+  
Sbjct: 412  LRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKG 471

Query: 487  THLTSNSN------LKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQW 540
            + +    +      ++  + W+  VE TLDGRGKMGSLVGASED++ +GGENAI+EY   
Sbjct: 472  SSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYL 531

Query: 541  TMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDF 600
            T++ INHLC +  ++ QRT+LR +L+N G+ RI+NK+KLL+YEKV +Q+  ++++  DDF
Sbjct: 532  TLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDF 591

Query: 601  NALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDE-KQDP 659
            +AL         VD++DPVS+ +NL + CKGT+ E+ L SL+Q++ + T +L  + K DP
Sbjct: 592  DALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDP 651

Query: 660  NKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLE 719
             + TKQLKL+D+LV+NVS+ S +  S+ N AIQRLYD+MQTDE+ARRAILE+R   K+ E
Sbjct: 652  TQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYE 711

Query: 720  EMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXX 779
            E++A+RD L EKLS AE GLVGQL+ EV++RD IL K+QRV                   
Sbjct: 712  EIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAK 771

Query: 780  XXXXXXXRKMLTILNSRPAKTKEQKKKIGS-----IEASEKEDLQRALQSGLQXXXXXXX 834
                   RK LT +NS    +   + + GS     +    K  +Q+ALQ+ L+       
Sbjct: 772  HEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEIN 831

Query: 835  XXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLK-PPANVQKKSKPI 893
                  G++++PN+RLK+LR +ME IEN+AR+LEMTNF++Y+K  +K P  + +   K +
Sbjct: 832  VESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAV 891

Query: 894  SEL-NKEQRIQ--KLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELE 950
            SE   K Q+I   KL ELR KL  +Q ESND+SKFNV+ R +E+F+ +K  AL RLK+LE
Sbjct: 892  SESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLE 951

Query: 951  TKYKGFGIDFKVEDFTHES----TDSSNEGYSSLDPKVYQDKLDEITKISEELLQQKNEL 1006
            T YKGFGI+F  +    ++    + SS++   +LDPK   + ++E++ I   L   K   
Sbjct: 952  TDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAE 1011

Query: 1007 ETTQTXXXXXXXXXXXXXXXXXXXXXALTNNKDINGTS-SNVSDLASGSFLDTLTQKYGT 1065
            ++ +T                           D NG   +  S L + SFL++L+QKYG 
Sbjct: 1012 KSNETPLRTATSSDSSEDEM-----------DDKNGDKIAADSTLPTSSFLESLSQKYGG 1060

Query: 1066 GQ----------AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM 1107
             Q             I  P   Y   + KSF++R+KR   VP Y+ ELS K+
Sbjct: 1061 AQNSLSNRHSFAGGEINYPGSGY---HRKSFMNRVKRTGAVP-YLGELSGKI 1108

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/585 (60%), Positives = 434/585 (74%), Gaps = 35/585 (5%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP+KKLKQLHWEK++  DNSIW + +AEKFADDLYEKGVLSELEKAFAAREIKS 
Sbjct: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
              RKK++  KI+FLS DISQQFGINLHMYS+L V+  V K+LKC++DF++T S IEFLSK
Sbjct: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EIVEVSTN+AR++APY+TDWEG+  +EDAK+PEKDP+ELQR+DQ++L L+VNLQSYW+S
Sbjct: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMR +++IT+YE++YN+L+ KL  +DKAVG++Q S+NL+N+F+VILAVGN+MND++KQA+
Sbjct: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD  NSMTFLNYVE+IV  NYP FN+FL ELEPVL+VVK+SIEQL N
Sbjct: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DCN+F   + NVERS+EIGNLSDSSKFHP D+VL KVLP L EARKK  LLADE++L++M
Sbjct: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +M+ +GED  DKFAK SFF+KFADFI EYK+AQ  N K++EEE AYER K M++EQ
Sbjct: 1727 EFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786

Query: 1675 QRKAQEDASKLNENSSQT--GNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRA 1732
            QR+A     KL +   +T                VMDKLLE+LKNAG  K DP+SARKRA
Sbjct: 1787 QRRA-----KLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSKGDPSSARKRA 1841

Query: 1733 LLRKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGE 1792
            L RKK+          L  + V  D    +PD +    L    ASP P            
Sbjct: 1842 LARKKLMGGREGSII-LEGLDVD-DLQSAAPDVQPDTPLRAASASPPP------------ 1887

Query: 1793 NSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHK 1837
                          +   DRA+ LL+ELR  +    R + LDEHK
Sbjct: 1888 --------------DPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  546 bits (1408), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 376/1043 (36%), Positives = 570/1043 (54%), Gaps = 127/1043 (12%)

Query: 21   LFQNLRRLTTKDRDNRN-----KSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSR 75
            LF NL +LT      R       SPK+ +L +         N+++S A           +
Sbjct: 34   LFSNLMKLTGSSGSQRIATSDISSPKKVTLPS---------NLDLSGA-----------K 73

Query: 76   PLNKKSTLNSQNLSQY---VNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSG--QVSM 130
            PLNK +T+N+ NL Q    V   ++ S  + S+  +   ++   +++ S++++       
Sbjct: 74   PLNKLNTINASNLPQVSGEVTQARSASGAALSSPSKYSYSKRSSQWASSKQANHPEHDQQ 133

Query: 131  APSSMGNI---------NLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDP 181
             P  + ++          LTR  TN S  SAS  S+ S++ L +    DG + L  P DP
Sbjct: 134  YPQHLNHLFVQPHPHHSALTRQMTNQSNYSAS--SYTSLSLLHKATDIDGTLTLEKPEDP 191

Query: 182  YEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSR 241
             E+E L+++++ KRNI QS+      ELMSY I+KKWL+VKQDLQ E+K++K        
Sbjct: 192  QEIEELYQELLQKRNIPQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMKN------- 244

Query: 242  TGMSMPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKPIAATS 301
               SMP                               +  + +RS  +N   +KP+A   
Sbjct: 245  ---SMP----------PSSTVESIASSALAKSPGGSISSGSITRSISQNS--AKPMA--- 286

Query: 302  TELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAF 361
                           +  + A+  P HYV+KI+ D+++  E+ DLW++LRTE +DWV  F
Sbjct: 287  ---------------VAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGF 331

Query: 362  LENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLM 421
            ++ QG +A+AN L+K + + +         L+KENA++KC RVL  L +G+ E     L+
Sbjct: 332  IDAQGQVAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLV 391

Query: 422  TDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES-------VLSSLDKNFIIGQNSH 474
              ++ +GL S RL+TR++ATE  +++L     K  ++       +L +LD+      N H
Sbjct: 392  ISSVVEGLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVALDQESKFAANIH 451

Query: 475  MNESYKKLPQYFTHLTSNSNLKVI----QAWLFAVEQTLDGRGKMGSLVGASEDYKNAGG 530
            +     +  +  +  T  ++  V+    + WL+ +E TLDGRG+MGSLVGAS+DYK  GG
Sbjct: 452  LRGRLHETNKRKSLPTGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GG 509

Query: 531  ENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIE 590
            EN +LEY  ++M+ +N LCS+  ++ QR LLR +L++ G+ RI+ K++LL Y  + +++ 
Sbjct: 510  ENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVR 569

Query: 591  LYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTS 650
             +E+  LDD+N L+ S   +  VD++DP +L ++     +GTE E  L+SL+QH+FL  S
Sbjct: 570  KFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAEGHLLSLLQHLFL-WS 628

Query: 651  KLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILE 710
            +   E +DP +  KQLKL+D+LVTNV+ +S +  S  N AIQRLYD+MQTDEVARRAILE
Sbjct: 629  RAFAEYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILE 688

Query: 711  SRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXX 770
            SR LTKK EE++AERD L  KLS+A++GLVGQL+ EV++ +RIL K+ RV          
Sbjct: 689  SRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHA 748

Query: 771  XXXXXXXXXXXXXXXXRKMLTILNSRPAKTKEQKKKIGS-----IEASEKEDLQRALQSG 825
                            RKMLTILNS+P        ++ +     ++  +K  +Q+ALQ  
Sbjct: 749  LKKKHLLEKHEHEVELRKMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDR 808

Query: 826  LQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEY-------EKK 878
            L+                  PN+RLK+LR +M+ IE EAR LEMTNFA++        + 
Sbjct: 809  LRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEP 868

Query: 879  GLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDK 938
             L  P  +Q+       L  EQ +++L  LR +L  IQ ESN+VSKFNV+ERVNELF +K
Sbjct: 869  KLLSPPKIQRS------LRGEQ-VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEK 921

Query: 939  KRTALQRLKELETKYKGFGIDFKVED-------FTHESTDSSN-----EGYSSLDPKVYQ 986
            K  AL RL++LE KYKGFGIDF  ED         + S D        E  + LDP    
Sbjct: 922  KNKALDRLRDLENKYKGFGIDFN-EDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLD 980

Query: 987  DKLDEITKISEELLQQKNELETT 1009
             K++E+TKI + L + K +++ +
Sbjct: 981  AKIEEMTKILDRLNKLKKDIDMS 1003

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 20/78 (25%)

Query: 1050 LASGSFLDTLTQKYGTGQ---AEPIQSP--------VGHYSNRN-------EKSFVDRMK 1091
            +++ SFL+TL+QKYGTG    A  + S         V   +++N        KSFV+RMK
Sbjct: 1083 ISNASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRMK 1142

Query: 1092 RNSRVPS--YVEELSKKM 1107
            R     S  ++EEL++K+
Sbjct: 1143 RTITPTSSNFLEELTQKV 1160

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/618 (59%), Positives = 466/618 (75%), Gaps = 28/618 (4%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP+K+LKQLHWEK++  DNSIW + +AEKFADDLYE+GVL+ELEKAFAAREIKSL
Sbjct: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
             +RKK D  K++FLS DISQQFGINLHMYS+LTV+Q V K+LKC++DF+NT S IEFLSK
Sbjct: 1460 ISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
             EIVEVS N+AR +APY+TDWEG+  +E+AK PEKDPNELQRADQ+YL L+VNLQSYW S
Sbjct: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRA+++IT+YE++YN+L+ KL  +DKAVG++Q S+NL+N+F+VILAVGN+MNDS+KQA+
Sbjct: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD  NSMTFLNYVEKIVR+NYP F+ FL ELEPVL+VVK+SIEQL N
Sbjct: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F   + NVERS+EIGNLSDSSKFHP D+VL KVLP L EARK+  LLADE++L++M
Sbjct: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +M+ +GED  DKFAK SFFQKFADFI EYK+AQ  N K+EEEE AYER K M+EEQ
Sbjct: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXX---XAVMDKLLEQLKNAGQVKTDPTSARKR 1731
            Q++A+++  +++ + S+ G+               VMD+LLE+LKNAG  K DP+SARKR
Sbjct: 1819 QKRARKNI-QIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPSKADPSSARKR 1877

Query: 1732 ALLRKKIHXXXXXXX--------XPLAEMQVGG--------DSLIYSPDAKEQIELEIHM 1775
            AL RKK+                  LA +Q  G         +++ SP +      ++  
Sbjct: 1878 ALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEG 1937

Query: 1776 ASP------TPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGS-DALMD 1828
             +P       P + E G + +  + + ESP KKI +++ +  RA+ LL ELR S D   D
Sbjct: 1938 LNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARNLLQELRSSDDHTED 1997

Query: 1829 RNTALDEHKERLRARRKR 1846
            R + LDEHKE++R RR +
Sbjct: 1998 RKSLLDEHKEKVRQRRNK 2015

 Score =  563 bits (1452), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 366/984 (37%), Positives = 552/984 (56%), Gaps = 93/984 (9%)

Query: 71   IDQSRPLNKKSTLNSQNLSQYVN----NGKALSPESGSNHHRTDSTQSGFKYSYSRRSSG 126
            +  ++PL+K STLN+ +LSQY +    +     P S  +  +   ++   ++S    S+ 
Sbjct: 74   LSTAKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSSQWS-GGNSNK 132

Query: 127  QVSMAPSSMGNIN-LTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVE 185
            Q+ + P    + + L+R  TN S +S +  S  S+T L +    DG ++L  P  P E+E
Sbjct: 133  QLLLLPQPQHSQHTLSRQPTNQSNNSDNSFS--SVTLLQKITDSDGNLSLEKPKYPQEIE 190

Query: 186  SLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMS 245
             L+++++ KRNIL S+      ELM Y ++KKWL+VKQDLQ E K          R   +
Sbjct: 191  ELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELK----------RMKNN 240

Query: 246  MPDLGSDXXXXXXXXXXXXXXXXXXXXXXXXXXAPSTYSRSGKKNIPISKP---IAATST 302
            +P                                 ST +     ++ +  P    ++++ 
Sbjct: 241  VPQ--------------------------------STVADPLSNSVHLKSPRGSFSSSNM 268

Query: 303  ELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFL 362
                I++ +     +  D ++  P HYV+KI+ D+++  E+ DLWV+LRTE +DWV  F+
Sbjct: 269  SARSISQNSAKQLAVSYDPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFI 328

Query: 363  ENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFTIHSLMT 422
            + QG +A+AN L+K   + + +  +   LL+KE A++KC RVL  L +G+       L+ 
Sbjct: 329  DAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSSKLVI 388

Query: 423  DTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES-------VLSSLDKNFIIGQNSHM 475
              + +GL S RL TR++ATE  +++L     K  ++       VL +LD+      + H+
Sbjct: 389  SAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHL 448

Query: 476  NESYKKLPQYFTHLTSNSNLKVI----QAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGE 531
                 +  +  +  T  ++L VI    + WL+ +E TLDGRG+MGSLVGASEDYKN  GE
Sbjct: 449  RGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GE 506

Query: 532  NAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIEL 591
            N +LEY  ++M+ IN LCSS  +++QR LLR +L++ G+ R++ K++LL Y  + +++  
Sbjct: 507  NTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSK 566

Query: 592  YENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSK 651
            +E+  LDD+N+L+ S+  + +VD++DP SL  N     KGTE+E  L+SL+QH+FL +SK
Sbjct: 567  FEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSK 626

Query: 652  LLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILES 711
               E  DP + +KQLKL+D+LV+NV+ +S +  S  N AIQRLYD+MQTDEVARRAILES
Sbjct: 627  AFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILES 686

Query: 712  RTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXX 771
            R LTKK EEM+AERD L  KL++A+ GLVGQL+ EV++  RIL K+ RV           
Sbjct: 687  RELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDL 746

Query: 772  XXXXXXXXXXXXXXXRKMLTILNSRPAKTKEQK--------KKIGSIEASEKEDLQRALQ 823
                           RKMLTILNS+P               K    ++  +K  +Q+ALQ
Sbjct: 747  KKKHLLEKHEHEVELRKMLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQ 806

Query: 824  SGLQXXXXXXXXXXXXXGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPP 883
              L+             G    PN+RLK+LR +M+ IE EA  LEMTNFAE+ KK  K  
Sbjct: 807  DRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEF-KKETKVE 865

Query: 884  ANVQKKSKPISELN-KEQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTA 942
               + +S P  E N + +++++L  LR +L  IQ ESN++SKFNV+ERVNELF +KK  A
Sbjct: 866  DLPRLQSPPKIERNVRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKA 925

Query: 943  LQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSS-----------------LDPKVY 985
            L RL++LE KY+ FGIDF +E      TD   +G +S                 LDP   
Sbjct: 926  LDRLRDLEEKYRSFGIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARL 985

Query: 986  QDKLDEITKISEELLQQKNELETT 1009
              K++E+TKI EEL + K +++ T
Sbjct: 986  DAKIEEMTKILEELNRLKCQVDPT 1009

 Score = 43.5 bits (101), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 18/72 (25%)

Query: 1054 SFLDTLTQKYGTG-QAEPIQSP-----------VGHYSNRN----EKSFVDRMKRNS--R 1095
            SFL++L+QKYGTG   +P +              G  S RN     KSFV+RMK+NS  +
Sbjct: 1110 SFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNSTPK 1169

Query: 1096 VPSYVEELSKKM 1107
              S+V+E+S+KM
Sbjct: 1170 SSSFVDEVSQKM 1181

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/612 (55%), Positives = 445/612 (72%), Gaps = 32/612 (5%)

Query: 1255 FENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSL 1314
            FE YPRP+KKLKQLHWEK+++  +SIW + +AEK ADDL+E+GVLS+LEKAFAARE KSL
Sbjct: 1226 FERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAFAARETKSL 1285

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
              + KE  +KI+FLS D+SQQFGINLHM+SNL V   V KV+KC+R+F++TPSVIEFLSK
Sbjct: 1286 KGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTPSVIEFLSK 1345

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
              I+EV+ NLAR + PYSTDWEG+  ++DAK PEKDPNELQRADQ+Y++ M+NLQ YW S
Sbjct: 1346 PTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEFMINLQPYWGS 1405

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            RMRAI MIT+YE++Y++L+ KL ++D+AV  ++ S++L+++F+VILAVGN+MNDS+KQA+
Sbjct: 1406 RMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGNYMNDSSKQAQ 1465

Query: 1495 GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
            GFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYPE+++F+ ELEP+  V K+SIEQLV 
Sbjct: 1466 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSVTKISIEQLVT 1525

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            DC +F Q + NVERSIEIGNLSD SKFHPLD+VL KV+P L EARKK +LL+DE+KL+++
Sbjct: 1526 DCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADLLSDEIKLSLL 1585

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            EFE +M+ +GED  DKF+K SFFQKFADFI E+KKA+  N+K+EEEE AYER KKM+E+Q
Sbjct: 1586 EFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAYERRKKMIEDQ 1645

Query: 1675 QRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKRALL 1734
            QRK QE  SK     +   N             ++KLL++LKNA   K DP+S RKRAL 
Sbjct: 1646 QRKQQEADSK-----ATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGDPSSTRKRALA 1700

Query: 1735 RKKIHXXXXXXXXPLAEMQVGGDSLIYSPDAKEQIELEI---HMASPTPKTKEDGKLGTG 1791
            RKK+                 G S+  +  A   IE  +      + +P  K+   L   
Sbjct: 1701 RKKLLDGK------------SGASIFDNITADSTIEAFVEQNRTLTESPTAKKSASLPET 1748

Query: 1792 E--NSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRARRKRTDS 1849
            E  +S+ + P           DRA+ LL+ELRG D   D + +  + K++LR  +K+  S
Sbjct: 1749 ESLSSSKQDP----------ADRARNLLLELRGPDERKDASPSPIKAKDKLRDLKKKDSS 1798

Query: 1850 NKIPSSNRLKFV 1861
             K+   N+L+FV
Sbjct: 1799 VKVDQPNKLQFV 1810

 Score =  554 bits (1427), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 333/825 (40%), Positives = 487/825 (59%), Gaps = 55/825 (6%)

Query: 325  PPIHYVKKIVDDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTP- 383
            PP +YV++I+  K+   E+ DLWV+LRTE LDWV +FLE QG +A+AN+++ S+++ T  
Sbjct: 267  PPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTD 326

Query: 384  -KDKVSEP-LLDKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMAT 441
             ++ V++P  L++E A FKC RVL  + + L E    +L+T+ + +GL S ++ TR++AT
Sbjct: 327  NQNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLAT 386

Query: 442  EIFVFLLEKKN--KKR------FESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNS 493
            E  ++L+ K    K R      F  V+ SL+    + QN HM   +       T   SN 
Sbjct: 387  ETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFST--NDSTDPESNP 444

Query: 494  NL----KVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLC 549
             L    K++Q WL+ VEQTLDGRGKMGSLVGAS++Y+N  GEN+I EY   ++V I+ LC
Sbjct: 445  QLYQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLC 504

Query: 550  SSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKK 609
             ++E++ +R ++R +L++ G+ RI+ K++LLDY  +   +  +E+  +DD+N+L++S K 
Sbjct: 505  LNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKF 564

Query: 610  NINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLM 669
              NVD+ DPVS+++ L  + KGTE E  L+S++Q++FL ++K   E  DP K  +QLKL+
Sbjct: 565  TENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLI 624

Query: 670  DSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLV 729
            DSL++NV++T+ +  SN N+AIQRLYDSMQTDE+ARRAILESR LTKKLEE++AERD L 
Sbjct: 625  DSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLN 684

Query: 730  EKLSKAEHGLVGQLEMEVKERDRILAKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXRKM 789
            +K+SKAE+GLVGQL+ E+ ERD IL K QRV                          RKM
Sbjct: 685  DKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKM 744

Query: 790  LTILNSRPAKTKEQKKKIGS----IEASEKEDLQRALQSGLQXXXXXXXXXXXXXGMTIQ 845
            LTI+NS+ +   E    + +    +    K  +Q  LQ  LQ             G  + 
Sbjct: 745  LTIVNSKTSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAVG 804

Query: 846  PNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKL 905
               RLK+LR +ME IEN+AR+LEMTNFA+     +KP     K+++   E  K Q+  KL
Sbjct: 805  SKSRLKLLRSKMEDIENQARELEMTNFAD-----VKP-----KQNQKFKEQVKGQQATKL 854

Query: 906  NELRDKLRRIQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDF 965
             ELR KL  IQ ESND++KFN++ RVNELF DKK  AL RLK+LE KY GF IDF  +  
Sbjct: 855  AELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDPE 914

Query: 966  THESTDSSNEGYSSLDPKVYQDKLDEITKISEELLQQKNELETTQTXXXXXXXXXXXXXX 1025
              E    S+ G  SLDP + Q K++E+  I +EL   K E++                  
Sbjct: 915  LKELLTQSSNGGPSLDPTIVQRKVEEMNSIIDELNALKEEMKN------RPKTGSSSSSS 968

Query: 1026 XXXXXXXALTNNKDINGTSSNVSDLAS--GSFLDTLTQKYGTGQAEPIQSPVGHY----- 1078
                   + + +      +S+ SD+ S   SFL++L+QKY TGQ     +  G       
Sbjct: 969  SSLSSASSSSEDGSSQSQASHGSDIVSNGSSFLESLSQKYSTGQQTATSTNGGRVGRETR 1028

Query: 1079 ---SNRNEKSFVDRMKRNS--------RVPSYVEELSKKMRGNKD 1112
               S  + KSF++R+K  +         +P ++ EL  K++   D
Sbjct: 1029 YPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSKVKMTDD 1073

 Score =  116 bits (291), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 123/217 (56%), Gaps = 26/217 (11%)

Query: 21  LFQNLRRLTTKDRDNRNKSPKRTSLDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKK 80
           LF NL++L T   ++ +  P +T    + IS  S K +  + ++ S    I  S+PLNK 
Sbjct: 29  LFSNLKKLATGG-NHGSSQPSQTR--KELIS--SPKRVFTTASLES-ATPIGGSKPLNKI 82

Query: 81  STLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINL 140
           S+LN+ NLS Y      + PE+ S         S  KYSYSRRSS              L
Sbjct: 83  SSLNTHNLSHYT-----MDPEANSRSQSASLLTSPTKYSYSRRSS-------------QL 124

Query: 141 TRHNTN--TSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNIL 198
           TR +TN     SSA  +S  S + L+RF+T DG + L  P +P E+  LF D++ KRN+ 
Sbjct: 125 TRSSTNKSIISSSAVSVSSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMDLLIKRNVF 184

Query: 199 QSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKAS 235
            S+  + Q ++++Y IEKKWL+VKQDLQ+EFKR+K++
Sbjct: 185 DSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRLKST 221

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  328 bits (842), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 177/482 (36%), Positives = 287/482 (59%), Gaps = 32/482 (6%)

Query: 1259 PRPQ----KKLKQLHWEKVESTDNSIWGS-QKAEKFADDLYEKGVLSELEKAFAAREIKS 1313
            P P+    KK+KQ+HWEK+E  +N+ W + Q+ E+   +L   G+  ++E  F  + +  
Sbjct: 810  PVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSV 869

Query: 1314 LATRKK---EDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIE 1370
            +  +KK      + ISFLS D++QQFGINLH++  L+ ++ V KVL+C+ D +   SV+E
Sbjct: 870  IMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLE 929

Query: 1371 FLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQS 1430
            F  K+E+  ++ +L R+  PYSTD+     +     P K+P+ELQRAD+I+L+L  NL+S
Sbjct: 930  FFCKEEMTHINPSLVRHLTPYSTDY-----MNPESVPTKNPDELQRADKIFLKLSFNLRS 984

Query: 1431 YWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSA 1490
            YW  R + + ++ +YE++Y +LL KL ++D A+  +  S+  KN+  +I+ +GNFMN   
Sbjct: 985  YWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--T 1042

Query: 1491 KQAKGFKLSTLQRLTFIK-DADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSI 1549
            +   G +LS L +L FIK + DN+++FL+Y+E+++R +Y +   F+ +L  V E+ K+S+
Sbjct: 1043 RPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISM 1102

Query: 1550 EQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEM 1609
            +Q+   C +F   I+ +  +I  G LSD  K HP D++L KV   ++ AR KGELL D  
Sbjct: 1103 DQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHF 1162

Query: 1610 KLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKK 1669
            KL+  +FE++M+ YGED  D  +K  FFQ F +F   +KK   +N++ EE E  Y + KK
Sbjct: 1163 KLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKK 1222

Query: 1670 MVEEQQRKAQE-DASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSA 1728
            ++E   RK  + D+   N +   T               +D LL QL+   + K +P   
Sbjct: 1223 IMEASTRKDSDVDSGTDNIDGENTA--------------VDSLLAQLRGVDK-KPEPLRT 1267

Query: 1729 RK 1730
            RK
Sbjct: 1268 RK 1269

 Score = 34.3 bits (77), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 101/212 (47%), Gaps = 32/212 (15%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYE 593
           I +Y    +  IN +    ++   +  +  +L+   +  ++  ++ +D   + +Q++L++
Sbjct: 339 ISDYFSSMLFLINSIVQGFQSFTTKKNILAELKRSEVYTLLYLLEDIDCNVIQEQVKLFK 398

Query: 594 NNKLDDFNALLESNKKNINVDLQDPV-SLMKNLLDACKGTENEKTLVSLVQHIFLPTSKL 652
           + +      +LE   +   V +  P  S+++ L +    T+ E  + SL+  I    +K 
Sbjct: 399 DTE----ENILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLDLILKSVNK- 453

Query: 653 LDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNM----------AIQRLYDSMQTDE 702
               +  ++ +K L+ M+S +       + + SN N           ++  L DS+Q+DE
Sbjct: 454 ----KTYSESSKLLQFMESFLQ-----YSLDNSNHNHYEHPETLFQESVNNLMDSLQSDE 504

Query: 703 VARRAILESRTLTKKLEEMEAERDMLVEKLSK 734
           +A+RA+LE       L+E +++ ++L  +L+K
Sbjct: 505 IAKRAMLE-------LDEKQSQMNILSNQLTK 529

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  322 bits (824), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 161/420 (38%), Positives = 275/420 (65%), Gaps = 13/420 (3%)

Query: 1264 KLKQLHWEKVESTDNSIWGSQKAEKFADD-LYEKGVLSELEKAFAAREI---KSLATRKK 1319
            KL+Q+HW+ +E    + W  ++  K     L E GV  E+E+ F  ++    K    +  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1320 EDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVE 1379
            ++L+K+SFLS D++QQFGINLHM+SN TV++ V KVL CE + +   SV+EF +K+++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1380 VSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAI 1439
            +S ++ +N+ PYST+      +   + P KD +EL+RAD+I+L+L  NL+SYW +RMR +
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1440 RMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLS 1499
             ++ +YE++Y ++L KL ++D A  +++ S  LK +  +I+ +GN+MN+  +QA+G KLS
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1500 TLQRLTFIK-DADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCND 1558
            +L +L F+K   +N+M+FL+Y+E+I+R+ Y +    + +L  +  + K++++Q+  DC +
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1559 FVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQ 1618
            F + I+N+ERS + G+LS +  FHP D ++ K    +  A++K  LL D+ KLT+ + E+
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1619 IMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKA 1678
            +M   GE+  D  AK +FFQ F DF++ +KKA  +NI+ EE E  YE+ KK++E ++R  
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKERSC 1270

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 113/229 (49%), Gaps = 38/229 (16%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIK-----LLD-----YE 583
           + +YC  T+  IN +   + +  ++ LL +K + CGI R+  K K     LLD     Y+
Sbjct: 317 LTDYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYK 376

Query: 584 KVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQ 643
           +V +++    + +L  F            +D+    S++K L+   + T  E  L  L++
Sbjct: 377 EVEEEVITRSSPELPTF------------LDISYG-SILKTLILETRSTPLEHPLYQLLE 423

Query: 644 HIFLPTSKLLDEKQDPNKVTKQLKLMDSLVT----NVSVTSTEEG--SNVNMAIQRLYDS 697
            +       +   +  ++  K  KL  S++     +   + + EG  S +  ++ ++ DS
Sbjct: 424 GVLQ-----ISVTRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDS 478

Query: 698 MQTDEVARRAILESRTLTKKLEEMEAERDMLVE--KLSKAEHGLVGQLE 744
           +Q+DE+ARRA+ E  +L + ++++ AE + L E  K++K E  ++ QLE
Sbjct: 479 LQSDEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGE--VIMQLE 525

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  320 bits (820), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 164/426 (38%), Positives = 268/426 (62%), Gaps = 15/426 (3%)

Query: 1259 PRPQ--KKLKQLHWEKVESTDNSIWGSQ-KAEKFADDLYEKGVLSELEKAFAAREI---K 1312
            P+PQ  K LKQ+HW+KVE+ DN+IW    +  +   +L    + +++E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1313 SLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFL 1372
            S   + KE     SFLS D++QQFGINLHMYSN T  +F++ VL C  + +   SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1373 SKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYW 1432
             K++++ +  +++RNYAPYS D+         + P KD +EL+RAD+++L+L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1433 ASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQ 1492
            A R + + ++ +YER+Y +L+ KL ++D A+  L  S   ++   ++L +GN+MN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1493 AKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQ 1551
             +G K+S+L +L FIK + +N+++FL+++EK++R+ YPE   F+ +L  V ++ KV++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1552 LVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKL 1611
            +  +C++F   +N+V  S+  G LS S K HP D +L KV   +S A+ K ELL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1612 TIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMV 1671
            T  +  +++  YGED  DK +  SFF    +F++ +KK   +NI+ EE E  YE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1672 EEQQRK 1677
            E Q +K
Sbjct: 1405 ESQSKK 1410

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 121/277 (43%), Gaps = 36/277 (12%)

Query: 485 YFTHLTS-----NSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQ 539
           Y T LTS     N  LK + A+L   E  ++ +      +      K  G +  I EY  
Sbjct: 307 YETVLTSLSPHFNQWLKGMTAYLTNPEDLIENKNSENHYI------KLIGFDKLIEEYLT 360

Query: 540 WTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYENNKLDD 599
             +  IN +     N  ++  L   L+  GI  I + +K L    + +QI +Y   + D 
Sbjct: 361 TCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQISIYSKIEQDI 420

Query: 600 FNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDP 659
             ++  +N   I+V   + + L   LL   + T  E+ +  L+  +    +K+L  +   
Sbjct: 421 ILSISNNNSMFIDVSYGNEIQL---LLSQSQKTPLEQPIGELLNFL----NKILTSRTQ- 472

Query: 660 NKVTKQLKLMDSLVTNVSV----------TSTEEGSNVNMAIQRLYDSMQTDEVARRAIL 709
              ++ +KL  S  + +            T     S V  +I  L D +Q+DE+ARRA+ 
Sbjct: 473 ---SESMKLFKSFGSTLGYLLDHFYKDNDTLLSPESTVQNSINELMDRLQSDEIARRAMN 529

Query: 710 ESRTLTKKLEEMEAERDMLVE--KLSKAEHGLVGQLE 744
           E ++L + ++ +++E   L E  +L K E  L+ QL+
Sbjct: 530 EMKSLEQIIDNLQSEISSLKEERQLDKGE--LIAQLK 564

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  314 bits (805), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 162/427 (37%), Positives = 272/427 (63%), Gaps = 15/427 (3%)

Query: 1259 PRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAF----AAREIKSL 1314
            P+   +LKQ+HWEKV+    ++W         D L ++GV S++EK F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1315 ATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSK 1374
            A  + +   KISFL+ DI+QQFGINLHMYS L+V +FV KVLKCE D +   SV+ F +K
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1375 QEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWAS 1434
            +++ ++ + L R +APYST++     + D  +PEKDP EL+RAD IYL+L  NL+SYW++
Sbjct: 934  EDLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1435 RMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK 1494
            R   + ++T+YER+Y +L+ KL ++D+A+  L  S  +K +  +I  +GN+MN  +    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1495 GFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLV 1553
            G KL++L +L+F+K + + +++FL++VE++VR ++P+   F  ++  V ++ KV++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1554 NDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTI 1613
             +C +F + + +V  S+  G LSD +K HP D +  K+   ++ A+ K ELL ++ +LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1614 MEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEE 1673
                ++M+ YGE+  DK +K +FF  F +F   +KK   +NI+ EE    YE+ K ++E+
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1674 QQRKAQE 1680
            + +K +E
Sbjct: 1226 RNKKIEE 1232

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 109/228 (47%), Gaps = 34/228 (14%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENC-GILRIMNKIKLLDYEKVIDQIELY 592
           ++EYC   M  +N +    ++  +++ +    EN      ++  I+ LD E    QI+ Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 593 ENNKLDDF--NALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIF--LP 648
            + KL+    N+ + S  ++++        ++ +L+   K T  E  L +L   +F  + 
Sbjct: 326 RDVKLEIMTRNSCVPSILEDVSYS-----QVLTDLVIQTKNTALESGLGNLFTLVFQVIH 380

Query: 649 TSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNM------AIQRLYDSMQTDE 702
           T KL       N+  K LKL+  LV  ++   T E S  N       AI  L D++Q+++
Sbjct: 381 TKKL-------NECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSED 433

Query: 703 VARRAILESRTLTKKLEEM---------EAERD--MLVEKLSKAEHGL 739
           + RRA++E +TL K + E+         EA  D   ++++L +AEH L
Sbjct: 434 LTRRAMVEIKTLEKNITELNSHIAELENEAHMDKRTIIQQLKQAEHML 481

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  314 bits (804), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 157/431 (36%), Positives = 266/431 (61%), Gaps = 13/431 (3%)

Query: 1260 RPQKKLKQLHWEKVESTDNSIWGSQ-KAEKFADDLYEKGVLSELEKAFAAREIKSLATRK 1318
            +P++ LKQ+HWEK+   + ++W  Q + ++   +L   G+ S++E++F  +E     T+ 
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1319 KEDLQKI---SFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQ 1375
            K+  +K    SFL  D++QQFGINLHM+S  +  QFV KVL+C+ + +   + +EF +++
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1376 EIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASR 1435
            ++V V+ +L R + PYSTD+      ED   P KDP EL R D+I+L+L  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1436 MRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKG 1495
               +  +T+YER+Y + + +L ++D  +  L+     K+I  +I+ +GN+MN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1496 FKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
             KLS+L +L F+K + D + +FL+++E+I+R  YP+   F  +L  V ++ K+S++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
            +CN+F   I+ V  +++ G LSD S+ HP D ++ K+   +  A+ K +LL D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            + +++M  +GED+ D  AK SFFQ F +F   +KK   +NI+ E+ +  YE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1675 QRKAQEDASKL 1685
            QR A    S L
Sbjct: 1210 QRTASNHNSDL 1220

 Score = 50.4 bits (119), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 100/218 (45%), Gaps = 22/218 (10%)

Query: 529 GG---ENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKV 585
           GG   E    ++   +++ +N +  +    +Q+  L + L+ CGI    + IK L  +  
Sbjct: 317 GGLKPEKCRADFMTTSLLVVNSILQALPTKDQKVSLMQTLKECGIHHCFHLIKQLQVDDT 376

Query: 586 IDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHI 645
             QI +Y    L+    L+E+      +D       +  LL   KGT  E+ L     H+
Sbjct: 377 DKQIAIY----LELETELIEATSAADQIDDSVYQPALHYLLSRTKGTLIEQDLA----HL 428

Query: 646 FLPTSKLLDEK--QDPNKVTKQL-KLMDSLVTNVS-VTSTEEGSNVNMAIQRLYDSMQTD 701
           F   +K+L  +   +  K+ + L  ++D L+ N     STE  S V  +I +  D+++++
Sbjct: 429 FESLNKILATRTTSESIKLFRSLGSILDYLIDNFCQAVSTEPASLVQESINKFLDNLESE 488

Query: 702 EVARRAILESR-------TLTKKLEEMEAERDMLVEKL 732
           E+ RRA+ E          L K+L E+   +D+  EKL
Sbjct: 489 EIGRRAMKEMTELENTIVVLRKELSELRDFKDISKEKL 526

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  313 bits (802), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/410 (39%), Positives = 257/410 (62%), Gaps = 15/410 (3%)

Query: 1264 KLKQLHWEKVESTDNSIWGSQKAE-KFADDLYEKGVLSELEKAF-----AAREIKSLATR 1317
            KLKQ+HW+K++    ++W   K     + +L   GV  E+E+ F     A +   ++ T 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1318 KKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEI 1377
            +     K++ LS+D++QQFGINL+++SN +V + VEKVL C+ + M   SVIEF SK +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1378 VEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMR 1437
              +  ++ R +APY T++    K      PEKD   L RAD+IYL+L  NL+SYWA R +
Sbjct: 935  NHIPQSIQRMFAPYETNYLTGDK------PEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1438 AIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFK 1497
             +  + +YE++Y ++L KL R+D    +++ S  LK +  +I+ VGN+MN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1498 LSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDC 1556
            LS+L +L F K + DN+++F++ +E IVR NYP+ + F+ +LE +L+V  + ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1557 NDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEF 1616
             +F + I+ +ERS+ +G LSDSSKFHP DK L+    N+S A KK +LL  +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1617 EQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYER 1666
            +++M  +GED  + F+K +FFQKF DF   +KKA  +NI+ E       R
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIEREVRRVCESR 1216

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  310 bits (793), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 162/429 (37%), Positives = 263/429 (61%), Gaps = 32/429 (7%)

Query: 1259 PRPQK-KLKQLHWEKVESTDNSIWG--------SQKAEKFADDLYEKGVLSELEKAFAAR 1309
            P  Q+ KLKQ+HW+K+++   ++W         S K E F       GV  E+E  F   
Sbjct: 765  PTSQRVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVV 817

Query: 1310 EIKSLATRKKEDLQ-----KISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMN 1364
                         Q     KI  LS+D++Q FGINLH++S+ +  + ++ VL C  + + 
Sbjct: 818  PATPKTASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQ 877

Query: 1365 TPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQL 1424
               VIEF SK +I  +  +  R +APY T++         K P+KDP  L+RAD+IYL+L
Sbjct: 878  NQRVIEFFSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLEL 931

Query: 1425 MVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGN 1484
              NL+SYWA+R + + ++ +YER+Y ++L KL R+D A  +++ S  LK +F +I+ +GN
Sbjct: 932  FYNLRSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGN 991

Query: 1485 FMNDSAKQAKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLE 1543
            +MN+  KQA G +LS++ +L F K + DN+++F++ +E+I+R+ YPE +NF  +LE V +
Sbjct: 992  YMNN--KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQD 1049

Query: 1544 VVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGE 1603
            +  + ++ +  +  +F + I+N+ERS+ +G LSDSS+FHP D+ L K   ++  ARKK E
Sbjct: 1050 MANIIVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAE 1109

Query: 1604 LLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAA 1663
            LL D+  LT+ +FE+++  +GED  D  ++ +FFQKF DF+A +KKA  +NI  E EE  
Sbjct: 1110 LLIDQSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENI--EREEIR 1167

Query: 1664 YERHKKMVE 1672
              + K+++E
Sbjct: 1168 RSQVKRVIE 1176

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 85/207 (41%), Gaps = 37/207 (17%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKI----KLLDYEKVIDQI 589
           I++YC  TM  IN +       + +  +   L + GI  I   I      L  E ++DQ+
Sbjct: 311 IIDYCVSTMFLINSIVQGQATYSDKRKILVLLNDAGIHTIFRIILRSGDRLSSEILLDQV 370

Query: 590 ELYENNKLDDFNALLESNKKNINVDLQDPV----SLMKNLLDACKGTENEKTLVSLV--- 642
             Y + +        E N K       +P     + +K ++   +GTE   ++  LV   
Sbjct: 371 SKYRSREA-------EINSKCATEGQIEPEKTFETQIKTIISLTQGTELGCSMAQLVDSV 423

Query: 643 -QHIFLPTS----KLLDEKQDPNKVTKQLKLMDSLVTNV---SVTSTEEGSNVNMAIQRL 694
            Q I   TS    KLL+  Q            D L+ N     + S EE   +  +I RL
Sbjct: 424 MQIITFRTSAEALKLLNLLQ---------ATFDHLLENYHKEQMPSVEEA--LRSSISRL 472

Query: 695 YDSMQTDEVARRAILESRTLTKKLEEM 721
            D +Q  +V RRA+ E   + +K+ EM
Sbjct: 473 MDDLQAQQVNRRAVQEMEEMKQKMIEM 499

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  312 bits (800), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/426 (37%), Positives = 269/426 (63%), Gaps = 23/426 (5%)

Query: 1259 PRPQKKLKQLHWEKVESTDNSIWG--SQKAEKFADDLYEKGVLSELEKAFAAREIK---- 1312
            P  + KLKQ+HW+K+E+   ++W    Q+  K + +L   G+  E+E+ F   EIK    
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSK-SSELESLGIFKEIEELF---EIKPAST 1215

Query: 1313 ----SLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSV 1368
                + A+  K    +IS LS +++Q+FGINLH++S  TV + V+KVL C+ + M    V
Sbjct: 1216 NLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKNQGV 1275

Query: 1369 IEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNL 1428
            +EF  K+E   V  ++ R + PY T++   ++      PEKDP EL+RAD+IYL+L  NL
Sbjct: 1276 LEFFCKEEANNVPQSIQRLFGPYETNYLTGER------PEKDPAELERADRIYLELFYNL 1329

Query: 1429 QSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMND 1488
            +SYWA+R   + +I+++ER+Y ++L KL R+D A  ++Q S+ LK +F +I+ +GN+MN 
Sbjct: 1330 RSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNYMNQ 1389

Query: 1489 SAKQAKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKV 1547
              K  +G +LS+L +L F K   DN+++F++ +E+IVR+ YP  ++F+  +  +  V  +
Sbjct: 1390 --KPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVEGINSITGVANI 1447

Query: 1548 SIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLAD 1607
             ++ +  + ++F   I N++RS+  G LSD SKFHP D+ L +    L++A+KK  LL D
Sbjct: 1448 IVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKARLLRD 1507

Query: 1608 EMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERH 1667
            +  LTI +FE++M  +GE+  +  +K +FFQKF DFI  ++KA  +N + EE +  YE+ 
Sbjct: 1508 QCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDRTYEKR 1567

Query: 1668 KKMVEE 1673
            ++++E+
Sbjct: 1568 RRLLEQ 1573

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  308 bits (790), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 162/477 (33%), Positives = 281/477 (58%), Gaps = 10/477 (2%)

Query: 1260 RPQKKLKQLHWEKVESTDNSIWGSQKAEK-FADDLYEKGVLSELEKAFAAREI-----KS 1313
            +P KKLKQ+HW+KVE  +++IW +++  +     L   GVL E+E  F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1314 LATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLS 1373
             AT      + +SFLS D++Q FGINLHM+SNL+V++FV+KVL C+ D +    V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1374 KQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWA 1433
            ++E+  +S++  R YAPY   +       +    E  P  L+R D+I+L+L   L+ YW+
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1434 SRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQA 1493
             R   + ++ +YE++Y +++ KL +++ A+  L+ S  L+N   +I+ +GN+MN   K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1494 KGFKLSTLQRLTFIKDADN-SMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQL 1552
             G K+S+L +L FIK +DN +++FL+Y+E+++R+ YP+   F+ +L+ V ++ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1553 VNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLT 1612
              +C++++  I  +  +++ G LSD +K +P D VL K+      A  K +LL  +MKL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1613 IMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVE 1672
              +  Q+M+ YGED  D   K  FF  FA+F+  +KK   +NI+ EE +  YE+ +K++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1673 EQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSAR 1729
            ++Q    +     +  +   G              +DKLL++L+   +    P   R
Sbjct: 1284 DKQSSRSKSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGKPRERR 1340

 Score = 33.1 bits (74), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 94/220 (42%), Gaps = 33/220 (15%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYE 593
           + ++    +  +N +  +S  +N +  + + L++ GI      +  +D   V +Q+++Y+
Sbjct: 322 VYDHLSTCLCLLNSILEASVALNVKYNILKSLKDAGIHNFFYSLDAIDSPLVFNQVKIYK 381

Query: 594 NNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLL 653
             +      +  +       +L    +LM  L++   GT  E ++  L Q        LL
Sbjct: 382 EKEEQALTKINATKNGPFLPNLVYGTTLML-LIEKSTGTPLEVSMGQLFQC-------LL 433

Query: 654 DEKQDPNKVTKQLKLMDSLVTNVS-----------------VTSTEEGSNVNMAIQRLYD 696
           D  ++    ++ L+L ++++  ++                 +T        N + + L D
Sbjct: 434 DILEN-RAYSESLRLFNAIIVLLTFFINKFTDSTRNATLPRITDDSLKPMFNESFENLMD 492

Query: 697 SMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAE 736
           S+Q+DEVA RA+        +LEE E +   L +KL K +
Sbjct: 493 SLQSDEVAARAM-------DQLEESEKKVSQLTDKLKKIQ 525

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  303 bits (777), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 154/420 (36%), Positives = 261/420 (62%), Gaps = 17/420 (4%)

Query: 1261 PQKKLKQLHWEKVESTDNSIWG--SQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRK 1318
            P+ KLKQ+HW+K++    ++W   SQ+  K + +L   G+  E+++ F            
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSK-STELASFGIFQEIDELFQLNPTSPAIANA 1016

Query: 1319 KEDL-----QKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLS 1373
              +L      K+S LS +++Q+FGINLH++S+ TV +   KVL C+ + +   SVIEF  
Sbjct: 1017 TANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFC 1076

Query: 1374 KQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWA 1433
            K+EI  +  ++ + +APYS ++         + P++DPNEL RAD+IYL+L  NL+SYW 
Sbjct: 1077 KEEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLRSYWG 1130

Query: 1434 SRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQA 1493
            +R + + +I +++++Y ++L KL R+D A  +LQ S  LK +F +I+ +GN+MN   +  
Sbjct: 1131 ARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPV 1188

Query: 1494 KGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQL 1552
             G +LS+L +L F K + DN+M+F++ +E+IVR  YP  ++F+  L+ +LEV  + ++ +
Sbjct: 1189 AGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHV 1248

Query: 1553 VNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLT 1612
              + ++F   I ++ER   IG LSD S+FHP DK +LK    +  A+KK +LL D+  LT
Sbjct: 1249 QQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLT 1308

Query: 1613 IMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVE 1672
            + +FE++M  +GE+  +  +K SFF+KF DFI  ++KA  +N + EE    YE+ ++ +E
Sbjct: 1309 MSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRALE 1368

 Score = 56.6 bits (135), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 135/286 (47%), Gaps = 38/286 (13%)

Query: 501 WLFAVEQTLDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTL 560
           WL AVE T+    +    V +     N   +  +++YC  TM  IN L         ++ 
Sbjct: 289 WLEAVETTIKDETQWHDDVPS-----NQKPQQLMIDYCVSTMFLINSLIQGIPTYRGKSR 343

Query: 561 LRRKLENCGILRIMNKI----KLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQ 616
           L R L++ GI RI ++I    +  D E ++D+I  Y++ + +  +  +     ++NV  +
Sbjct: 344 LIRLLKDAGIHRIFHRIVSSGEKFDSEILLDEISKYQSREGEINSKFVIDTPTHLNVSFK 403

Query: 617 DPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNV 676
              S +K ++   +GT  E  +  ++  I     + +   +   + TK L+L  S+   +
Sbjct: 404 ---SQIKTIVTLTQGTSLESYMTLVLDSI-----RQIVTSRTSAEATKLLQLFQSIFKYL 455

Query: 677 SVTSTEE---GSNVNM--AIQRLYDSMQTDEVARRAILESRTLTKKLEEM---------- 721
              S E+   G+ + +  ++ +L D +Q+ +V +RA+ E   +  K+EEM          
Sbjct: 456 IEHSYEDEELGTEIALQASLNKLMDDLQSKQVNQRAVQELEEMKVKMEEMKRVIAKLEHQ 515

Query: 722 -EAERDMLVEKLSKAEHGLVGQLEM--EVKER---DRILAKNQRVM 761
            E  + ++ ++L+  +  L  +L+   E++ER     IL KN+R++
Sbjct: 516 KEIAKSVIAKELNATKAALSIKLDYITELEERLESVEILRKNERMI 561

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  301 bits (772), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/491 (34%), Positives = 278/491 (56%), Gaps = 46/491 (9%)

Query: 1259 PRPQKKLKQLHWEKVESTDNSIW--GSQKAEKFADDLYEKGVLSELEKAFAAREIKSLAT 1316
            P P+++LKQ+HW++VE   +++W    Q+ E   + L   GV S++E  F  R    +A+
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRE-LQTDGVFSQIEDIFKMRSPAKIAS 929

Query: 1317 RKKE---------------DLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERD 1361
            +                  +L+K+SFLS D++QQFGINLHM+S L+  +FV KVL C+ D
Sbjct: 930  KNNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDND 989

Query: 1362 FMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIY 1421
             +   ++++F  K+E+  +  +L   Y PYS   EG           K  ++LQRAD+I+
Sbjct: 990  IIQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIF 1038

Query: 1422 LQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILA 1481
            L+L +NL+SYW  R + +  +++YER+Y +LL KL ++D  +  L  S   KN+  +I  
Sbjct: 1039 LELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITE 1098

Query: 1482 VGNFMNDSAKQAKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEP 1540
            +GN MN   K  KG KL +L +L F++ + D +M+FL+++EKI+R  YP+   F+ +L+ 
Sbjct: 1099 IGNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKK 1156

Query: 1541 VLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARK 1600
            + ++ K+S+E +  +C++F   I N+    + G LS      P D+++ KV   ++ A+ 
Sbjct: 1157 IEDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKI 1216

Query: 1601 KGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEE 1660
            K ELL  + KLT+++  ++M+ YGED  DK +K  FFQ F +F+A +KK   +NI+ EE 
Sbjct: 1217 KSELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEM 1276

Query: 1661 EAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQ 1720
            E  YE+ K ++E           + N N    GN           AV D L+ +L+   +
Sbjct: 1277 ERVYEQRKSLLE----------MRTNNNKKSNGNDENEGEEVNTDAV-DLLISKLR---E 1322

Query: 1721 VKTDPTSARKR 1731
            VK DP   R+R
Sbjct: 1323 VKKDPEPLRRR 1333

 Score = 43.1 bits (100), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 97/183 (53%), Gaps = 30/183 (16%)

Query: 585 VIDQIELYENNKLDDFNALLESNK--------KNINVDLQDPVSLMKNLLDACKGTENEK 636
           +++QI+ ++  +   F++++++++        KN+  +   PV +   LL   K +  E 
Sbjct: 388 IMEQIKQFKTKESSIFDSMIQTSRDMKATPSMKNVTEEEGAPVCIENCLLLKVKDSPIET 447

Query: 637 TLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVS-------VTSTEE----GS 685
            +  ++Q ++    K+LD K+  ++  K LKL++SL+  +         +S +E      
Sbjct: 448 PINEIIQSLW----KILDSKKPYSESIKLLKLINSLLFYLIDSFQAPICSSFDENLDLAQ 503

Query: 686 NVNMAIQ----RLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVG 741
           NV+   Q    +L DS+Q++E+ARRA+ E   L  K+ ++  E+  LVE  SK +H L+ 
Sbjct: 504 NVDSVFQDSVNKLLDSLQSNEIARRAVTEIDDLNNKILDLN-EKLNLVENYSK-DH-LIA 560

Query: 742 QLE 744
           +L+
Sbjct: 561 KLD 563

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  301 bits (772), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 174/492 (35%), Positives = 282/492 (57%), Gaps = 47/492 (9%)

Query: 1259 PRP-QKKLKQLHWEKVESTDNSIW--GSQKAEKFADDLYEKGVLSELEKAFAAREIKSLA 1315
            P P +K+LKQ+HW+KVE   +++W  G Q+ E     L   G+ S++E  F  +    +A
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRG-LQTDGIFSQIEDIFKMKSPTKIA 928

Query: 1316 TR---------------KKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCER 1360
             +                  +L+KISFLS D++QQFGINLHM+S L+  +FV KVLKC+ 
Sbjct: 929  NKTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDN 988

Query: 1361 DFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQI 1420
            D +   ++++F  K+E+V +  +L   Y PYS       + E+ KA     ++LQRAD+I
Sbjct: 989  DIVQNVNILKFFCKEELVNIPKSLLNKYEPYS-------RGENGKAA----SDLQRADRI 1037

Query: 1421 YLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVIL 1480
            +L+L +NL+ YW  R +++  +++YER+Y +L+ KL  +D  +  L  SD  KN+  +I 
Sbjct: 1038 FLELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIIT 1097

Query: 1481 AVGNFMNDSAKQAKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELE 1539
             +GN MN   +  KG KL +L +L F++ + D +M+FL+++EKI+R  YP+   F+ +L+
Sbjct: 1098 EIGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLK 1155

Query: 1540 PVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEAR 1599
             V ++ K+S+E +  +C++F   I N+    + G LS+     P D+++ KV   ++ AR
Sbjct: 1156 KVEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAR 1215

Query: 1600 KKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEE 1659
             K ELL D+ KLT+++  ++M+ YGED  DK +K  FFQ F +F+  +KK   +NI+ EE
Sbjct: 1216 IKSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEE 1275

Query: 1660 EEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAG 1719
             E  YE+ K ++E           + N N    GN           AV D L+ +L+   
Sbjct: 1276 MERVYEQRKNLLE----------MRTNGNKKCDGNDENEGEEVNTDAV-DLLISKLR--- 1321

Query: 1720 QVKTDPTSARKR 1731
            +VK DP   R+R
Sbjct: 1322 EVKKDPEPLRRR 1333

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 89/173 (51%), Gaps = 28/173 (16%)

Query: 585 VIDQIELYENNKLDDFNALLESN--------KKNINVDLQDPVSLMKNLLDACKGTENEK 636
           +++QI+ ++  +   F++++++          KNI     +PV L K LL   K +  E 
Sbjct: 387 IMEQIKQFKAKETSIFDSMIQTRNDMNPLHPAKNITNPEGEPVCLEKCLLLKAKDSPVET 446

Query: 637 TLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLV----------TNVS----VTSTE 682
            +  ++  ++    K+LD ++  ++  K LKLM+SL+          TN S    + S E
Sbjct: 447 PINEIIHSLW----KILDSQRPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAE 502

Query: 683 EGSNVNM-AIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSK 734
              +V   ++ +L DS+Q+DE+ARRA+ E   L KK+  +  + D LVE  SK
Sbjct: 503 NADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKISHLNEKLD-LVENCSK 554

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  299 bits (765), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 263/420 (62%), Gaps = 16/420 (3%)

Query: 1260 RPQKKLKQLHWEKVESTDNSIW-GSQKAEKFADDLYEKGVLSELEKAF-----AAREIKS 1313
            +P++ LKQ+HWEK++  + ++W  +++ E+   +L   G+  +++  F       +++K+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1314 LATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLS 1373
              + KK   Q  SFLS D++QQFGINLHMYS   V +FV KVL+C+ D +   SV+EF +
Sbjct: 908  DNSTKKTT-QLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1374 KQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWA 1433
             +E+  +  +L+R++APYS D++      + K+P  DPNEL+R D+I+L+L  NL+SYW 
Sbjct: 967  NEELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYWR 1020

Query: 1434 SRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQA 1493
             R + + +  +YER+Y +L+ KL  +D A+  ++ +  LK +  +I+ +GN+MN   K  
Sbjct: 1021 ERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNV 1078

Query: 1494 KGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQL 1552
             G +L++L +L+F+K + DN+++FL+++EK+VR  YP+  +F  +L     +  +S + +
Sbjct: 1079 SGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHI 1138

Query: 1553 VNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLT 1612
             ++C ++   +N+V R    G LS  S  HP D+++ KV   ++ A+ K +LL D+ KL 
Sbjct: 1139 QSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLI 1198

Query: 1613 IMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVE 1672
              + +++M+ +GE+  DK AK SFF  F +F   +KK   +NI+ EE    YE+ KK+++
Sbjct: 1199 SADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  295 bits (755), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/423 (35%), Positives = 263/423 (62%), Gaps = 16/423 (3%)

Query: 1262 QKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYE---KGVLSELEKAFAAREI---KSLA 1315
            +KKLKQ+HW+K+E+  N++W    A+   D + E    G+  +++  F+ +++      A
Sbjct: 856  KKKLKQIHWDKIENVKNTLWD--HADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRA 913

Query: 1316 TRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQ 1375
               +E  + +SFLS D SQQ  INLH+++ LT  + ++KVL C+ D +   SV+EF  K 
Sbjct: 914  VNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKD 973

Query: 1376 EIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASR 1435
            E+V + +   R++ PYS D+     +  ++ P K+P+EL+RAD+++L L  NL+ YWA R
Sbjct: 974  EMVNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAER 1028

Query: 1436 MRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKG 1495
             + + +I++YEREY ++L  L ++D A+ +++ S+  K    +I+ +GN+MN   K  +G
Sbjct: 1029 SQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEG 1086

Query: 1496 FKLSTLQRLTFIKDADN-SMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVN 1554
             +L++L +L FIK  DN + +FL++VEK++R +YP+   F+ +L  V ++ K++I+Q+  
Sbjct: 1087 IRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQL 1146

Query: 1555 DCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIM 1614
             C ++   I  +  S+  G LSD ++ HP D++L KV   ++ A+ K ELL  + KLT  
Sbjct: 1147 QCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNN 1206

Query: 1615 EFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQ 1674
            +F + M  YGED  D   KI+FF +F +F + ++K   +NI+ EE + AYE+ KK+ E +
Sbjct: 1207 DFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIAELR 1266

Query: 1675 QRK 1677
             +K
Sbjct: 1267 NKK 1269

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  295 bits (756), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 161/428 (37%), Positives = 262/428 (61%), Gaps = 17/428 (3%)

Query: 1263 KKLKQLHWEKVESTDNSIWGSQKA-EKFADDLYEKGVLSELEKAF---AAREIKSLATRK 1318
            ++LKQ+HW+K+E    +IW  ++     A  L E G+L E+   F    +   K+   R 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1319 KEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIV 1378
             E+   ++ L  D++QQFGINLHM+SNL+V  FV KVL C+R  +   SV+EF ++ ++V
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1379 EVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRA 1438
             +  +L+  + PYS+D+         K P KD ++L+RAD+I+L L  NL+SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1439 IRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKL 1498
            +  + +YE++Y +++ KL RVD A+  ++ S  LK+   +I+ +GN+MN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1499 STLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCN 1557
            S+LQ+L F+K + D +++FL+ VE+ +R        F+ EL  VL++  + + Q+  D  
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1558 DFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFE 1617
            ++++ I+ V++S++ G LSDS  FHP D++L+KV P ++ A +K  LL ++ KLT+   E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1618 QIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRK 1677
             +M+ YGED+     +  FF  F  FI ++KKA  +NI+ EE E  Y  H+K + +Q+ K
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYN-HRKELLQQKTK 1328

Query: 1678 A--QEDAS 1683
            A  + DAS
Sbjct: 1329 ASSKNDAS 1336

 Score = 42.0 bits (97), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 111/241 (46%), Gaps = 21/241 (8%)

Query: 528 AGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVID 587
           A  +  + +YC  ++  IN +   + ++ ++    ++L+   I R+   +  L++ ++  
Sbjct: 340 ARPQQMLRDYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEI-- 397

Query: 588 QIELYENNKLDDFNALLESNKKNINVDLQD--PVSLMKNLLDACKGTENEKTLVSLVQHI 645
                 + ++D + +L E   +  N +      VS  K L +    T ++  L   +  +
Sbjct: 398 ------DGEIDKYKSLEEEVIQKTNPEFPQLLNVSYGKFLTNIIHQT-HQNPLEHCMHQL 450

Query: 646 FLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEE-----GSNVNMAIQRLYDSMQT 700
           F   SK L  +   + + K L L  S++  +   S  E      S VN+++  L D +Q+
Sbjct: 451 FETLSKTLVARTMSDNL-KVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQS 509

Query: 701 DEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRV 760
           DE+A+RA+ E     K++E +E+E    +  L K +    G +  E+++  + LA+ +  
Sbjct: 510 DEIAKRAMSELELAQKEIENLESE----IRALRKDKEITKGGVLSELRQTQQALAEKETA 565

Query: 761 M 761
           +
Sbjct: 566 I 566

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  292 bits (748), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 164/481 (34%), Positives = 277/481 (57%), Gaps = 28/481 (5%)

Query: 1257 NYPRPQKKLKQLHWEKVESTDNSIWGSQKAEK-FADDLYEKGVLSELEKAFAAREI---K 1312
            N  +  KKLKQ+HW +V     +IW     ++    +L   GV   ++ +F  +++   K
Sbjct: 1135 NIQKEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKK 1194

Query: 1313 SLATRKKEDLQKI-SFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEF 1371
            +    K +D Q++ SFLS D++QQFGINLH++++  V++ +EKVL+C+ D     +++EF
Sbjct: 1195 NTDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEF 1254

Query: 1372 LSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSY 1431
             +K+E   +S ++ARNYAPY  D++            KD +EL+RAD+I+L+L  NL++Y
Sbjct: 1255 FNKEEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAY 1308

Query: 1432 WASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAK 1491
            WA R + + ++ +YE++Y +L+ KL R+D AV  L  S   K    ++L +GNFMN   K
Sbjct: 1309 WAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KK 1366

Query: 1492 QAKGFKLSTLQRLTFIKDADNS-MTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIE 1550
             A+G  +S+L +L FIK ++N+ ++FL+++EK +R+ +PE   F+ +L  V E+  VS++
Sbjct: 1367 PAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLD 1426

Query: 1551 QLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMK 1610
             +  +C +F   +N    ++  G LS     HP D++L KV   +S+A+ K   L D+  
Sbjct: 1427 HITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQI 1486

Query: 1611 LTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKM 1670
            LT     ++++ YGED  D+ +K  FF+  A+F   +KK   +NI  EE E  YE+ K M
Sbjct: 1487 LTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYM 1546

Query: 1671 VEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARK 1730
            ++          +KL +N+S +G+             +DKLL +L+    V+  P   R+
Sbjct: 1547 LD----------NKLQKNNS-SGDDSDLEKNTENDDAVDKLLLKLRG---VENKPEPLRR 1592

Query: 1731 R 1731
            R
Sbjct: 1593 R 1593

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  288 bits (738), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 157/490 (32%), Positives = 288/490 (58%), Gaps = 44/490 (8%)

Query: 1259 PRPQKKLKQLHWEKVESTDNSIW-GSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATR 1317
            P  +K+LKQ+HW+KVE   +++W  + + ++   +L   G+ S++E  F  +    +A +
Sbjct: 872  PPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANK 931

Query: 1318 K---------------KEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDF 1362
            +                 +L+KISFLS D++QQFGINLHM+S L+  +FV KVL C+ D 
Sbjct: 932  RNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 991

Query: 1363 MNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYL 1422
            +   ++++F  K+E+V +  ++   Y PYS   +G           K  ++LQRAD+I+L
Sbjct: 992  VQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRIFL 1040

Query: 1423 QLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAV 1482
            +L +NL+ YW +R +++  +++YER+Y +L+ KL ++D A+  L  S   K++  +I  +
Sbjct: 1041 ELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEI 1100

Query: 1483 GNFMNDSAKQAKGFKLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPV 1541
            GN MN   +  KG KL +L +L F++ + D +++FL+++EK++R  YP+   F+ +L+ +
Sbjct: 1101 GNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNI 1158

Query: 1542 LEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKK 1601
             ++ K+S+E + ++C++F + I ++    ++G LS      P D+++ KV   ++ A+ K
Sbjct: 1159 EDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTK 1218

Query: 1602 GELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEE 1661
             ELL  + KLT+++  ++M+ YGED  DK +K  FFQ F +F+A +KK   +NI+ EE E
Sbjct: 1219 SELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEME 1278

Query: 1662 AAYERHKKMVEEQQRKAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQV 1721
              YE+ K ++ + +  + + ++  +EN  +  N             +D L+ +L+   +V
Sbjct: 1279 RVYEQRKSLL-DMRTSSNKKSNGSDENDGEKVNRD----------AVDLLISKLR---EV 1324

Query: 1722 KTDPTSARKR 1731
            K DP   R+R
Sbjct: 1325 KKDPEPLRRR 1334

 Score = 47.0 bits (110), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (49%), Gaps = 27/143 (18%)

Query: 617 DPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLV--- 673
           +P+ L   LL   K +  E  +  ++Q ++    K+LD ++  ++  K LKL++SL+   
Sbjct: 427 EPLCLENCLLLKAKDSPVEAPINEIIQSLW----KILDSQKPYSESIKLLKLINSLLFYL 482

Query: 674 -------TNVSVTST-EEGSNVNMAIQ----RLYDSMQTDEVARRAILESRTLTKKLEEM 721
                  TN S   T E   NV+   Q    +L DS+Q+DE+ARRA+ E   L  K+  +
Sbjct: 483 IDSFQVSTNPSFDETLESAENVDYVFQDSVNKLLDSLQSDEIARRAVTEIDDLNAKISHL 542

Query: 722 EA--------ERDMLVEKLSKAE 736
                     ++D L+ KL ++E
Sbjct: 543 NEKLNLVENHDKDHLIAKLDESE 565

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  288 bits (736), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 263/421 (62%), Gaps = 18/421 (4%)

Query: 1264 KLKQLHWEKVESTDNSIWGSQKAEK--FADDLYEKGVLSELEKAFAAREIKSLATRKKED 1321
            KLKQ+HW+K+E    +IW SQ+ E+   A  L   G L E+ + F  R  +SL  + K +
Sbjct: 920  KLKQIHWDKLEDVSETIW-SQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSE 976

Query: 1322 LQ----KISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEI 1377
                  K+S L  D++QQFGINLHM+SNL+V++FV KVL C+RD +N  SV+EF +++++
Sbjct: 977  TSSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDL 1036

Query: 1378 VEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMR 1437
              +  ++A    PY+TD +        +AP  D  +L+RAD+I+L+L  NL+SYW  R  
Sbjct: 1037 SIIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSL 1090

Query: 1438 AIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFK 1497
             +  +++YE++Y +L+ KL RVD A+  ++ S  LK+   +I+ +GN+MN   KQA G +
Sbjct: 1091 CLLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIR 1148

Query: 1498 LSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDC 1556
            LS+LQ+LTF+K + D +M+ L+ VE+ +R        F+ +L  VL++  + + Q+  D 
Sbjct: 1149 LSSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDF 1208

Query: 1557 NDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEF 1616
            +++ Q I+ V++S+E G LS    FHP D++L+KV P ++ A +K  LL ++  LT+   
Sbjct: 1209 HEYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRAL 1268

Query: 1617 EQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQR 1676
            E +M+ YGED  +  +K  FFQ F +F++++KK   +N + E  E  Y + K++++ + +
Sbjct: 1269 ENLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSK 1328

Query: 1677 K 1677
            +
Sbjct: 1329 E 1329

 Score = 35.0 bits (79), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 43/65 (66%)

Query: 685 SNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLE 744
           S +++++ +L D++Q+DE+A RA+ E +T    ++++ +E  +L ++ S ++  ++ +LE
Sbjct: 494 SVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSELE 553

Query: 745 MEVKE 749
              KE
Sbjct: 554 KIKKE 558

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  280 bits (717), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/475 (33%), Positives = 272/475 (57%), Gaps = 29/475 (6%)

Query: 1261 PQKKLKQLHWEKVESTDNSIW-GSQKAEKFADDLYEKGVLSELEKAFAARE--IKSLATR 1317
            P K +KQ+HWEKV  T  S+W    +      +L   G+ SE+E  F +++  IK    +
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1318 KKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEI 1377
             +   + ++ L  +++QQFGINLHM+S ++     EKVL+C+       SVIEF + +++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1378 VEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMR 1437
              + +N+ R + PYS D++          P KD +EL R D I+L L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKT-----PGSKPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1438 AIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFK 1497
             + M+ +YE++Y +L+ KL R+D+A+ +++ S  LK++  +I+A+GNFMN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1498 LSTLQRLTFIK-DADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDC 1556
            LS+L +LT+IK ++++  +FL+++E+++R  YPE   F  +L  V  +  V+++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1557 NDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEF 1616
            +D    IN V RSI+ G LS+    HP D +L KV   +  A  K  +L D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1617 EQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQR 1676
            E+++  +GED  D   KI+FF+  ++F+  ++K   +NI+ EE +  YE+ +++++  + 
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDS-KI 1377

Query: 1677 KAQEDASKLNENSSQTGNXXXXXXXXXXXAVMDKLLEQLKNAGQVKTDPTSARKR 1731
            +AQ D+S       Q                +D+LL++L+   Q    PT+A +R
Sbjct: 1378 QAQWDSSMDEIEEDQQD-------------AVDQLLKKLRGVEQ----PTTAVRR 1415

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  279 bits (713), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 144/436 (33%), Positives = 270/436 (61%), Gaps = 16/436 (3%)

Query: 1255 FENYPRPQ-KKLKQLHWEKVESTDNSIWGSQKAEK-FADDLYEKGVLSELEKAFAAREI- 1311
            F + P+P+ K LKQ+HW+K+E   +++W          +DL EKGV +E+   F  + + 
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1312 ---KSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSV 1368
               KS  T  K++ +K+S LS D++QQFGINLHM+S+ +V   + KVL+C+ D +   SV
Sbjct: 852  MKKKSNVTASKKN-EKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSV 910

Query: 1369 IEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNL 1428
            +EF +K +   +  ++ R++ PY++DW+        KAP++D ++L+RAD+IYL++  N+
Sbjct: 911  LEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNM 964

Query: 1429 QSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMND 1488
            + YW  R  ++ +  +YE++Y ++L +L ++D     ++ S+ LK  F +++ +GNFMN+
Sbjct: 965  RYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN 1024

Query: 1489 SAKQAKGFKLSTLQRLTFIK-DADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKV 1547
              K+ +G KLS+L +L+ +K ++D +++FL+ +E+I+R  YP+  +F  +L  + ++ K+
Sbjct: 1025 --KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKI 1082

Query: 1548 SIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLAD 1607
            +IE + ++ +++ + I  ++ S E G LS + K HP DK   K+   L  A +K ELL +
Sbjct: 1083 NIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHN 1142

Query: 1608 EMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERH 1667
            + KLT+ +F   M+  GED  +  AK +FF+ F++F+  + K   +N + E     +E+ 
Sbjct: 1143 QCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQR 1202

Query: 1668 KKMVEEQQRKAQEDAS 1683
            ++++++   + Q + S
Sbjct: 1203 QQLLQKASTETQVEKS 1218

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  279 bits (714), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/423 (34%), Positives = 257/423 (60%), Gaps = 28/423 (6%)

Query: 1264 KLKQLHWEKVESTDNSIW--GSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKED 1321
            +LKQ+HW+KVE   +++W   +Q+ E   + L   G+ S++E  F  ++   +A++K  +
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKE-LQTDGIFSQIEDIFKMKDPVKIASKKNGN 939

Query: 1322 LQK-----------ISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIE 1370
                          +SFLS D++QQFGINLHM+S ++  +FV+KVL C+ + +   ++++
Sbjct: 940  SSTSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILK 999

Query: 1371 FLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQS 1430
            F  K+E+V +  ++   Y PYS   +G K + D          LQRAD+I+L+L +NL+S
Sbjct: 1000 FFCKEELVSIPKSMLSKYEPYSQG-KGGKSVSD----------LQRADRIFLELCINLRS 1048

Query: 1431 YWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSA 1490
            YW +R +++  +++YER+Y +L+ KL ++D  +  L  S   K++  +I  +GN MN   
Sbjct: 1049 YWNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--K 1106

Query: 1491 KQAKGFKLSTLQRLTFIKD-ADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSI 1549
            K  KG KL +L +L F++  AD +++FL+++EK++R+ YP+   F+ +L+ + ++ KVS+
Sbjct: 1107 KMVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSL 1166

Query: 1550 EQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEM 1609
            E +  +C +F   +       + G LS+     P D+++ KV   ++ A+ K +LL D+ 
Sbjct: 1167 EHVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQC 1226

Query: 1610 KLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKK 1669
            KLT+++  ++M+ YGED  DK +K  FFQ F +F+A +KK   +NI+ EE E  YE+ K 
Sbjct: 1227 KLTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKN 1286

Query: 1670 MVE 1672
            ++E
Sbjct: 1287 LLE 1289

 Score = 41.6 bits (96), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 23/135 (17%)

Query: 618 PVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNV- 676
           PV L K LL   K +  E  +  +V  ++    K+LD ++  ++  K L+L++SL+  + 
Sbjct: 430 PVCLEKCLLLKAKDSPVETPINEIVNALW----KILDSQRPYSESIKLLRLINSLLFYLI 485

Query: 677 -------------SVTSTEEGSNVNMAIQ----RLYDSMQTDEVARRAILESRTLTKKLE 719
                        ++   +   NV+   Q    +L DS+Q+D++ARRA++E   L  K+ 
Sbjct: 486 DSFQVPLNASFDEALDQPQNTQNVDSVFQDSIDKLLDSLQSDDIARRAVIEIDDLNCKIS 545

Query: 720 EMEAERDMLVEKLSK 734
            +  ER  LVE  SK
Sbjct: 546 TLN-ERISLVENYSK 559

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  273 bits (698), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/417 (34%), Positives = 249/417 (59%), Gaps = 27/417 (6%)

Query: 1264 KLKQLHWEKVESTDNSIW-GSQKAEKFADDLYEKGVLSELEKAFAAREIK------SLAT 1316
            +LKQ+HWEKVE  ++++W  S + E+ A +L   G+  ++   F  + IK      + A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1317 RKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQE 1376
            +K    Q  + L  +++QQFGINLHM+S+L  ++FVEKVL+C  D ++  SV+EF +K+E
Sbjct: 912  KK----QNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1377 IVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRM 1436
            +  + T+L + + PY+   E IK             EL+RAD+I+ +L   L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENIK----------SKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1437 RAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGF 1496
              + ++ +YE++Y +L+ KL +VD  +  L  S   ++   +I+ +GN+MN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1497 KLSTLQRLTFIKDA-DNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVND 1555
            ++ +L +L F+K + DN+++FL+++EKI+R  YP+  +F+ EL  + ++ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1556 CNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIME 1615
              +F   IN +   +E G LS + +  P D++L K    +  A+ K EL+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1616 FEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVE 1672
            + +IM+ +GED  D+ +K +FF    +FI  +KK   +NI+ EE E  YE+ +KM +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 43.1 bits (100), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 108/221 (48%), Gaps = 17/221 (7%)

Query: 534 ILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELYE 593
           I EY    M  IN +       N++  +  KL++  + ++  ++  LD + + +QI  Y+
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 594 NNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLL 653
            N  +    ++  N  +I  D+    +LM  L++  K T  E+ + +L+  +     K+L
Sbjct: 383 KNDENIRLKIINENPLSIP-DISYGATLML-LIEKSKSTPLEEPIGALLDSVL----KIL 436

Query: 654 DEKQDPNKVTKQLKLMDSLVTNV-----SVTSTEEGSN-----VNMAIQRLYDSMQTDEV 703
           D +     + K    + SL+T +     S  S+ E +N     +  +I+RL D++++DEV
Sbjct: 437 DTRTYSESI-KLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLESDEV 495

Query: 704 ARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLE 744
           ARRA+ E R     ++++  E   L  + + ++  ++ QLE
Sbjct: 496 ARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

>CAGL0B04477g Chr2 complement(437357..438208) [852 bp, 283 aa] {ON}
           similar to uniprot|Q12057 Saccharomyces cerevisiae
           YOR104w PIN2
          Length = 283

 Score = 35.4 bits (80), Expect = 1.1,   Method: Composition-based stats.
 Identities = 38/152 (25%), Positives = 60/152 (39%), Gaps = 30/152 (19%)

Query: 65  SSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPES-------------------GSN 105
           SS++   D+S  LN +  L SQNL         LSP+                    G  
Sbjct: 140 SSKNTVYDESIELNDRYDLESQNLQGRSRKQTHLSPQRMPLTMETERFDGRDELSVYGGY 199

Query: 106 HHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSR 165
           HHR  ST      SY          +PS        R + +T+++S+S L  G   + S 
Sbjct: 200 HHRGQSTSDVSDISYEMEPFPPAQQSPSR-------RQHLSTNYNSSSNLVSGGRGSRSS 252

Query: 166 FMTPDGK-INLTMPSDPYEVESLFEDIMYKRN 196
             +P  + +    P+D    +S +E+ +Y+ N
Sbjct: 253 HTSPVRQPVRAPYPADN---DSYYEENVYRNN 281

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 620 SLMKNLLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNK-------VTKQLKLMDSL 672
           SL   LL   +G+E EK   +L  H   P +    + + P+        +T  ++++D  
Sbjct: 385 SLYYPLLGCDQGSECEKDTFALAAHALYPDTPKYYQVKTPSAHEGHWENITTGVRILDE- 443

Query: 673 VTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRA 707
              ++ T+++EG         LYD ++  E AR A
Sbjct: 444 --ELASTNSDEGKTFRKVAMLLYDYIEDTEFARLA 476

>KAFR0E02550 Chr5 complement(522127..525453) [3327 bp, 1108 aa] {ON}
           Anc_8.426 YDR217C
          Length = 1108

 Score = 34.3 bits (77), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 16/111 (14%)

Query: 328 HYVKKIVDD----KLSKDEMKDLWVTLRTEQLDWVDAFL-ENQGHIAMANILMKSIYKTT 382
           HY +  +DD    K  +DE  DL ++   E+       L E  G I + N        ++
Sbjct: 763 HYARNTIDDQALKKEGEDEAADLALSHMQERTKTPSKLLAEPSGSITLKN-------SSS 815

Query: 383 PKDKVSEPLLDKENAFFKCFRVLAVLSQGLHEFT--IHSLMTDTIAQGLFS 431
           PK  +  P  +K   F KC  VL  +S+  ++ +  I SL  D I + L S
Sbjct: 816 PKPII--PTTEKREVFAKCLFVLTTVSENKNKLSEMIKSLGGDVIEEDLSS 864

>TPHA0A02640 Chr1 (566643..569120) [2478 bp, 825 aa] {ON} Anc_1.151
           YCR030C
          Length = 825

 Score = 33.9 bits (76), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 91/184 (49%), Gaps = 22/184 (11%)

Query: 35  NRNKSPKRTSLDNDNISQRST--KNINVSQAV--SSRHGSIDQSRP-LNKKSTLNSQNL- 88
           N+NK+  + SL+N+   +  T  ++ N++QAV  SSR  + +  +P   K+ + +S N+ 
Sbjct: 314 NKNKTTNQNSLNNEKDVRIDTVEEDFNINQAVRSSSRRATTNSIKPEYFKRGSFSSDNID 373

Query: 89  -SQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSRRSSGQVSMA-----PSSMGNINLTR 142
            ++ +NN  +  P     H R +ST + F+ S S+R+S   S+       S   +    +
Sbjct: 374 SAEDLNNRSSSRP-----HSRMNSTTTDFRKSASKRNSIYNSLKETDDNASPFADQPPVQ 428

Query: 143 HNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLP 202
              N+   S S  +   I++LS +  P   +  T+ ++P  +   F ++    NI   +P
Sbjct: 429 DENNSQLHSDSSSNSNKISHLSMYQPPLKPLPRTVKTEP--ILPSFGNMAINSNI---VP 483

Query: 203 QEKQ 206
           Q++Q
Sbjct: 484 QQQQ 487

>KLTH0D09152g Chr4 (760328..762154) [1827 bp, 608 aa] {ON} highly
            similar to uniprot|P06208 Saccharomyces cerevisiae
            YNL104C LEU4 Alpha-isopropylmalate synthase (2-
            isopropylmalate synthase) the main isozyme responsible
            for the first step in the leucine biosynthesis pathway
          Length = 608

 Score = 33.5 bits (75), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 10/84 (11%)

Query: 1442 ITSYEREYNELLAKLHRVDKAVGSLQGSDN---------LKNIFNVILAVGNFMNDSAKQ 1492
            +T  + E   L  ++  ++  V  +QGS N         + N+FNV   V N+   S   
Sbjct: 482  VTKIDAERRSLTGQVS-INGGVYDIQGSGNGPISSLVDAMSNLFNVKFGVANYTEHSLGS 540

Query: 1493 AKGFKLSTLQRLTFIKDADNSMTF 1516
                + ++   L + +D+DN  TF
Sbjct: 541  GSSTQAASFIHLVYRRDSDNERTF 564

>YDL139C Chr4 complement(211375..212046) [672 bp, 223 aa] {ON}
           SCM3Nonhistone component of centromeric chromatin that
           binds stoichiometrically to CenH3-H4 histones, required
           for kinetochore assembly; required for G2/M progression
           and localization of Cse4p; may protect Cse4p from
           ubiquitylation
          Length = 223

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 32/105 (30%)

Query: 280 PSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDD--- 336
           P+   R  KK+  IS+PIA  +  +Y +++ N                H + K+ DD   
Sbjct: 50  PNIEKRKTKKDDGISRPIAERNGHVYIMSKEN----------------HIIPKLTDDEVM 93

Query: 337 ---KLSKDEMKDLWVTLRT------EQLDWVD----AFLENQGHI 368
              KL+ + M+ +W  + +      EQ D VD      +E+ GHI
Sbjct: 94  ERHKLADENMRKVWSNIISKYESIEEQGDLVDLKTGEIVEDNGHI 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 182,556,018
Number of extensions: 8136608
Number of successful extensions: 43697
Number of sequences better than 10.0: 565
Number of HSP's gapped: 45441
Number of HSP's successfully gapped: 702
Length of query: 1898
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1774
Effective length of database: 39,262,815
Effective search space: 69652233810
Effective search space used: 69652233810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 73 (32.7 bits)