Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J08184g1.83ON57257228930.0
Suva_5.41.83ON59052220570.0
NDAI0A006101.83ON56555220400.0
Skud_5.261.83ON59058320270.0
YEL063C (CAN1)1.83ON59052320240.0
Smik_5.241.83ON59052220230.0
KNAG0C007901.83ON57957019780.0
TDEL0C061801.83ON58356319690.0
YNL270C (ALP1)1.83ON57353919630.0
NCAS0B085701.83ON53252819520.0
TPHA0B044801.83ON60358719560.0
NCAS0A006001.83ON54452319440.0
Smik_14.671.83ON57357519430.0
Skud_14.701.83ON57356619390.0
NDAI0F042001.83ON56656519190.0
SAKL0C02662g1.83ON54854919010.0
Suva_14.731.83ON49747918860.0
KNAG0C05920singletonON59955018930.0
Kpol_2000.651.83ON59555318770.0
SAKL0C02640gsingletonON54854818620.0
ZYRO0F16654g1.83ON58056818390.0
KAFR0D007001.83ON57457518360.0
TBLA0A054501.83ON60654918280.0
SAKL0C02684gsingletonON58855118150.0
CAGL0J08162g1.84ON59757618090.0
KLTH0F02398g1.83ON55554317960.0
Kpol_2000.641.84ON61057818020.0
KLLA0C02343g1.83ON58154817950.0
TBLA0A054601.84ON60856717920.0
Smik_14.681.84ON61156617860.0
Kwal_33.134011.83ON55954917780.0
YNL268W (LYP1)1.84ON61159117800.0
Suva_14.751.84ON61156617760.0
NDAI0F041901.84ON59957417720.0
Ecym_10871.83ON57055117660.0
Skud_14.711.84ON61259317690.0
NCAS0A006101.84ON60751317570.0
TPHA0B044701.84ON59951817390.0
KNAG0F004801.84ON59756317260.0
TDEL0C061701.84ON57352417220.0
KAFR0D039401.83ON59757917230.0
Ecym_10881.84ON56754217080.0
KLLA0C02365g1.84ON57954216960.0
KLTH0F02420g1.84ON62151916990.0
SAKL0C02728g1.84ON56252316810.0
Kwal_33.134111.84ON56051816760.0
AFR667C1.84ON56356016330.0
ZYRO0F16632g1.84ON60751316060.0
AFR668W1.83ON55654915540.0
Kpol_358.3na 1ON5755389141e-115
Kwal_26.69407.44ON5705349121e-115
CAGL0A01199gna 1ON6135208961e-112
YPL265W (DIP5)na 1ON6085148861e-111
SAKL0G14916gna 1ON5815698831e-111
TBLA0A07060na 1ON6255108841e-110
KAFR0B06430singletonON5935858741e-109
Smik_6.473na 1ON6065238721e-109
TPHA0M00130singletonON6115138651e-108
Kwal_33.15545na 1ON5765418601e-107
Skud_16.12na 1ON6075538591e-107
KLLA0E16281gna 1ON6055688571e-106
NCAS0D02260na 1ON5975538541e-106
Suva_16.40na 1ON6065148541e-106
TPHA0H028507.44ON6015958461e-105
KLTH0B01166gna 1ON5775028411e-105
KLTH0D01474g7.44ON6245198441e-104
KNAG0L02470singletonON6385338411e-104
Ecym_2480na 1ON5865268371e-104
CAGL0E05632g7.44ON5985448341e-103
NDAI0I02660na 1ON5945228321e-103
AFR156W7.44ON5585418081e-100
KNAG0E003907.44ON5995678091e-100
Kwal_26.9612singletonON5434938032e-99
TDEL0H040707.44ON5775738025e-99
KNAG0L02460singletonON5885438036e-99
NCAS0E022607.44ON5935908028e-99
YOR348C (PUT4)7.44ON6275988041e-98
NDAI0E038007.44ON6215868031e-98
SAKL0B10956g7.44ON5725827973e-98
Kpol_367.77.44ON5845867974e-98
Ecym_60211.244ON6005797961e-97
SAKL0C01232gsingletonON6135687961e-97
Suva_2.6881.50ON6615727956e-97
Skud_6.2na 2ON5585307869e-97
SAKL0C13992gsingletonON5525247859e-97
SAKL0F09790gsingletonON5585157842e-96
Smik_15.5327.44ON6315957883e-96
Smik_13.1singletonON5234997751e-95
NDAI0B052201.244ON6115477794e-95
ZYRO0D03762g1.244ON6005807741e-94
Skud_15.5157.44ON6265997752e-94
Suva_8.4027.44ON6835887792e-94
KAFR0D005001.50ON6175467743e-94
Ecym_80357.44ON5635427693e-94
KAFR0D00510na 3ON6175367733e-94
TDEL0C00930singletonON5955427698e-94
Kwal_27.126811.244ON5935567662e-93
Smik_4.7901.50ON6635677685e-93
Kwal_23.4026singletonON5345197595e-93
YFL055W (AGP3)na 2ON5585127607e-93
ZYRO0A00308gsingletonON5645357581e-92
Kpol_543.791.244ON6055467602e-92
SAKL0D00836gna 4ON6014947593e-92
TBLA0C01240singletonON6295987604e-92
TPHA0B010901.244ON6065607585e-92
SAKL0C01650g1.50ON6135687577e-92
TPHA0E036601.50ON6475777589e-92
CAGL0B01012g1.50ON6235627561e-91
Skud_11.2751.244ON6025977541e-91
KLLA0F27093gsingletonON5634657511e-91
Suva_2.716singletonON6035907532e-91
SAKL0G14014g5.158ON6055387532e-91
KAFR0A011203.284ON5925347523e-91
YDR508C (GNP1)1.50ON6635727554e-91
KLLA0F23419g7.44ON5735777494e-91
NDAI0A006401.50ON6415707535e-91
Skud_4.7841.50ON6635727546e-91
NDAI0D021605.158ON5875457488e-91
KAFR0D00520na 5ON5985787471e-90
KAFR0C051607.44ON5845687461e-90
ACL135Wna 1ON5885277417e-90
Ecym_26643.285ON5755587408e-90
ZYRO0D17908gna 1ON5185087358e-90
YBR068C (BAP2)3.284ON6095477428e-90
Kwal_33.132041.50ON6075877421e-89
KLTH0E15642g1.244ON5965677392e-89
CAGL0K05753g1.50ON6605907423e-89
KAFR0C004003.284ON5825707347e-89
Kpol_2000.921.50ON6375817371e-88
KNAG0C02140singletonON5985497332e-88
TBLA0G031203.284ON6735387382e-88
Suva_7.4855.158ON6035577313e-88
Kwal_33.154075.158ON5875057303e-88
CAGL0B03773g5.158ON6055387314e-88
YKR039W (GAP1)1.244ON6025287305e-88
Suva_4.3073.284ON6095777306e-88
Kwal_8.590na 6ON6295327316e-88
Skud_7.5255.158ON6035637296e-88
Ecym_47895.158ON5885307286e-88
Ecym_10561.50ON6065667289e-88
KLLA0A11770g5.158ON5815707261e-87
NDAI0A056203.284ON5715347232e-87
Kwal_33.14276na 4ON5965717253e-87
KAFR0E018505.158ON5605047204e-87
NCAS0A071105.158ON5925457225e-87
KLTH0F04048gsingletonON5835697225e-87
NCAS0B085801.50ON6275327247e-87
YGR191W (HIP1)5.158ON6035397227e-87
AFR698C1.50ON6095077228e-87
TDEL0A08030singletonON5144567141e-86
KLTH0B02046g5.158ON5895657192e-86
KNAG0G009005.158ON6135387202e-86
KAFR0D04120na 5ON6485597232e-86
Skud_2.1913.284ON6095287202e-86
SAKL0D02970g3.284ON6015737183e-86
Suva_11.2731.244ON6015697183e-86
Smik_16.1155.158ON6035307174e-86
NDAI0C029505.158ON6095347175e-86
NDAI0G060301.368ON5995147157e-86
KLTH0B00154gna 6ON5565207119e-86
NCAS0A106803.284ON5935467131e-85
AGR319W5.158ON6265427142e-85
KNAG0H011503.284ON6175357132e-85
TDEL0E05750singletonON5485287073e-85
KLTH0C05170g3.284ON5985757113e-85
YDR046C (BAP3)3.284ON6045337113e-85
Smik_4.2843.284ON6045337105e-85
CAGL0H08393g3.284ON6125287106e-85
TBLA0A051801.50ON6765107146e-85
Kpol_2002.441.50ON6275817107e-85
SAKL0D04664g1.244ON5934967088e-85
Smik_2.2013.284ON6095217081e-84
NCAS0B079001.244ON6195647062e-84
CAGL0L03267g1.244ON5974967042e-84
Suva_3.1891.50ON6335647063e-84
KLLA0C01606g1.50ON6205237054e-84
TDEL0C065101.50ON6425757064e-84
TDEL0F02830na 7ON5615077004e-84
SAKL0F16544gsingletonON5675486996e-84
YCL025C (AGP1)1.50ON6335687038e-84
Suva_2.2033.284ON6045337011e-83
Smik_3.531.50ON6335637021e-83
YOL020W (TAT2)1.368ON5925377001e-83
Skud_15.1381.368ON5925186973e-83
Smik_15.1461.368ON5935416964e-83
Kwal_27.105383.284ON6025936974e-83
KLTH0H13398g1.368ON5875706955e-83
Kpol_1010.325.158ON5995286965e-83
TPHA0A047005.158ON5695586935e-83
Smik_6.482na 8ON5585416911e-82
KNAG0J022003.284ON6074906941e-82
AGR038C3.284ON5805676921e-82
NCAS0D018705.158ON5955176921e-82
Suva_13.517singletonON5475426882e-82
Ecym_26623.284ON5895156912e-82
AEL030W1.368ON5825646902e-82
NCAS0A089201.368ON5995636912e-82
NDAI0A074903.284ON5965346903e-82
KAFR0D041401.50ON6375436933e-82
AGR039Cna 9ON5865486885e-82
KNAG0F002701.50ON6345136915e-82
NCAS0J00140na 2ON5585246865e-82
ZYRO0C18502g7.44ON5755546875e-82
Skud_3.381.50ON6335066907e-82
TBLA0B077605.158ON6585146901e-81
NCAS0I015303.284ON5955706852e-81
Smik_11.3021.244ON5534916822e-81
KLTH0F01584g1.50ON5965746842e-81
NCAS0A004201.50ON6795816893e-81
SAKL0D02926g3.285ON5835716806e-81
Suva_15.1481.368ON5925216816e-81
CAGL0D02178g1.368ON5775236797e-81
AFR230C1.244ON6045086801e-80
Kpol_543.78singletonON6055716801e-80
Kpol_534.221.368ON5925646781e-80
KLTH0F01606gna 5ON6045466782e-80
Skud_16.2na 8ON4964936667e-80
KLTH0A00308gsingletonON5415296698e-80
Skud_4.3003.284ON6045336748e-80
TBLA0A05190na 5ON6675466789e-80
KLLA0A06886gsingletonON5875696729e-80
Ecym_27161.368ON5925846712e-79
TPHA0A002405.158ON6035596712e-79
CAGL0M00154gsingletonON5505216672e-79
SAKL0D02948gna 9ON5945676684e-79
KLLA0A06930g1.244ON5875396676e-79
CAGL0L07546g3.284ON6345716706e-79
SAKL0H08184gna 10ON5985616669e-79
NDAI0A01340singletonON5544966631e-78
Sklu_YGOB_Anc_1.3681.368ON5414666611e-78
KLLA0B14685gna 11ON5715406632e-78
Kwal_26.8097na 12ON5445336612e-78
TPHA0M012003.284ON6075606652e-78
Kwal_23.2817na 11ON5805706597e-78
Smik_2.2023.285ON6175536627e-78
Ecym_2663na 9ON5895076598e-78
KLLA0A10813g1.368ON5845886581e-77
ZYRO0G12342g3.284ON6205606573e-77
NDAI0F043901.50ON6675336603e-77
KAFR0D04130na 3ON6445586576e-77
ZYRO0G07172gna 7ON5675106517e-77
TBLA0C012101.368ON6005176502e-76
Kpol_1065.133.284ON5965806493e-76
Skud_2.1923.285ON6195486513e-76
ZYRO0F17446g1.50ON6335196523e-76
KLTH0D07128gna 12ON5435136445e-76
ADL272Wna 10ON5645086455e-76
KNAG0L00110na 2ON5715116457e-76
KNAG0J022103.285ON5815406459e-76
Kwal_34.16254singletonOFF4814786343e-75
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J08184g
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...  1118   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   796   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   790   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   785   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   784   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   783   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              766   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   763   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   760   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            756   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   758   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   753   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   753   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   751   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            743   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   736   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   731   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            733   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   727   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   721   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   712   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   711   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   708   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   703   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   701   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   696   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   698   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   696   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   694   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   692   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   689   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   690   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   688   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   687   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   684   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   686   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              681   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   674   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                669   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   667   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   668   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   662   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   657   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   659   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   652   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   650   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   633   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   623   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   603   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   356   e-115
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   355   e-115
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   349   e-112
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   345   e-111
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   344   e-111
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   345   e-110
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   341   e-109
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   340   e-109
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     337   e-108
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   335   e-107
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   335   e-107
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   334   e-106
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              333   e-106
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   333   e-106
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   330   e-105
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   328   e-105
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   329   e-104
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             328   e-104
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   327   e-104
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   325   e-103
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   325   e-103
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   315   e-100
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   316   e-100
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   313   2e-99
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   313   5e-99
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             313   6e-99
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     313   8e-99
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   314   1e-98
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     313   1e-98
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   311   3e-98
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   311   4e-98
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   311   1e-97
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   311   1e-97
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   310   6e-97
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      307   9e-97
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   306   9e-97
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   306   2e-96
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   308   3e-96
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    303   1e-95
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   304   4e-95
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   302   1e-94
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   303   2e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   304   2e-94
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      302   3e-94
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   300   3e-94
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      302   3e-94
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   300   8e-94
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   299   2e-93
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   300   5e-93
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   296   5e-93
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   297   7e-93
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   296   1e-92
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   297   2e-92
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   296   3e-92
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   297   4e-92
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   296   5e-92
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   296   7e-92
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   296   9e-92
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   295   1e-91
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   295   1e-91
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   293   1e-91
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   294   2e-91
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   294   2e-91
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   294   3e-91
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   295   4e-91
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   293   4e-91
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   294   5e-91
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   295   6e-91
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    292   8e-91
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   292   1e-90
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   291   1e-90
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   290   7e-90
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   289   8e-90
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   287   8e-90
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   290   8e-90
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   290   1e-89
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   289   2e-89
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   290   3e-89
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                287   7e-89
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   288   1e-88
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   286   2e-88
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              288   2e-88
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   286   3e-88
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   285   3e-88
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   286   4e-88
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   285   5e-88
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   285   6e-88
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   286   6e-88
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   285   6e-88
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   285   6e-88
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   285   9e-88
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   284   1e-87
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            283   2e-87
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   283   3e-87
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   281   4e-87
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   282   5e-87
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   282   5e-87
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   283   7e-87
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   282   7e-87
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   282   8e-87
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            279   1e-86
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   281   2e-86
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   281   2e-86
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   283   2e-86
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   281   2e-86
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   281   3e-86
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   281   3e-86
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   280   4e-86
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    280   5e-86
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   280   7e-86
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   278   9e-86
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   279   1e-85
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   279   2e-85
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              279   2e-85
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            276   3e-85
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   278   3e-85
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   278   3e-85
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   278   5e-85
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   278   6e-85
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   279   6e-85
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   278   7e-85
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   277   8e-85
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   277   1e-84
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   276   2e-84
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   275   2e-84
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   276   3e-84
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   276   4e-84
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   276   4e-84
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   274   4e-84
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   273   6e-84
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   275   8e-84
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   274   1e-83
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   275   1e-83
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   274   1e-83
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   273   3e-83
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   272   4e-83
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   273   4e-83
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   272   5e-83
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   272   5e-83
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   271   5e-83
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   270   1e-82
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   271   1e-82
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   271   1e-82
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   271   1e-82
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   269   2e-82
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   270   2e-82
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   270   2e-82
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   270   2e-82
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   270   3e-82
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              271   3e-82
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   269   5e-82
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   270   5e-82
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      268   5e-82
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   269   5e-82
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   270   7e-82
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   270   1e-81
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              268   2e-81
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   267   2e-81
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   268   2e-81
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   270   3e-81
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   266   6e-81
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   266   6e-81
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   266   7e-81
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   266   1e-80
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   266   1e-80
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   265   1e-80
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   265   2e-80
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   261   7e-80
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   262   8e-80
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   264   8e-80
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   265   9e-80
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   263   9e-80
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   263   2e-79
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   263   2e-79
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   261   2e-79
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   261   4e-79
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   261   6e-79
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   262   6e-79
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   261   9e-79
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              259   1e-78
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   259   1e-78
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   259   2e-78
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   259   2e-78
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   260   2e-78
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   258   7e-78
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   259   7e-78
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   258   8e-78
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   258   1e-77
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   257   3e-77
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   258   3e-77
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              257   6e-77
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   255   7e-77
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   254   2e-76
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   254   3e-76
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   255   3e-76
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   255   3e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   252   5e-76
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   253   5e-76
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   253   7e-76
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   253   9e-76
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   248   3e-75
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   248   4e-75
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   250   7e-75
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   250   1e-74
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   251   1e-74
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   249   1e-74
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              249   3e-74
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                247   1e-73
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   246   1e-73
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   246   8e-73
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              244   1e-72
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   245   1e-72
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   243   1e-72
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   244   2e-72
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   244   2e-72
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   244   3e-72
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   241   3e-71
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   242   5e-71
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   238   1e-70
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   238   5e-70
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   237   5e-70
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   237   7e-70
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   236   1e-69
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   241   1e-69
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   236   3e-69
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   235   5e-69
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   233   2e-68
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   232   5e-68
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              232   6e-68
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   230   4e-67
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   229   8e-67
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   229   1e-66
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   227   3e-66
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   226   8e-66
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   226   1e-65
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   223   1e-65
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   226   2e-65
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   224   3e-65
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    224   3e-65
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   224   6e-65
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   228   8e-65
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      223   1e-64
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   223   2e-64
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   222   2e-64
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   223   2e-64
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   221   4e-64
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   222   4e-64
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   221   4e-64
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   221   4e-64
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   219   2e-63
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   219   3e-63
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   223   4e-63
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   218   1e-62
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   216   1e-62
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   218   1e-62
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   221   4e-62
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   215   1e-61
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              215   1e-61
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                214   1e-61
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   219   2e-61
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   214   3e-61
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   213   8e-61
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   217   1e-60
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   211   5e-60
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   215   5e-60
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   209   1e-59
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   214   1e-59
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   213   3e-59
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                207   8e-59
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   205   6e-58
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   205   7e-58
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   202   5e-57
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   206   6e-57
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   204   3e-56
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   202   2e-55
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   201   6e-55
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   196   9e-55
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   196   1e-54
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   198   3e-54
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   198   4e-54
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   197   1e-53
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   192   2e-53
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   196   2e-53
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   194   1e-52
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   193   3e-52
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     174   1e-48
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     173   2e-48
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   173   9e-46
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         133   5e-34
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   124   1e-31
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      97   7e-22
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          96   1e-21
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     97   5e-21
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          84   5e-18
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    82   2e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      74   1e-15
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      69   2e-13
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    58   8e-09
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    53   1e-06
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    41   0.008
NDAI0F03680 Chr6 complement(872773..874764) [1992 bp, 663 aa] {O...    39   0.050
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...    38   0.058
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              36   0.087
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    37   0.15 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    36   0.25 
TPHA0F00170 Chr6 (21183..22853) [1671 bp, 556 aa] {ON} Anc_4.5 Y...    34   1.1  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    34   1.4  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    33   3.1  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   3.2  
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    32   4.2  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    32   5.4  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    32   5.4  
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    32   6.5  
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    31   8.4  
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    31   8.7  
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    31   9.4  

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/572 (96%), Positives = 552/572 (96%)

Query: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL
Sbjct: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           LEHHDVKRSLKQRH                    PLANAGPVGALVAYLFMGTVVFSVTQ
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
           SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240
           VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP
Sbjct: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360
           RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360

Query: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420
           NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY
Sbjct: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420

Query: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480
           MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL
Sbjct: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480

Query: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED 540
           AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED
Sbjct: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED 540

Query: 541 VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA
Sbjct: 541 VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/522 (72%), Positives = 439/522 (84%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           ED+  E +  +++ +VKR LKQRH                    PL NAGPVGAL++YLF
Sbjct: 69  EDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLF 128

Query: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
           MG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSVV
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
           GQ+IQFWT+ VPLAAWISIFWV++TA NMFPVK+YGEFEFW+ASIKV+A++GFLIY  C+
Sbjct: 189 GQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248

Query: 231 VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290
           VCGAG TGP+GFRYWRNPGA GPGIIS N  EARFLGWVSSLINAAFT+QGTELVGITAG
Sbjct: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAG 308

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQN 350
           EAANPRK VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLTS  SYVS+SPFII I+N
Sbjct: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIEN 368

Query: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410
           +GT+VLPHIFNAVILTTIISA NSN+YVGSR+LF ++K+ LAPKF +KTT  GVPY++V 
Sbjct: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVF 428

Query: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470
           A S FG+L+YME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+L
Sbjct: 429 ATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDEL 488

Query: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYF 530
           P+KA  MP LAYYA FFMVVIILIQGFTSF P F+G +F+AAYISV LFL  W  F++ F
Sbjct: 489 PFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIF 548

Query: 531 RCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           RCR +WK+EDVDID+DRR+IE++VWE+  PKTLWDKFW+ V 
Sbjct: 549 RCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/552 (69%), Positives = 448/552 (81%), Gaps = 5/552 (0%)

Query: 25  DSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL----LEHHDVKRSLKQRHXXXXXX 80
            S S+  +   L RR        +Q   + ++++E+    +   +VKR LKQRH      
Sbjct: 15  KSSSYELDDYPLHRRTNSVHSIPSQI-TIESQEEEIANGQIREAEVKRELKQRHIGMIAL 73

Query: 81  XXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQ 140
                         PL NAGPVGAL+AYLFMGT+V+SVTQSLGEMATFIPVTSSF+VF+Q
Sbjct: 74  GGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQ 133

Query: 141 RFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMF 200
           RFLSP+ GAANGYMY+ SW  TFALELSVVGQIIQFWT  VP+ AWISIFWVLL A NMF
Sbjct: 134 RFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMF 193

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNT 260
           PV+FYGEFEFW+ASIKVLA+MGFLIY LC+VCGAG TGP+GFRYWRNPG MGPGII+ N 
Sbjct: 194 PVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPMGPGIIAKNL 253

Query: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320
            EA+FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI+KV+ RIL FYIGSLFF
Sbjct: 254 NEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFF 313

Query: 321 IGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGS 380
           IGL VPYNDPKLTS DSYV++SPFII+IQN+GT +LPHIFNAVIL+TIISA NSNVYVGS
Sbjct: 314 IGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGS 373

Query: 381 RILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGV 440
           RI+F ++K+ LAP+ L++T   GVP++SV+    FG+L+YME STGG  AFNWLLNITGV
Sbjct: 374 RIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGV 433

Query: 441 AGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF 500
           AGFF+WL IS SHVRFMQAL++RGISRDDLP+KA +MP LAYYAIFFM +II+IQGFTSF
Sbjct: 434 AGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSF 493

Query: 501 APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAP 560
            P F G DF+AAYIS  LF+  W  FQ++FRCR+IWK+EDVDIDTDRR+IE VVWED  P
Sbjct: 494 CPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEVVWEDPPP 553

Query: 561 KTLWDKFWDFVA 572
            T WDKFW+ VA
Sbjct: 554 VTFWDKFWNVVA 565

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/583 (66%), Positives = 460/583 (78%), Gaps = 16/583 (2%)

Query: 6   SDLKEKSVIQD-IDTIIDGNDSDSHNSNTGELGRRKRK-----------TSVSS----TQ 49
           ++++EK +  + + T++   ++   +   G L  +  K           T V+     + 
Sbjct: 8   AEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSM 67

Query: 50  YEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYL 109
            E+L  E +  +++ +VKR LKQRH                    PLANAGPVGAL+AYL
Sbjct: 68  EENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYL 127

Query: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           FMG++ FSVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSV
Sbjct: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
           VGQ+IQFWT KVPLAAWISIFWVL+T  N+FPVK+YGEFEFW+ASIKV+A++GFLIY  C
Sbjct: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 230 IVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           +VCGAG TGP+GFRYWRNPGA GPGIIS N  E RFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQ 349
           GEAANPRK VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLT   SYVS+SPFI+ IQ
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           N+GT+VLPHIFNAVILTTIISA NSN+YVGSRILF ++KN LAPKFL++T+  GVPY++V
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
            A + FG+L+YME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIY 529
           LP+KA  MP LAYY+ FFM++II+IQGFT+FAP F+G  F+AAYIS+ LF+  W  F+  
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547

Query: 530 FRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           FRCR IWK+EDVDID+DRR+IE++VWED  PKT WDKFW+ VA
Sbjct: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/523 (71%), Positives = 436/523 (83%), Gaps = 1/523 (0%)

Query: 51  EDLATEKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYL 109
           ED   ++DE  +++ +VKR LKQRH                    PL NAGPVGAL++YL
Sbjct: 68  EDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           FMG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
           VGQ+IQFWT+KVPLAAWISIFWV++T  N+FPVK+YGEFEFW+ASIKVLA++GFLIY  C
Sbjct: 188 VGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFC 247

Query: 230 IVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           +VCGAG TGP+GFRYWRNPGA GPGIIS +  E RFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQ 349
           GEAANPRK+VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLT + SYVS+SPFII I+
Sbjct: 308 GEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIE 367

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           N+GT+VLPHIFNAVILTTIISA NSN+YVGSRILF ++KN LAPKFL++TT  GVPY++V
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
              +AFG+L+YME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+
Sbjct: 428 FVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIY 529
           LP+KA  MP LAYYA  FM +II+IQGFT+FAP F+G  F AAYIS+ LFL  W  FQ  
Sbjct: 488 LPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCI 547

Query: 530 FRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           FRCR IWK+ DVDID+DRR+IE++VWED  PKT WDKFW+ VA
Sbjct: 548 FRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/522 (72%), Positives = 437/522 (83%), Gaps = 1/522 (0%)

Query: 52  DLATEKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           D+  ++D+  + + +VKR LKQRH                    PLANAGPVGAL++YLF
Sbjct: 69  DVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLF 128

Query: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
           MG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSVV
Sbjct: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVV 188

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
           GQ+I+FWT KVPLAAWISIFWV++T  N+FPVK+YGEFEFW+ASIKVLA++GFLIY  C+
Sbjct: 189 GQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM 248

Query: 231 VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290
           VCGAG TGP+GFRYWRNPGA GPGIIS +  E RFLGWVSSLINAAFT+QGTELVGITAG
Sbjct: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAG 308

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQN 350
           EAANPRK VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLT+  SYVS SPFII I+N
Sbjct: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIEN 368

Query: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410
           +GT+VLPHIFNAVILTTIISA NSN+YVGSRILF ++KN LAPKFL++TT  GVPY++V 
Sbjct: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428

Query: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470
             + FG+L+YME STGG K F WLLNITGVAGFFAWLLIS SH+RFMQALK+RGISRD+L
Sbjct: 429 ITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDEL 488

Query: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYF 530
           P+KA  MP LAY+A  FM++IILIQGFT+FAP F G DF+AAYIS+ LFL  W  F+I F
Sbjct: 489 PFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 531 RCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           RCR IWK+EDVDID+DRR+IE++VWED  PKT WDKFW+ VA
Sbjct: 549 RCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/570 (66%), Positives = 440/570 (77%), Gaps = 22/570 (3%)

Query: 23  GNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH------------------H 64
           G+  D  +    E  R  +  +V+S  Y  L   + ++                     H
Sbjct: 12  GSSPDMRHRKKAEEMRETKLAAVTS--YTSLGESRADIRHRMSFESGEDGESEEQTGYVH 69

Query: 65  D--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
           D  VKR LKQRH                    PL  AGPVGAL++Y+FMGT+V+SVTQSL
Sbjct: 70  DAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSL 129

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           GEMATFIPVTSSF+VFAQRFLSP++GAA GYMY+ SW  TFALELSV+GQ+IQ+WT+ VP
Sbjct: 130 GEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVP 189

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF 242
           LAAWISIFWV++TA NMFPVK+YGE EFWIA IKV+A++GFL+Y LC+VCGAG TGP+GF
Sbjct: 190 LAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVGF 249

Query: 243 RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 302
           RYWRNPG  GPGIIS +  EARFLGWVSSLIN AFTYQGTELVGI+AGEAANPRKAVPRA
Sbjct: 250 RYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRA 309

Query: 303 IRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNA 362
           I+KV+ RIL FYIGSLFFIGL VPYND  L +TDSYV+SSPFII I+N+GT VLPHIFNA
Sbjct: 310 IKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFNA 369

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VI  TI+SAGNSNVYVGSRILF ++KN LAPK L++TT  GVP+++VL  S  G+L+YME
Sbjct: 370 VIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYME 429

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            STGG  AFNWLLNIT VAGFF WL IS SH+RFMQALK+RGISRDDLP+KA  MP LAY
Sbjct: 430 TSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAY 489

Query: 483 YAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVD 542
           YA F M VII+IQGFT+FAP FSG DF AAYIS+ LF+  W  FQI FRCR I K+EDVD
Sbjct: 490 YASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVD 549

Query: 543 IDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           IDTDRR+IE+VVWED  PKT+WDKFW+ +A
Sbjct: 550 IDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/563 (68%), Positives = 447/563 (79%), Gaps = 15/563 (2%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATE--------------KDELLEHHDVKRS 69
           ND DS +   G +  RK K+ VS T   D +                K+  +   +VKR+
Sbjct: 22  NDEDSSSGQAGAINHRK-KSVVSKTTAVDESLPGLSSSDLESSDDFVKEGQVHEAEVKRA 80

Query: 70  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFI 129
           LKQRH                    PL+NAGPVG L+AYLFM T+V+SV QSLGEMATFI
Sbjct: 81  LKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFI 140

Query: 130 PVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISI 189
           PVTS+F+VF+ RFLSPA GAA+GYMY+ SW  TFALELSVVGQII+FWT  VP+AAWI+I
Sbjct: 141 PVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAAWITI 200

Query: 190 FWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPG 249
           FWVLLT  N+FPVK+YGEFEFWIA IKV+AL+GF+IY LC+VCGAG TGP+GFRYWRNPG
Sbjct: 201 FWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRYWRNPG 260

Query: 250 AMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIR 309
           A GPGIIS +  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI+KV+ R
Sbjct: 261 AWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 320

Query: 310 ILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTII 369
           IL+FY     FIGL VPYNDPKL S+DSYVSSSPFII I+N+GT+VLPHIFNAV+LTTII
Sbjct: 321 ILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVVLTTII 380

Query: 370 SAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAK 429
           SAGNSNVYVGSRI++ +AK  LAP F  +T   GVPY +V   SAFG+L+YMELSTGGA 
Sbjct: 381 SAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGAS 440

Query: 430 AFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMV 489
           AFNWLLNITGVAGFF W+LIS  H+RFMQALK+RGISRDDLP+KA +MPWLAYYA+FFMV
Sbjct: 441 AFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMV 500

Query: 490 VIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRRE 549
           VIILIQGFT+FAP FSG DF AAY+SV LF+  W   QI+FRCRI  +L++VDIDTDRR+
Sbjct: 501 VIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRD 560

Query: 550 IESVVWEDDAPKTLWDKFWDFVA 572
           IE+VVW+D+ PKTLWDKFW+ VA
Sbjct: 561 IEAVVWDDEPPKTLWDKFWNIVA 583

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/539 (68%), Positives = 441/539 (81%), Gaps = 3/539 (0%)

Query: 37  GRRKRKTSVSSTQYEDLATEKDEL--LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXX 94
           G    K   +  + ED A ++ E    E  +VKR LKQRH                    
Sbjct: 35  GENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGP 94

Query: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYM 154
           PLA+AGPVGAL++YLFMGTV++SVTQSLGEM TFIPVTSSFSVFAQRFLSPALGA NGYM
Sbjct: 95  PLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYM 154

Query: 155 YFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214
           Y+LSWCFTFALELSV+G++IQ+WT  VPLAAWI IFW LLT+ NMFPVK+YGEFEF IAS
Sbjct: 155 YWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIAS 214

Query: 215 IKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273
           IKV+AL+GF+I+S C+VCGAG++ GPIGFRYWRNPGA GPGIISS+  E RFLGWVSSLI
Sbjct: 215 IKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 274

Query: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT 333
           NAAFTYQGTELVGITAGEAANPRKA+PRAI+KV++RIL+FYI SLFFIGL VPYNDPKL 
Sbjct: 275 NAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLD 334

Query: 334 STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393
           S   +VSSSPF+I+I+N+GT+VLP IFNAV+L TI+SAGNSNVY+GSR+L+S++KN LAP
Sbjct: 335 SDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAP 394

Query: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453
           +FL+  T  GVPY SVL+ S FG L+++E+S G  KAFNWLLNITGVAGFFAWLLIS SH
Sbjct: 395 RFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSH 454

Query: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAY 513
           +RFMQA++ RGISRDDLPYKA  MP+LAYYA FF+ +I+LIQGFT+FAP F   DFVAAY
Sbjct: 455 IRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAY 514

Query: 514 ISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           IS+ LFL  W  FQ++F+CR++WKL+D+DID+DRR+IE +VW +   KT W + WD ++
Sbjct: 515 ISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 428/528 (81%), Gaps = 4/528 (0%)

Query: 48  TQYEDLATEKDEL---LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 104
            Q   +  E  E+   +E   V+R LKQRH                    PL NAGPVGA
Sbjct: 6   NQDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGA 65

Query: 105 LVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFA 164
           L+AYLFM T+ +SVTQSLGEMATFIPVTSSF+VF+QRF+SPA GAANGYMY+ SWC TFA
Sbjct: 66  LIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFA 125

Query: 165 LELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFL 224
           LELSVVGQ+IQFWTF VPLAAWISIFWVLLT  NMFPVK+YGEFEFW+A +KV+A+MGFL
Sbjct: 126 LELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFL 185

Query: 225 IYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTEL 284
           IY  C+VCGAG TGP+GFRYWR+PGA GPGII+ +  +ARFLGWVSSLINAAFT+QGTEL
Sbjct: 186 IYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTEL 245

Query: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPF 344
           VGITAGEAANPRK VPRAI+KV+ RIL FYI SLFFIGL VPY+D KLTSTDSYVS+SPF
Sbjct: 246 VGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPF 305

Query: 345 IITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGV 404
           II I+N+GT VLPHIFNAVI+ TIISAGNSN+YVGSRI++ ++ + LAP  L++TT  GV
Sbjct: 306 IIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGV 365

Query: 405 PYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRG 464
           P+++VL  S FG+L+YME STGG KAFNWLLNITGVAGFF WL IS SH+RFMQAL+ RG
Sbjct: 366 PWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRG 425

Query: 465 ISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWG 524
           ISRDDLP+KA WMP LAYY +FFM +II+IQGFTSF P ++G DF+ AYISV +F+  W 
Sbjct: 426 ISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWI 484

Query: 525 FFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
            FQ +FRCR+IW++EDVDIDTDRR +E  VW +  P+  WDKFW+ VA
Sbjct: 485 AFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/587 (64%), Positives = 452/587 (77%), Gaps = 23/587 (3%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDE--------- 59
             +S   +++   D  +     S++G L +RKR     +    DL     +         
Sbjct: 17  NNRSSASEMNKGSDAKEKVDVISSSGSLSKRKRINRSRANSNSDLEGSAADGTARARDID 76

Query: 60  --------------LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 105
                         +++  +VKR LKQRH                    PL NAGPVGAL
Sbjct: 77  NADVDDDDYYMDEGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGAL 136

Query: 106 VAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFAL 165
           +AYLFM T+VFSVTQSLGEMATFIPVTSSF+VF+ RFLSPA+GAANGYMY+ SW  TFAL
Sbjct: 137 IAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFAL 196

Query: 166 ELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLI 225
           ELSVVGQIIQFWT  VPL+AWI I+WV+LT  N+FPVKFYGEFEFW+ASIKVLA++GFLI
Sbjct: 197 ELSVVGQIIQFWTHAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLI 256

Query: 226 YSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELV 285
           Y LC+VCGAG TGP+GFRYWRNPG  GPGIIS +  E RFLGWVSSLINAAFTYQGTELV
Sbjct: 257 YCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELV 316

Query: 286 GITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFI 345
           GITAGEAANPRK VPRAI+KV  RIL+FYI SLFFIGL VPY+D KLTSTDSY+S+SPFI
Sbjct: 317 GITAGEAANPRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFI 376

Query: 346 ITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVP 405
           I I+N+GT++LPHIFNAVIL+TIISAGNSNVYVGSRILF +AK  LAPK+   T+  GVP
Sbjct: 377 IAIENSGTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVP 436

Query: 406 YLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGI 465
           Y SV   S+FG+L+++E+S+GGAKAFNWLLNI  VAGFFAWLLIS +HVRFMQALKHRGI
Sbjct: 437 YYSVFFTSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGI 496

Query: 466 SRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGF 525
           SRDDLP+KA +MP LAYY+IFFM +II+IQGFT+FAP F+G DFVAAYIS+ LF   W  
Sbjct: 497 SRDDLPFKARFMPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLC 556

Query: 526 FQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           FQ+YFR +++W +E+VDIDTDRR++++++WED  PKT WDKFWD VA
Sbjct: 557 FQLYFRSKLLWTVEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/523 (71%), Positives = 428/523 (81%), Gaps = 3/523 (0%)

Query: 53  LATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
           ++T  D+  +  DVKR LK+RH                    PL  AGP+GAL+AYLFMG
Sbjct: 22  ISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMG 81

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           TVVFSVTQSLGEM TFIPVT+SF+VFAQRFLSPA GAANGYMY+ SW  TFALELSVVGQ
Sbjct: 82  TVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQ 141

Query: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           IIQFWT  VPLAAWISI WVLLT  N+FPV+ YGE EFWIAS+KVLA++GF+IY +CI+C
Sbjct: 142 IIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIIC 201

Query: 233 GAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292
           GAG TGP+GFRYW+NPG  G GIISSN  EARF GWVSSLINAAFT+QGTELVGITAGE 
Sbjct: 202 GAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEV 261

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAG 352
             PRK VP+AI+KV+ RIL+FYIGSL  IGL VPYNDPKL S DSYVSSSPFIITIQNAG
Sbjct: 262 QEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAG 321

Query: 353 TRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAI 412
           T++LPHIFNAVIL TIISAGNSNVY+GSRIL+ +AKN  APKF   T+  GVPY++VL  
Sbjct: 322 TKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFT 381

Query: 413 SAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPY 472
           S FGSL+YME +TGG KAF WLLNI GVAGFFAWLLISCSH+RFM+ALK RGISR+DLPY
Sbjct: 382 SMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPY 441

Query: 473 KALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRC 532
           KA+ MPWLAYYA+FFMV+II+IQGFTSFAP F   +F AAYISV LF++FW  FQI+F+C
Sbjct: 442 KAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKC 501

Query: 533 RIIWKLEDVDIDTDRREIESVVWEDDAP---KTLWDKFWDFVA 572
           R++WKL+DVD+DTDRR+IE  VW DD     K  WD+FW++VA
Sbjct: 502 RLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/575 (64%), Positives = 447/575 (77%), Gaps = 16/575 (2%)

Query: 2   EIGPSDLKEKSVIQDIDTII---DGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKD 58
           ++   ++   S I++ + I    DG D++   +    +     K + +S +         
Sbjct: 11  KVSQYEINSISTIKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPR--------- 61

Query: 59  ELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSV 118
              +  +VKR LKQRH                    PLA+AGPVGAL++YLFMGTV++SV
Sbjct: 62  ---KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSV 118

Query: 119 TQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT 178
           TQSLGEMATFIPVTSSFSVFAQRFLSPALGA NGYMY+LSWCFTFALELSV+GQIIQ+WT
Sbjct: 119 TQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT 178

Query: 179 FKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTG 238
             VPL AWI IFW LLT  NMFPVK+YGEFEF IASIKV+AL+GF+ +S CIVCGAG++G
Sbjct: 179 DAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSG 238

Query: 239 -PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297
            PIGFRYWRNPGA GPGIIS N  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPR+
Sbjct: 239 GPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRR 298

Query: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLP 357
           AVPRAI+KV++RIL+FYI SLFFIGL VPYNDPKL S  ++VSSSPF+I+I+N+GT+VLP
Sbjct: 299 AVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLP 358

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
            IFNAV+L TI+SAGNSNVY+GSR+L+S++KN LAP+FL+  T  GVPY +VL+ SAFG 
Sbjct: 359 DIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGF 418

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           L+++E S G  K FNWLLNITGVAGFFAWLLIS SH+RFMQA+K RGISRDDLPY+A  M
Sbjct: 419 LAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMM 478

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWK 537
           P+LAYYA FF+ +I+LIQGFT+FAP F   DF+AAYISV LF+  W  FQ++F+CR +WK
Sbjct: 479 PFLAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWK 538

Query: 538 LEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           L+DVDID+DRR+IE  VW +   KT W   WD ++
Sbjct: 539 LQDVDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/566 (66%), Positives = 443/566 (78%), Gaps = 16/566 (2%)

Query: 8   LKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVK 67
           +KEK ++       D + + + NS+    G +  +TS  S                 +V+
Sbjct: 23  IKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRS---------------RGEVQ 67

Query: 68  RSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT 127
           R LK+RH                    PLA+AGPVGAL++YLFMGTV++SVTQSLGEMAT
Sbjct: 68  RKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMAT 127

Query: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187
           FIPVTSSFSVFAQRFLSPALGA NGYMY+LSWCFTFALELSV+GQIIQ+WT  VPLAAWI
Sbjct: 128 FIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWI 187

Query: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGK-TGPIGFRYWR 246
            IFW LLT  NMFPVK+YGEFEF IASIKV+ L+GF+I+S CIVCGAG+  GPIGFRYWR
Sbjct: 188 VIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWR 247

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           NPGA GPGIISSN  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI+KV
Sbjct: 248 NPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKV 307

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
           +IRIL+FYI SLFFIGL VPYNDPKL S  ++VS+SPF+I+I+N+GT+VLP IFNAV+L 
Sbjct: 308 VIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAVVLI 367

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           TI SAGNSNVY+GSR+L+S++KN LAPK L+  T  GVPYL+VL  S FG L+++E S G
Sbjct: 368 TIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAG 427

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
             KAFNWLLNITGVAGFFAWLLIS SH+RFMQA+K RGISRDDLPYKA  MP+LAYYA F
Sbjct: 428 SGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASF 487

Query: 487 FMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTD 546
           F+ +I+LIQGFT+FAP F   DFVAAYISV LF + W  FQ++F+CR+I KL+D+DID+D
Sbjct: 488 FIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSD 547

Query: 547 RREIESVVWEDDAPKTLWDKFWDFVA 572
           RREIE  VW +   KT W + WD ++
Sbjct: 548 RREIEEQVWIEPECKTRWQRVWDILS 573

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/565 (64%), Positives = 437/565 (77%), Gaps = 14/565 (2%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLA-TEKDELLEHHDVK 67
           K K VI+  +++      + H+      G   + T  ++   E+++  EKDE   +H+VK
Sbjct: 15  KSKIVIKSTESL------EQHDLQ----GNEDKNTPTTTPSKENVSENEKDE---YHEVK 61

Query: 68  RSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT 127
           R L +RH                    PL  +GPVG+L+AYLF+GTVV+SVTQSLGEMAT
Sbjct: 62  RDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121

Query: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187
           FIPVT+SF++F+ RFLSPALGAANGYMY+ SW  TFALELSVVGQIIQFWTF VPL AWI
Sbjct: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181

Query: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRN 247
           SIFWV+LT  N+FPV+ YGE EFWIA +KV A++GF+IY  CIVCGAGKTGP+GFRYWRN
Sbjct: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241

Query: 248 PGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVL 307
           PG  G GIISSN  EARFLGW SSLINAAFT+QGTELVGITAGEAANPR+ VP+AIRKV+
Sbjct: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301

Query: 308 IRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTT 367
            RIL+FYI SLFFIGL VPY+D KL S +SYVSSSPFII I+N+GT++LPHIFN VIL T
Sbjct: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361

Query: 368 IISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGG 427
           IISAGNSNVY+GSR+LF +AKNG  PK  AKTT  GVP  +V+  S FG+L++ME STGG
Sbjct: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421

Query: 428 AKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFF 487
            +AF WLLN+ GVAGFF+WLLIS +H+RFMQ L+ RGISR+DLP+KA +MP+LAYYA   
Sbjct: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481

Query: 488 MVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
           M++II  QGFT+FAP F   +F A+YISV LF +FWG FQ++F+CR +WKL D+DID DR
Sbjct: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDR 541

Query: 548 REIESVVWEDDAPKTLWDKFWDFVA 572
           REIE  VW+D  P  LW KFWDFVA
Sbjct: 542 REIEDRVWQDTTPANLWGKFWDFVA 566

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/549 (66%), Positives = 424/549 (77%), Gaps = 5/549 (0%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
            D ++     G     K   +  +   E L + K+       VKR+LK RH         
Sbjct: 5   KDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKET-----QVKRALKPRHISMIALGGT 59

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                      PL+NAGPVGAL+AY+F+GT+ +SVTQSLGEMATFIPVTSSF+VF QRFL
Sbjct: 60  IGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFL 119

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVK 203
           SPALG+ANGY+Y+LSW  TFALELSVVGQIIQFWT  VPL AWI+IFWV+LT  N+FPVK
Sbjct: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179

Query: 204 FYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEA 263
           +YGE EFWIA IKVLA++GF+IY+  +VCGAGKTGP+GFRYWRNPG  GPGIIS +  E 
Sbjct: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEG 239

Query: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323
           RFLGWVSSLI+AAFTYQGTELVGITAGEAANPRK VPRAI KV  RIL FYI SL FIGL
Sbjct: 240 RFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGL 299

Query: 324 TVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRIL 383
            VP+NDPKL S DSY+SSSPF+I I+N+GT+VLPHIFNAVIL+TIISAGNSNVYVGSRI 
Sbjct: 300 LVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIA 359

Query: 384 FSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
           +SMA NGLAPK+L  TT  G+PY +VL  S  G L+Y+E S+G +  FNWLLNIT VAGF
Sbjct: 360 YSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGF 419

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
           F W+LIS SH+RFMQALKH+GISRDDLP+KA +MPW AYYA FF+ VII+IQGFT+FAP 
Sbjct: 420 FTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPK 479

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTL 563
           F   DF  AYISV LF VFW  FQI+FR  +  K ED+D+DTDRREI+ VVWE+  P+ L
Sbjct: 480 FKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNL 539

Query: 564 WDKFWDFVA 572
           W+KFW  +A
Sbjct: 540 WEKFWAAIA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/479 (74%), Positives = 415/479 (86%), Gaps = 1/479 (0%)

Query: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYM 154
           PLA+AGPVGAL++Y+FMGTV++SVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 155 YFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214
           Y+LSWCFTFALELSV+GQIIQ+WT  VPL+AWI IFW LLT  NMFPVK+YGEFEF IAS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 215 IKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273
           IKV+AL+GF+IYS C+VCGAG+  GPIGFRYWRNPGA GPGIISS+  E RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT 333
           NAAFTYQGTELVGITAGEAANPRKAVPRAI+KV++RIL+FYI SLFFIGL VPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 334 STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393
           S  S+VS+SPF+I+I+N+GT+VLP IFNAV+L TI+SAGNSNVY+GSR+L+S++KN LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453
           +FL+  T  GVPY +VLA S FG L+++E S G  KAFNWLLNITGVAGFFAWLLIS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAY 513
           +RFMQA+  RGISR+DLPYKA  MP+LAYYA FF+ +I+LIQGFT+FAP F   DFVAAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 514 ISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           ISV LF+  W  FQ++F+C II KL+DVDID+DRREIE  VW +   KT W   WD +A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/550 (64%), Positives = 434/550 (78%), Gaps = 3/550 (0%)

Query: 24  NDSDSHNSNTGELGRRKRKTSV-SSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXX 82
           N S++ + +T   G       + S+T    L TE  E ++H  VKR+LK RH        
Sbjct: 52  NASEAASQSTSPTGSELIPDCLQSATNTGTLCTE--EHVKHRSVKRALKPRHIAMIALGG 109

Query: 83  XXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRF 142
                       PL NAGPVGAL+AY+F+GT++FSVTQSLGEM TFIPVTSSF+VF+ RF
Sbjct: 110 TIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRF 169

Query: 143 LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPV 202
           LSPA GAANGYMY+ SW  TFA+ELSV+G++IQFWT  VPLAAWI IFW LLT  NMFPV
Sbjct: 170 LSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPV 229

Query: 203 KFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGE 262
           K+YGE EFWIA +KVL+L+GFLI+ LCI  GAG  GP GFRYWR+PGA GPGII+ +  E
Sbjct: 230 KYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSE 289

Query: 263 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIG 322
           ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP+AI+KV++RIL FY+GSLFFIG
Sbjct: 290 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIG 349

Query: 323 LTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRI 382
           + VP+NDPKLTS  S+VSSSPFII IQN+G  +LP IFN VIL TIISAGNSNVYVGSRI
Sbjct: 350 MLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRI 409

Query: 383 LFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAG 442
           LF +A + LAP+F  +TT  GVP+++VL  S FGSL+++EL+T G K FNWLL+I  +AG
Sbjct: 410 LFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAG 469

Query: 443 FFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP 502
           FFAWLLIS SH+RFM+AL++RGISR+ LP+KA++MPWLAYYA  F+++IILIQGFT+FAP
Sbjct: 470 FFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAP 529

Query: 503 HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKT 562
            F+  DFVA+YIS+ LF++ WG FQ   +CRI WK+ED+D+D+DR++IE + WEDD+PKT
Sbjct: 530 RFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWEDDSPKT 589

Query: 563 LWDKFWDFVA 572
            W K W  +A
Sbjct: 590 FWTKVWQTLA 599

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/553 (68%), Positives = 448/553 (81%), Gaps = 10/553 (1%)

Query: 20  IIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXX 79
           ++DG+    H S+           S S +  ED       +++  +VKR LKQRH     
Sbjct: 53  VVDGSSRHLHGSHG----------SHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIA 102

Query: 80  XXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA 139
                          PL NAGPVG+L+AYLFM T+VFSVTQSLGEMATFIPVTSSF+VF+
Sbjct: 103 LGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFS 162

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199
            RF+SP++GAANGYMY+ SW  TFALELSVVGQIIQFWT  VPL+AWI I+W +LT  NM
Sbjct: 163 SRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNM 222

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSN 259
           FPVKFYGEFEFW+ASIKV+A+MGFLIY LC+VCGAG TGP+GFRYWRNPG  GPGIISS 
Sbjct: 223 FPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQ 282

Query: 260 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLF 319
             E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VPRAI+KV  RIL+FYI SLF
Sbjct: 283 VAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLF 342

Query: 320 FIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379
           FIGL VP++DPKL+S DSYVSSSPFII IQN+GT+VLPHIFNAVIL+TIISAGNSN+YVG
Sbjct: 343 FIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVG 402

Query: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439
           SR++F +AK  LAP++   TT  GVPY++VL  SAFG+L+++E+S+GGAKAFNWLLNI G
Sbjct: 403 SRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVG 462

Query: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499
           VAGFFAWLLIS +HVRF+Q L+HRGISRDDLP+KA  MPWLAYYAIFFM++II+IQGFT+
Sbjct: 463 VAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTA 522

Query: 500 FAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDA 559
           FAP F+G DFVAAYISV LF   W  FQ+YFRC++ W L++VDIDTDRR+I++++WED A
Sbjct: 523 FAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSA 582

Query: 560 PKTLWDKFWDFVA 572
           PKT WD+FWD VA
Sbjct: 583 PKTFWDRFWDVVA 595

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/548 (64%), Positives = 423/548 (77%), Gaps = 1/548 (0%)

Query: 25  DSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXX 84
            +  H+S+  E    +  +  S ++ + ++ E    ++   VKR+LK RH          
Sbjct: 2   SAQQHHSSEKEKNSEELVSEFSRSK-DVVSLESLGSVKETQVKRALKPRHISMIALGGTI 60

Query: 85  XXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLS 144
                     PL+NAGPVGAL+AY+F+GT+ + V+QSLGEMATFIPVTSSF VF QRFLS
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLS 120

Query: 145 PALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKF 204
           PALGAANGYMYFLSW  TFALELSVVGQ+IQFWT  VPL AWI I WV+L + N+ PVKF
Sbjct: 121 PALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKF 180

Query: 205 YGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEAR 264
           YGE EFWIA IKVLA++GF+IY+  +VCGAGKTGP+GFRYWRNPG  GPGIIS +  E R
Sbjct: 181 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGR 240

Query: 265 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLT 324
           FLGWVSSLI+AAFTYQGTELVGITAGEAANPRK VPRAI KV  RIL FYI SL FIGL 
Sbjct: 241 FLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLL 300

Query: 325 VPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
           VP+NDPKL S DSY+SSSPF+I I+N+GT+VLPHIFNAVIL+TIISAGNS+VY+ SR+L+
Sbjct: 301 VPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLY 360

Query: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444
           SM  NGLAPK+L  TT  G+PY +VL  S  G L+Y+E S G +  F+WLLNIT VAGFF
Sbjct: 361 SMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFF 420

Query: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF 504
           AW+LIS +H+RFMQALKH+GISRDDLP+KA +MPW AYYA FF+ VII+IQGFT+FAP F
Sbjct: 421 AWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKF 480

Query: 505 SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLW 564
           +  DF  AY+SV LF   W  FQI+FR  +  K ED+D+DTDRREI++ VWE+D PK LW
Sbjct: 481 NVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLW 540

Query: 565 DKFWDFVA 572
           +KFW  VA
Sbjct: 541 EKFWSAVA 548

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/568 (61%), Positives = 429/568 (75%), Gaps = 17/568 (2%)

Query: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYED----------------LATEKDELLEHH 64
           +D +  ++   +  E   ++   S+SS   E+                +  EK E+    
Sbjct: 14  LDSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEKGEV-RST 72

Query: 65  DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124
           +VKR+LK RH                    PL NAGPVG L+AYLFM T+ FSV QSLGE
Sbjct: 73  EVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGE 132

Query: 125 MATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA 184
           MAT+IPVTS+FSVF+QRFLSPA GAANGYMY+ SW  TFALELSV+GQI+Q+WTFKVP+A
Sbjct: 133 MATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVA 192

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRY 244
           AWISIFWVL+   N  PVKFYGEFEFWIA IKV+A++GF+IY   +VCGAGKTGP+GFRY
Sbjct: 193 AWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGFRY 252

Query: 245 WRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIR 304
           WR+  A G GIIS N  EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VP++I+
Sbjct: 253 WRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIK 312

Query: 305 KVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVI 364
           + L RIL+FYI SL F+GL VP+ND  L  + SY +SSPFI+ I+N+GT+ LP IFNAVI
Sbjct: 313 RTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALPDIFNAVI 372

Query: 365 LTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELS 424
           LTT+ISA NS+VYVGSR+++SMA+N LAP  LAK +  GVPY +VL  SA G+L+Y+E S
Sbjct: 373 LTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETS 432

Query: 425 TGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYA 484
           + GA  FNWL+NITGVAGFF+W LIS SH+RFM+ALK RGISR+DLP+KA +MPW+A Y+
Sbjct: 433 SSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYS 492

Query: 485 IFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDID 544
            FFM +IIL+QGFT F PHF   DFVA+YISVGLF V W  FQI+FRC ++  + ++DID
Sbjct: 493 FFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDID 552

Query: 545 TDRREIESVVWEDDAPKTLWDKFWDFVA 572
           TDRR++++ VWED+ PKTLWDKFW+ VA
Sbjct: 553 TDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/575 (63%), Positives = 443/575 (77%), Gaps = 25/575 (4%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH---HD 65
           + KS +Q   T+   +D    N          ++T  SST      TE +E+L     HD
Sbjct: 14  QRKSGVQTFSTMSQDDDMKKINI--------IQQTDASST------TEDEEMLNSGSVHD 59

Query: 66  --VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLG 123
             VKR LKQRH                    PL ++GPVG+L+AY+F+GT+ ++VTQSLG
Sbjct: 60  AEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119

Query: 124 EMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPL 183
           EMATFIPVTSSF+VFA RFLSP++GAA GYMY+ SW  TFALELSVVGQI+ +WTF VP+
Sbjct: 120 EMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPI 179

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFR 243
           AAWISIFWV+LTA NMFPVKFYGE EFW+A++KV+A++GFLIY LC+VCGAG TGP+GFR
Sbjct: 180 AAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFR 239

Query: 244 YWRNPGAMGPGI------ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297
           YWRNPG  G G+      IS N    RFLGW +SLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 240 YWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRK 299

Query: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLP 357
            VPRAI+KV+ RILLFYIGSLFFIGL VP++DPKL+S DSYVSSSPFII I+N+GT++LP
Sbjct: 300 TVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGTKILP 359

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
            IFNA+IL TIISAGNSN+YVGSRILFS+AK GLAPK L++TT +GVP++SVLA + FG 
Sbjct: 360 DIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGV 419

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           L+YME + GG   F+WL+NIT +AGF+AWL I  SH+RFMQ LK RGISRDDLP+KA  M
Sbjct: 420 LAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLM 479

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWK 537
           P LAYYA+F MV+II+ QGFT+F P F   DF AAYISV LF + WG FQ++F+CR IWK
Sbjct: 480 PGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWK 539

Query: 538 LEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           LEDVDID++RR++E ++WED  PKT WDKFW+ VA
Sbjct: 540 LEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/549 (66%), Positives = 428/549 (77%), Gaps = 2/549 (0%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           +D D+  +   +   R    S +S+   +   +   ++E   VKR LK RH         
Sbjct: 60  SDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELKPRHIGMIALGGT 119

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                      P+ NAGPVG+L+AY+FMGT+VFSVTQSLGEMATFIPVTSSF+VFA RF+
Sbjct: 120 IGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFV 179

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVK 203
           S   GAA GYMY+ SW  TFALELSVVGQ+I+FWTFKVPLAAWISIFWVL+   N FPVK
Sbjct: 180 SDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVK 239

Query: 204 FYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEA 263
            YGEFEFW+ASIKV+A++GF+IY LC+VCGAG TGP+GFRYWR+PG  GPGIIS +  EA
Sbjct: 240 VYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEA 299

Query: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323
           RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI+KV +RILLFYI SLFFIGL
Sbjct: 300 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGL 359

Query: 324 TVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRIL 383
            VPYNDPKL+STDSYVS+SPFII IQN+GT+VLPHIFNAVILTTIISA NSNVYVGSRIL
Sbjct: 360 LVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRIL 419

Query: 384 FSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
           + ++   LAPKF  KT   GVP+++VL  +AFG+L+YME S GG  AFNWLLNITGVAGF
Sbjct: 420 YGLSSAKLAPKFFQKTR-NGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGF 478

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
           FAWL IS SH+RFMQ LKHRG+SRDDLPYKA  MP LAYY  FF+ +IILIQGFT+FAP 
Sbjct: 479 FAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPK 538

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTL 563
           F    F+ AYIS  LFL  +   Q YFR R+   L+DVDIDTDRR+I++V+WE + P+T 
Sbjct: 539 FDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRDIDTVIWE-EGPQTF 597

Query: 564 WDKFWDFVA 572
           WDKFW  +A
Sbjct: 598 WDKFWAVIA 606

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/551 (63%), Positives = 418/551 (75%), Gaps = 5/551 (0%)

Query: 22  DGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXX 81
           D   +D       ++   +  +   S  Y D    +D      +VKR+LK RH       
Sbjct: 43  DTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDA-----EVKRALKPRHISMIALG 97

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQR 141
                        PLA+AGPVGAL+AY+FMGT+ + VTQSLGEMATFIPVTSSF+VF QR
Sbjct: 98  GTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQR 157

Query: 142 FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP 201
           FLSPA G ANGY+Y+ SWC TFALELSVVGQIIQFWTF VPL AWI+IFWV+LT  N+FP
Sbjct: 158 FLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFP 217

Query: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTG 261
           VK+YGE EFWIA IKVLA++GF+IY+  +VCGAGKTGP+GFRYWRNPG  GPGIIS +  
Sbjct: 218 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVN 277

Query: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321
           E RFLGWVSSLINAAFTYQGTELVGITAGE+ NPR+ VPRAI KV  RIL FYI SL FI
Sbjct: 278 EGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFI 337

Query: 322 GLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSR 381
           GL VP+NDPKL S DSY+SSSPF+I I+N+GT+VLPHIFNAVIL+TIISAGNSN+YVGSR
Sbjct: 338 GLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSR 397

Query: 382 ILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVA 441
           +L+ +AKN LAPK  A+ T  GVPY+SVL  +AFG L+Y+ LS    K F+WLLNIT +A
Sbjct: 398 VLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIA 457

Query: 442 GFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFA 501
           GFFAWL IS +H+RFMQ LK R +SR+DLP+KA +MPW AYY+ FF+ +II+IQGFT+FA
Sbjct: 458 GFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFA 517

Query: 502 PHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPK 561
           P F+  +F AAYISV LFL  W  FQI FR R I    DVDIDTDRR+I+ +VWE++ PK
Sbjct: 518 PKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPK 577

Query: 562 TLWDKFWDFVA 572
             WDKFW  +A
Sbjct: 578 NAWDKFWAAMA 588

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/576 (59%), Positives = 433/576 (75%), Gaps = 22/576 (3%)

Query: 15  QDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH----------- 63
           +DI+ I    D++   S T    ++K      ST ++D  +    L              
Sbjct: 26  EDIEIIPSRYDNEKFYSATEATHKKK----TGSTGFDDTISLTHTLSRSRIPTSMEDEDA 81

Query: 64  -----HD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVF 116
                HD  VKR+LKQRH                    PL+N+GPVGAL+AY+FMGT+++
Sbjct: 82  EEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIY 141

Query: 117 SVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQF 176
            VTQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E+SV+GQ+IQ+
Sbjct: 142 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQY 201

Query: 177 WTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGK 236
           WTFKVPLAAWI IFWVL+T  N FPVK YGEFEFW+ASIKV+A++G+LIY+L IVCG   
Sbjct: 202 WTFKVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSH 261

Query: 237 TGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
            GPIGFRYWRNPGAMG GIISS+ GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 262 QGPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 321

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVL 356
           K+VPRAI KV+ RI+LFYI SLFF+GL VPYNDP+L+++ + ++SSPF+I+IQNAGT+VL
Sbjct: 322 KSVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVL 381

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P IFNAV+L T+ISA NSNVYVGSR+L+++A++G APK  A  T  GVPYL V+  +  G
Sbjct: 382 PDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLG 441

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++ ++     AFNWL+NI+ +AG  AWL IS +H+RFMQALK RGISRDDLP+KA +
Sbjct: 442 LLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKF 501

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW 536
           MPW AYYA FF+ VII IQGF +FAP F   +F  AYIS+ L +V +   Q+Y+RCR +W
Sbjct: 502 MPWGAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLW 561

Query: 537 KLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           KLED+DID+DRREI+++VWEDD P+ LW+KFW  VA
Sbjct: 562 KLEDIDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/543 (63%), Positives = 418/543 (76%)

Query: 30  NSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXX 89
           + N  ++      +S++    E  +       +   ++R+LK RH               
Sbjct: 13  HKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLF 72

Query: 90  XXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA 149
                PL +AGPVG+L++YLFMG++ F VTQSLGEMATFIPV SSF+VF +RFLSPALGA
Sbjct: 73  VGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGA 132

Query: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           ANGYMY  SWC TFALELS+VG+IIQ+WT  VP AAWI IFWV ++  N+  VKFYGEF+
Sbjct: 133 ANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQ 192

Query: 210 FWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWV 269
           FWIA IKV+A++GFLIY LC+VCGAGKTGP+GFRYWRNPG  G GIIS +  E RFLGWV
Sbjct: 193 FWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWV 252

Query: 270 SSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYND 329
           SSL+NAAFTYQGTELVG++AGE+ANPRK VP+AIRKV +RILLFY+GSLFFIGL VP+ND
Sbjct: 253 SSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFND 312

Query: 330 PKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKN 389
           PKL ST +Y +SSPFII IQN+GTR LP IFNAVILTTIISA NSNVYVGSR+L+ +AK 
Sbjct: 313 PKLDSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKE 372

Query: 390 GLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLI 449
           GLAPK + +    GVPY+ V  +S FG L Y+ +S+G AKAF+WLLNIT +AGFFAWL I
Sbjct: 373 GLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFI 432

Query: 450 SCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDF 509
           S  H+RFMQALK++GISRDDLP+KA  MPW AYYA FF+++II+IQGFT+FAP F+  +F
Sbjct: 433 SLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNF 492

Query: 510 VAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWD 569
            AAY+SV LF+  W  FQ+ F+ R+I K+EDVDID+DRREIE+ VWEDD P  LW KFW 
Sbjct: 493 FAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWA 552

Query: 570 FVA 572
            +A
Sbjct: 553 AMA 555

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/578 (59%), Positives = 427/578 (73%), Gaps = 11/578 (1%)

Query: 6   SDLKEKS-VIQDIDTIIDGNDSDS-----HNSNTGELGRRKRKTSV---SSTQYEDLATE 56
           S +KE + VI+ I+T    + SD        S   E+G     +++    +T   D    
Sbjct: 33  STMKENNEVIELINTNSFKDSSDKPPITLRKSKLSEIGSLHSGSNLHQHGTTSLHDDEES 92

Query: 57  KDELLEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
             E  ++ D  VKR+LKQRH                    PL+NAGPVG+L+AY+FMG+V
Sbjct: 93  DTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSV 152

Query: 115 VFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           V+ VTQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E+SV+GQ+I
Sbjct: 153 VYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 212

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           Q+WT  VPLAAWI IFWV++T  N FPVK YGEFEFWIASIKVLA+MG+LIY+L IVCG 
Sbjct: 213 QYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGG 272

Query: 235 GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
              GPIGFRYWRNPG  GPGIIS  TGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN
Sbjct: 273 SHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 332

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           PRK+VPRAI KV+ RI LFYI SLFFIGL VP+ND +L +  + ++SSPF+I+IQNAGTR
Sbjct: 333 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTR 392

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
            LP IFNAV+L TIISA NSNVYVGSR+L+++A  G APK  +  T  GVPY+ V+  +A
Sbjct: 393 ALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAA 452

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
            G L+++ ++     AFNWL+NI+ +AG  AWL IS SH+RFMQALK+RGISRDDLP+KA
Sbjct: 453 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKA 512

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
             MPW AYYA FF+ VII IQGF +F P F    F  +YIS+ L  V +   Q+Y+RCR 
Sbjct: 513 KLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRF 572

Query: 535 IWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           IWK+ED+DID+DRREIE+++WE+D PK LW+KFW +VA
Sbjct: 573 IWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/548 (63%), Positives = 425/548 (77%), Gaps = 5/548 (0%)

Query: 30  NSNTGELGRRKRKTSVSSTQYEDLAT---EKDELLEHHDVKRSLKQRHXXXXXXXXXXXX 86
           NS   +  R  +  +++    +D ++   + +  +   +VKR+LK RH            
Sbjct: 34  NSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGT 93

Query: 87  XXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPA 146
                   PL NAGPVG+L+A++ +GT+ +SVTQSLGEMATFIPVTSSF+VF+QRF+SPA
Sbjct: 94  GLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPA 153

Query: 147 LGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYG 206
           +GAANGYMY+ SW  TFALELS+VGQIIQ+WT  VPL AWI+IFWVLL +FNMFPVK+YG
Sbjct: 154 VGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYG 213

Query: 207 EFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFL 266
           EFEFW+ASIKV+A++GFLIYSLC+VCGAG  GPIGFRYWR PG  G GII+ N  +ARFL
Sbjct: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFL 273

Query: 267 GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVP 326
           GWVSSLI+AAFTYQGTELVGITAGE  NPRKAVPRAI KV  RIL+FYIGSLFFIGL VP
Sbjct: 274 GWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVP 333

Query: 327 YNDPKLTSTD--SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
           YNDPKL  +D  SY++ SPF+I I N  T VLPHIFNAVILTTIISAGNSNVYVGSRILF
Sbjct: 334 YNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILF 393

Query: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444
            ++KN LAPKF +KTT  GVP+++VL  + FG L+Y+ +S    + F+WLLNIT +AGF 
Sbjct: 394 GLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFI 453

Query: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF 504
            WLLIS SH+RFMQ LKHRGISRDDLPYKA +MP+ AYYA FF+ VII+IQGFT+FAPHF
Sbjct: 454 TWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHF 513

Query: 505 SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLW 564
           +  DF AAYISV LF + W  FQ  +R ++   L++VDID+DRR+I+ ++WE++ PK LW
Sbjct: 514 NVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLW 573

Query: 565 DKFWDFVA 572
           +KFW   A
Sbjct: 574 EKFWAVAA 581

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/567 (59%), Positives = 425/567 (74%), Gaps = 6/567 (1%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHN-SNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65
           D K+ +V  D + I++  DS S   ++         +  +SS +Y+    E     +   
Sbjct: 47  DKKDMTVTYD-NEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQEAE----FKDTK 101

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           VKR+LK RH                    PL  +GPVG+L+AY+FMGTVV+ VTQ+LGEM
Sbjct: 102 VKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEM 161

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAA 185
           ATFIPVTSS +VF+ RFLSPA G +NGY+Y+ +W  T+A+E+SVVGQ+I+FWT KVPLAA
Sbjct: 162 ATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAA 221

Query: 186 WISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYW 245
           WISIFWVL+TA N FPV  YGE EFW+AS+KVLA++G+LIY+L IVCG  K GPIGFRYW
Sbjct: 222 WISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIGFRYW 281

Query: 246 RNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRK 305
           R+  AMG G+IS +  EARFLGWV+SLINAAFTYQGTELVGITAGEAANPRK+VPRAI K
Sbjct: 282 RHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINK 341

Query: 306 VLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVIL 365
           V+ RI++FYI SLFFIGL VPYNDPKL S  SY++SSPF+I+I+NAGTR LPHIFNA+I+
Sbjct: 342 VVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFNAIIM 401

Query: 366 TTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELST 425
            TIISA NSNVYV SR+L+S+A +G APK  A+ T QGVP+L V+  +  G L+++ ++ 
Sbjct: 402 ITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNN 461

Query: 426 GGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAI 485
              +AFNWL+NI+ +AG  AWL IS SH+RFM+ALK+RGISRDDLP+KA +MP+ +YYA 
Sbjct: 462 NANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYAC 521

Query: 486 FFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDT 545
           FF+ VII IQGFT+F+P F    F  AYIS+ L  V +   Q+Y+RCR  WK+ED+DIDT
Sbjct: 522 FFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDT 581

Query: 546 DRREIESVVWEDDAPKTLWDKFWDFVA 572
           DRREI+ +VWEDD PKT WDKFW  VA
Sbjct: 582 DRREIDEIVWEDDEPKTAWDKFWAAVA 608

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/566 (60%), Positives = 428/566 (75%), Gaps = 11/566 (1%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDV 66
           +LK+K  +QD D I D       NS T  L R +    VS     D   E++   E   V
Sbjct: 57  NLKKKHGLQD-DAIAD------VNSTTNSLTRTQ---IVSHEAGADEEDEEEAHYEDKHV 106

Query: 67  KRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA 126
           KR+LKQRH                    PL+NAGPVG+L+AY+FMGTV++ +TQSLGEMA
Sbjct: 107 KRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGEMA 166

Query: 127 TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAW 186
           TFIPVTSS +VF++RFLSPA G +NGYMY+ +W  T+A+E+SV+GQ+IQ+WT KVPLAAW
Sbjct: 167 TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAAW 226

Query: 187 ISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWR 246
           I+IFWVL+T  N FPVK YGEFEFW+AS+KVLA++G+LIY+L IVCG    GPIGFRYWR
Sbjct: 227 IAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWR 286

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           NPGA GPGIIS N  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VPRAI KV
Sbjct: 287 NPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKV 346

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
           + RI++FYI SLFFIGL VPYN+P+L+ + + ++SSPF+I+IQNAGT  LP IFNAV+L 
Sbjct: 347 VFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVVLI 406

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           T+ISA NSNVYVGSR+L+S+A++G APK     T QGVPY+ VL+ +A G L+++ ++  
Sbjct: 407 TVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVNNN 466

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
              AFNWL++I+ +AG  AWL IS +H+RFMQALK RGISRDDLP+KA  MP+ AYYA F
Sbjct: 467 ANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYASF 526

Query: 487 FMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTD 546
           F+ +II IQGF +F P FS  +F  +YIS+ L  V +   Q+Y++CR IWKLED+DID+D
Sbjct: 527 FVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDIDSD 585

Query: 547 RREIESVVWEDDAPKTLWDKFWDFVA 572
           RREIE+++WEDD PK LW+KFW  VA
Sbjct: 586 RREIEAIIWEDDEPKNLWEKFWAAVA 611

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/549 (61%), Positives = 411/549 (74%), Gaps = 3/549 (0%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
            ++   +   G            S+Q   L +        + V+R LK RH         
Sbjct: 14  TETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHG---RNAVQRQLKPRHVSMIALGGT 70

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                      PL NAGPVGAL++YLFMG++ + VTQSLGEMATFIPVTSSF+VF +RFL
Sbjct: 71  IGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFL 130

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVK 203
           S  LGAANGYMY  SW  T+ALELS+VGQII++WT  VP AAWI+IFWV +T  N+ PVK
Sbjct: 131 SLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVK 190

Query: 204 FYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEA 263
           FYGEF+FWIA IKV+A++GFL+Y LC+VCGAGKTGP+GFRYWRNPG  G GIIS +  E 
Sbjct: 191 FYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEG 250

Query: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323
           RFLGWVSSL+NAAFTYQGTELVGI+AGE+ANPRK VP+AI KV  RILLFY+GSLFFIGL
Sbjct: 251 RFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGL 310

Query: 324 TVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRIL 383
            VP+ND KLTS+DSY + SPFII IQN+GT++LP IFNAVIL TIISA NSNVYVGSR+L
Sbjct: 311 LVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVL 370

Query: 384 FSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
           + +AK  LAP+F A+T   GVP ++VL ++ FG L Y+ +S G +KAF+WLLNIT +AGF
Sbjct: 371 YGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGF 430

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
           F+WL IS  HVRFMQALK +GISRDDLP+KA  MPW AYY+ FF+ +II+IQGFTS AP 
Sbjct: 431 FSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPT 490

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTL 563
           F+  +F AAYISV +FLV W  FQ ++R RII ++E VDID+DRRE+++  W++  P TL
Sbjct: 491 FNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDNTEPTTL 550

Query: 564 WDKFWDFVA 572
           W KFW  +A
Sbjct: 551 WGKFWAAMA 559

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/591 (57%), Positives = 432/591 (73%), Gaps = 21/591 (3%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLAT------ 55
           E    +L E  +  +++ I   N +  ++ +  +   +K+  S+      D+ +      
Sbjct: 22  EQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGAIADVNSITNSLT 81

Query: 56  -----------EKDELLEHHD---VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 101
                       +DE   H++   VKR+LKQRH                    PL+NAGP
Sbjct: 82  RLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGP 141

Query: 102 VGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCF 161
           VG+L+AY+FMGT+V+ VTQSLGEMATFIPVTSS +VF++RFLSPA G +NGYMY+ +W  
Sbjct: 142 VGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAI 201

Query: 162 TFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALM 221
           T+A+E+SV+GQ+I++WT KVPLAAWI+IFWV++T  N FPVK YGEFEFW+AS+KVLA+M
Sbjct: 202 TYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIM 261

Query: 222 GFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQG 281
           G+LIY+L IVCG    GPIGFRYWRNPGA GPGIISS+  E RFLGWVSSLINAAFTYQG
Sbjct: 262 GYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQG 321

Query: 282 TELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS 341
           TELVGITAGEAANPRK VPRAI KV+ RI+LFYI SLFFIGL VPYND +L+++ + ++S
Sbjct: 322 TELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIAS 381

Query: 342 SPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTL 401
           SPF+I+IQNAGT  LP IFNAV+L T++SA NSNVYVGSR+L+S+A+ G APK     T 
Sbjct: 382 SPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTR 441

Query: 402 QGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALK 461
           QGVPYL V+  +A G L+++ ++     AFNWL+NI+ +AG  AWL IS +H+RFMQALK
Sbjct: 442 QGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALK 501

Query: 462 HRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLV 521
           HRGISRDDLP+KA  MP+ AYYA FF+ VII IQGF +F P F   +F  +YIS+ L  V
Sbjct: 502 HRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAV 560

Query: 522 FWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
            +   QIY++CR IWKLED+DID+DRREIE+++WEDD PK LW+KFW  VA
Sbjct: 561 VFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/566 (60%), Positives = 427/566 (75%), Gaps = 6/566 (1%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDV 66
           D K+ ++ +    ++DG   D  NS T  L R    + ++S +      E++   E   V
Sbjct: 52  DEKQDNLKKKSGLMLDGTIGDI-NSITNSLTR----SQIASHEQGGDDEEEEAHYEDKHV 106

Query: 67  KRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA 126
           +R+LKQRH                    PL+NAGPVG+L+AY+FMGTVV+ VTQSLGEMA
Sbjct: 107 RRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMA 166

Query: 127 TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAW 186
           TFIPVTSS +VF++RFLSPA G +NGYMY+ +W  T+A+E+SV+GQ+I++WT KVPL  W
Sbjct: 167 TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKVPLGVW 226

Query: 187 ISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWR 246
           I+IFWVL+T  N FPVK YGEFEFW+AS+KVLA+MG+LIY+L IVCG  K GPIGFRYWR
Sbjct: 227 IAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIGFRYWR 286

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           NPGA GPGIISS+  E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VPRAI KV
Sbjct: 287 NPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKV 346

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
           + RI+LFYI SLFFIGL VPY DP+L+++ + ++SSPF+I+IQNAGT  LP IFNA++L 
Sbjct: 347 VFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFNAIVLI 406

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           T+ISA NSNVYVGSR+L+S+A+ G APK     T QGVPYL VL+ +A G L+++ ++  
Sbjct: 407 TVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNN 466

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
              AFNWL+NI+ +AG  AWL IS SH+RFMQAL  RGISRDDLP+KA +MP+ AYYA F
Sbjct: 467 ANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAYYASF 526

Query: 487 FMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTD 546
           F+ VII IQGF SF P F   DF  +YIS+ L  V +   Q+Y++CR IWKLED+DID+D
Sbjct: 527 FVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDSD 585

Query: 547 RREIESVVWEDDAPKTLWDKFWDFVA 572
           RREIE+++WEDD PK LW+KFW  VA
Sbjct: 586 RREIEAIIWEDDEPKNLWEKFWAAVA 611

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/574 (59%), Positives = 427/574 (74%), Gaps = 8/574 (1%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSH-NSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           E G   + ++ ++ D   +   N  ++  NS T  L R +      +T +ED   E+ E 
Sbjct: 31  ENGIETINDEKIVFDKKKLAHTNQFNADINSITHSLTRSR-----IATHHEDDQEEEAEE 85

Query: 61  LEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSV 118
            ++HD  VKR+LKQRH                    PL N+GPVG+L+AYLFMG++++ +
Sbjct: 86  AQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFI 145

Query: 119 TQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT 178
           TQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  TFA+E+SVVGQ+I++WT
Sbjct: 146 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWT 205

Query: 179 FKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTG 238
            KVPLAAWI+IFWVL+T  N FPVK YGE EFWIA IKVLA+MG+L+Y+L IVCG    G
Sbjct: 206 DKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQG 265

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
           PIGFRYWRNPG  GPGIIS +    RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 
Sbjct: 266 PIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 325

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPH 358
           VPRAI KV+ RI LFYI SLFFIG+ VPYND +L ST + ++SSPF+I+IQNAGT+VLP 
Sbjct: 326 VPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
           IFNA+++ TIISA NSNVYVGSR+L+++A +G APK  A  T  GVPYL V+  SA G L
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           +++ ++     AFNWL+NI+ +AG  AWL IS SH+RFMQALK RGISRDDLP+KA  MP
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 479 WLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL 538
           + AYYA FF+ VII IQGF +F+PH+    F  +YIS+ +  V +   QI++RCR  W++
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRV 565

Query: 539 EDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           ED+DID+DRREIE+V+WEDD PKTLWDKFW  VA
Sbjct: 566 EDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/551 (60%), Positives = 413/551 (74%), Gaps = 5/551 (0%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL---EHHDVKRSLKQRHXXXXXX 80
           ND  + +S + ++   +++T             + E L   +  DVKR LK RH      
Sbjct: 17  NDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISL 76

Query: 81  XXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQ 140
                         P+  AGPVG+L+AYLFMGT+ F VTQSLGEMATFIPVTSSF+++ Q
Sbjct: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136

Query: 141 RFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMF 200
           RFLSPALGAANGY+Y+ SWC TFALELS++GQ+IQ+WTF VPL+ WI +FW+LLTA NM 
Sbjct: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMI 196

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNT 260
           PV+FYGE EFWIA++KVL++ GFLIY+L +VCG    G +GFRYW+NPG  G G+ISSN 
Sbjct: 197 PVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNK 256

Query: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320
            EARFLGWVSSLI AAFTYQGTELVGITAGE+ NPRK VP+AI KV  RIL FYI SLFF
Sbjct: 257 YEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFF 316

Query: 321 IGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379
           +GL VPY DP+L T++DS +++SPF++ IQN+GT+VLP +FN VIL TI+SAGNSN+Y+G
Sbjct: 317 VGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIG 376

Query: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439
           SR+L+ ++K+GLAP    KT  QGVP+ +VL  S FG L+Y+ +S    K F+WLL IT 
Sbjct: 377 SRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITA 436

Query: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499
           VAGFFAWLLIS SH+RFMQ LK RGISR+DLP+KA +MPW AYYA FF+ VIILIQGF S
Sbjct: 437 VAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDS 496

Query: 500 FAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVW-EDD 558
           FAP F   +F+A YISV LF+V W  FQ+ F+ R+I + EDVDIDTDRREI+++VW +DD
Sbjct: 497 FAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDD 556

Query: 559 APKTLWDKFWD 569
            PKTL  K W 
Sbjct: 557 EPKTLLQKLWQ 567

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/593 (57%), Positives = 432/593 (72%), Gaps = 31/593 (5%)

Query: 10  EKSVIQDIDT--------IIDGNDS-DSHNSNTGELGRRKRK----TSVSSTQYEDLATE 56
           EK  IQ++ T        +ID +D   S+ ++  +   +K++     +++S      +  
Sbjct: 21  EKHSIQEVSTDQIEHEMEVIDAHDKLSSYCTDEKQYNMKKKRLLQDDAIASVNLITNSLP 80

Query: 57  KDELLEHH-----------------DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           + ++  H                   VKR+LKQRH                    PL+ A
Sbjct: 81  RSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKA 140

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSW 159
           GPVG+L++Y+FMGTVV+ +TQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W
Sbjct: 141 GPVGSLISYIFMGTVVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNW 200

Query: 160 CFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLA 219
             T+A+E+SV+GQ+IQ+WT KVPLA WI+IFWVL+T  N FPVK YGEFEFW+AS+KVLA
Sbjct: 201 AITYAVEVSVIGQVIQYWTDKVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLA 260

Query: 220 LMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY 279
           +MG+LIY+L IVCG    GPIGFRYWRNPGA GPGIISS+  E RFLGWVSSLINAAFTY
Sbjct: 261 IMGYLIYALVIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTY 320

Query: 280 QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV 339
           QGTELVGITAGEAANPRK VPRAI KV+ RI+LFYI SLFFIGL VPYN+P+L+++ + +
Sbjct: 321 QGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVI 380

Query: 340 SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT 399
           +SSPF+I+IQNAGT  LP IFNAV+L T+ISA NSNVYVGSR+L+S+A+ G APK     
Sbjct: 381 ASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYV 440

Query: 400 TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQA 459
           T QGVPYL VL+ +A G L+++ ++     AFNWL+NI+ +AG  AWL IS +H+RFMQA
Sbjct: 441 TKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQA 500

Query: 460 LKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLF 519
           L+ RGISRDDLP+KA  MP+ AYYA FF+ VII IQGF +F P F   DF  +YIS+ L 
Sbjct: 501 LEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILL 559

Query: 520 LVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
            V +   Q+Y++CR IWKLED+DIDTDRREIE+++WEDD PK LW+KFW  VA
Sbjct: 560 AVVFTGCQLYYKCRFIWKLEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/513 (64%), Positives = 401/513 (78%), Gaps = 2/513 (0%)

Query: 62  EHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVT 119
           ++HD  VKR+LKQRH                    PL N+GPVG+L+AYLFMG++++S+T
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           QSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E+SVVGQ+I++WT 
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
           KVPLAAWI+IFWV +T  N FPVK YGE EFWIA +KVLA+ G+L+Y+L IVCG    GP
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGP 274

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IGFRYWRNPG  G GIIS +   +RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+V
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           PRAI KV+ RI LFYI SLFFIGL VPY+DP+L+S  + V+SSPF+I+IQNAGT++LP I
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDI 394

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
           FNA+++ T+ISA NSNVYVGSR+L+++A+ G APK  A  T  GVPYL VL  +A G L+
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++ ++     AFNWL+NI+ +AG  AWL IS SH+RFMQALK RGISRDDLP+KA +MPW
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLE 539
            AYYA FF+ VII IQGF +F+PHF    F  AYIS+ +  V +   QIY+RCR  WKLE
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 540 DVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           D+DIDTDRREIE V+WEDD PKT WDKFW  VA
Sbjct: 575 DIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/518 (62%), Positives = 400/518 (77%), Gaps = 1/518 (0%)

Query: 55  TEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
           TE+   ++   VKR+LKQRH                    PL NAGPVGAL+AY+FMG++
Sbjct: 83  TEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSI 142

Query: 115 VFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           ++ +TQSLGEMATFIPVTSS +VF++RFLSPA G  NGYMY+ +W  T+A+E+SVVGQ+I
Sbjct: 143 IYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVI 202

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           Q+WT  VPLAAWI+IFWV +T  N FPVK YGE EFW+ASIKVLA++G+LIY+L IVCG 
Sbjct: 203 QYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGG 262

Query: 235 GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
              GPIGFRYWRNPG  GPGIIS +  E RFLGWVSSLINAAFTYQGTELVGITAGEAAN
Sbjct: 263 SSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 322

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           PRK+VPRAI KV+ RI LFYI SLFFIGL VPYND  L+S DSY++SSPF+I+IQNAGT 
Sbjct: 323 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTY 382

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
            LP IFNAV++ TIISA NSNVYVGSR+L+++A+ G APK  A  T  GVP+L V+  ++
Sbjct: 383 ALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTAS 442

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
            G L+++ ++     AFNWL+NI+ +AG  AW  I+ SH+RFMQALK+RGISRDDLP+KA
Sbjct: 443 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKA 502

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
             MPW AYY+ FF+ VII IQGF +F P +    F  +YIS+ L +V +   Q+Y+RCR 
Sbjct: 503 KLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRF 561

Query: 535 IWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           + K+ED+DIDTDRREIE+++WEDD PK LW+KFW +VA
Sbjct: 562 LLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/563 (58%), Positives = 415/563 (73%), Gaps = 4/563 (0%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69
           EK  +Q +  +     +D H S TG L R +  + V      D + E +  +    VKR+
Sbjct: 39  EKIRLQKLKHV--STQADVH-SVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETKVKRA 95

Query: 70  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFI 129
           LKQRH                    PL+ AGPVG+L+AY+FMGT+++ VTQSLGEMATFI
Sbjct: 96  LKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFI 155

Query: 130 PVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISI 189
           PVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E+SV+GQ+IQ+WT  VPLAAWI+I
Sbjct: 156 PVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAI 215

Query: 190 FWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPG 249
           FWVL+T  N FPVK YGE EFWIA +KVLA++G+LIY+L IVCG    GPIGFRYWR+PG
Sbjct: 216 FWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPG 275

Query: 250 AMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIR 309
           A GPGIIS N    +FLGWV+SLINAAFTYQGTELVGITAGEAANPRK VPRAI KV+ R
Sbjct: 276 AFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFR 335

Query: 310 ILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTII 369
           I+LFYI SLFFIG+ +PYND +L++ D+ ++SSPF+I+I+NA T+VLP IFNAV++ T++
Sbjct: 336 IVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVM 395

Query: 370 SAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAK 429
           SA NSNVYVGSR+L+++A  G APK  +  T  GVPYL V+  ++ G L+++ ++     
Sbjct: 396 SAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANT 455

Query: 430 AFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMV 489
           AFNWL+NI+ +AG  AWL IS +H+RFMQALK RGISRDDLP+KA  MPW AYYA FF+ 
Sbjct: 456 AFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVT 515

Query: 490 VIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRRE 549
           VII IQG+ +F P +    F  +YIS+ L  V     Q+Y+R R + KLED+DIDTDRRE
Sbjct: 516 VIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRRE 574

Query: 550 IESVVWEDDAPKTLWDKFWDFVA 572
           IES+VWEDD PKTLWDKFW + A
Sbjct: 575 IESIVWEDDEPKTLWDKFWAWAA 597

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/524 (62%), Positives = 405/524 (77%), Gaps = 2/524 (0%)

Query: 51  EDLATEKDELLEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAY 108
           + L  E  E   +HD  VKR+LKQRH                    PL+NAGPVG+L+AY
Sbjct: 50  DGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAY 109

Query: 109 LFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELS 168
           LFMG++V+ +TQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E+S
Sbjct: 110 LFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 169

Query: 169 VVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSL 228
           V+GQ+IQFWT  VPLAAWI+IFWV ++  N FPVK YGE EFW+ASIKV+A++G+LIY+L
Sbjct: 170 VIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYAL 229

Query: 229 CIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288
            IVCG    GPIGFRYWRNPG  GPGIIS +  E RFLGWVSSLINAAFTYQGTELVGIT
Sbjct: 230 VIVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGIT 289

Query: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITI 348
           AGEAANPRK+VPRAI KV+ RI++FYI SLFF+G+ VP+NDP+L S  + ++SSPF+I+I
Sbjct: 290 AGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISI 349

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           QNAGTRVLPHIFNAV++ TIISA NSNVYVGSR+L+++++ G APK     T  GVPYL 
Sbjct: 350 QNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLG 409

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           V+A S  G L+++ ++     AFNWL+NI+ +AG  AWL IS SH+RFMQALK RGISRD
Sbjct: 410 VIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRD 469

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQI 528
           DLP+KA  MPW AYYA FF+ VII IQGF +F+P F    F  AYIS+ + +V     Q+
Sbjct: 470 DLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQL 529

Query: 529 YFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           Y+RCR +WKLED+DIDTDRREIE ++WE++ P+ LW+KFW  +A
Sbjct: 530 YYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/579 (56%), Positives = 418/579 (72%), Gaps = 21/579 (3%)

Query: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           +EI  +D K+ S+ + I            NS    L     ++ V     ED A E D  
Sbjct: 33  IEIQHNDSKDNSIKKKIP-----------NSELASLTHAYSRSRVEPEHDED-AEEAD-- 78

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
            E   VKR LKQRH                    PLA+AGPVGAL+AY+FMG++V+ VTQ
Sbjct: 79  YEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQ 138

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
           +LGEMATFIPVTSS +VF+QRFLSPA G ANGYMY+ +W  TFA+E+SVVGQ+IQ+WT  
Sbjct: 139 ALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDA 198

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGP 239
           VPLAAWI+IFWVL+T  N FPVK YGE EFW+A +KV+A++G+L+Y+L IVCG + K GP
Sbjct: 199 VPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGP 258

Query: 240 IGFRYWRNPGAMGPGIIS------SNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAA 293
           IGFRYWRNPGA G G+ S      S+  E RFLGWV+SLINAAFTYQGTELVGITAGEAA
Sbjct: 259 IGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAA 318

Query: 294 NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGT 353
           NPRK VPRAI KV+ RI+LFYI SLFFIGL VP+ D +L+   + ++SSPF+I+I+NAGT
Sbjct: 319 NPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGT 378

Query: 354 RVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAIS 413
           ++LP IFNA+++ T++SA NSNVYVGSR+L+S+A   +APK  A+ T QGVP++ V+  S
Sbjct: 379 KILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTS 438

Query: 414 AFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYK 473
             G L+++ +      AFNWL++I+ +AG  AWL IS +HVRFMQ LK RGISRDDLP+K
Sbjct: 439 LLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFK 498

Query: 474 ALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533
           A +MPW +YYA F++ VII +QGF +F+PHF    F   YIS+ L  V +   Q+Y+RCR
Sbjct: 499 AKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCR 558

Query: 534 IIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
            +WKLEDVDID+DRREIE  +WEDD PKT+WDKFW  +A
Sbjct: 559 FLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/542 (57%), Positives = 403/542 (74%), Gaps = 3/542 (0%)

Query: 34  GELGRRKRKTSVSSTQYEDLATEKDELLEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXX 91
           G  G      S++    ++   E ++  ++H+  VKR+LK RH                 
Sbjct: 26  GNNGSEIALESITPDSGDEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIV 85

Query: 92  XXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAAN 151
              PL  AGPVG+L+AY+FMGTVV+S+TQSLGEMATFIPVTSS +VF++RFLSPA G AN
Sbjct: 86  IASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVAN 145

Query: 152 GYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFW 211
           GYMY+ +W  TFA+ELSVVGQII +WT  VPL AWI+IFW+++T  N FPV+FYGE EFW
Sbjct: 146 GYMYWFNWAITFAVELSVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFW 205

Query: 212 IASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSS 271
           IAS+KV+ ++G+LIY+  +VCG    GPIGFR WRNPG  G G+ISSN  EARFLGWVSS
Sbjct: 206 IASVKVITIVGYLIYAFIVVCGGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSS 265

Query: 272 LINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPK 331
           LI AAFTYQGTELVGITAGE+ NPRK VP+AI KV  RIL FYI SLFF+GL VPYNDP+
Sbjct: 266 LIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPR 325

Query: 332 LTST-DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNG 390
           + +T D+ V++SPF+I+I+NAGT++LP IFNAV+L T++SA NSNVY+GSR+++S+A++G
Sbjct: 326 MDNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSG 385

Query: 391 LAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLIS 450
            APK        GVP L V+  +  G ++++ ++     AFNWL+NI+ +AG  AWL IS
Sbjct: 386 NAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFIS 445

Query: 451 CSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFV 510
            +H+RFMQ LK RGISRD LP+KA +MPW AYYA  F+ VII IQG+T+F+P F    F 
Sbjct: 446 LAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFF 505

Query: 511 AAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDF 570
            AYIS+ L LV +   QIY++CR +WKLED+DIDT+RREI+++VWEDD PK LWDKFW  
Sbjct: 506 TAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWST 565

Query: 571 VA 572
           +A
Sbjct: 566 IA 567

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/542 (59%), Positives = 407/542 (75%), Gaps = 1/542 (0%)

Query: 28  SHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHH-DVKRSLKQRHXXXXXXXXXXXX 86
           S  S  GE         VSS  Y+   +E+ E   H  +VKR+LK RH            
Sbjct: 34  SKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGT 93

Query: 87  XXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPA 146
                   PL+ +GPVG+L+AY+FMG+VV+ VTQSLGEMATFIPVTSS +VF++RFLSPA
Sbjct: 94  GLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPA 153

Query: 147 LGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYG 206
            G ANGYMY+ +W  T+A+ELSV+GQII +WT  VPLAAWI+IFWVLLTA N FPVK+YG
Sbjct: 154 FGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYG 213

Query: 207 EFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFL 266
           EFEF +ASIKV+A++G+L+Y+L IVCG    GPIGFRYWRNPG  G G I+ N  +ARFL
Sbjct: 214 EFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFL 273

Query: 267 GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVP 326
           GWV SL+NA+FTYQGTELVGITAGEA+NPRK VP+AI KV  RIL+FYIGSLFF+GL VP
Sbjct: 274 GWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVP 333

Query: 327 YNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386
           YN P+L S  + ++SSPF+I+IQNAGT+VLP IFNAV+L TI+SAGNSNVYVGSR+L+S+
Sbjct: 334 YNSPQLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSL 393

Query: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
           A +G APK  +  T QGVPYL V+  +  G L+++  +     AFNWL+NI+ +AG  AW
Sbjct: 394 ALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAW 453

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG 506
             IS +H+RFMQ LK RGISRD LP+KA  MPW AYYA FF+ +I+ IQGFT+FAP F  
Sbjct: 454 FFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDV 513

Query: 507 RDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDK 566
            +F  AYIS+ L +V +   Q+Y+RCR + K+ED+DID+DRREI++++WEDD PK LW+K
Sbjct: 514 SEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEK 573

Query: 567 FW 568
           FW
Sbjct: 574 FW 575

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/519 (61%), Positives = 393/519 (75%), Gaps = 1/519 (0%)

Query: 55  TEKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGT 113
           TE  E  ++   VKR+LK RH                    PL+ +GPVGAL+AY+FMGT
Sbjct: 103 TESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGT 162

Query: 114 VVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQI 173
           VV+ VTQS+GEMATFIPVTSS +VF+ RFLSPA G ANGYMY+ +W  TFA+ELSV GQ+
Sbjct: 163 VVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQV 222

Query: 174 IQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG 233
           I++WT  VP AAWI+IFWVL+T  N FPV+FYGE EFW+ASIKVLA++G+LIY+L IVCG
Sbjct: 223 IEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCG 282

Query: 234 AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAA 293
             K GPIGFRYWRNPG  G GIIS +  E RFLGWV+SLINA+FTYQGTELVGITAGEAA
Sbjct: 283 GSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAA 342

Query: 294 NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGT 353
           NPR+ VPRAI KV  RIL FYI SLFF+GL VPYN   L  T + ++SSPF+I+IQNAGT
Sbjct: 343 NPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGT 402

Query: 354 RVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAIS 413
           R LP IFNAV+L TIISA NSNVYVGSR+LFS+A  G+APK  +  T QGVP++ V+  S
Sbjct: 403 RALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTS 462

Query: 414 AFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYK 473
             G L+++ ++    +AFNWL+NI+ +AG  AWL IS SH+RFMQ LK RGISRDDLP+K
Sbjct: 463 LLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFK 522

Query: 474 ALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533
           +  MP+ AYYA F++ VII +QGF +F+PHF   +F  +YIS+ L +V +   Q+++RCR
Sbjct: 523 SKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCR 582

Query: 534 IIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
              +LED+DID+DRRE ++++WEDD P TLW KFW  VA
Sbjct: 583 FFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/523 (62%), Positives = 404/523 (77%), Gaps = 1/523 (0%)

Query: 51  EDLATEKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYL 109
           ++   EK E      +VKR+LK RH                    PL+ +GPVGAL+AY+
Sbjct: 40  DNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYI 99

Query: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           F+G++V+ VTQSLGEMATFIPVTSS +VF++RFLSPA G ANGYMY+ +W  T+A+E++V
Sbjct: 100 FIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAV 159

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
           VGQ+IQ+WT  VPLAAWI+IFWVL+T  N FPVKFYGE EFW+AS+KV+A++G+LIY+L 
Sbjct: 160 VGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALV 219

Query: 230 IVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           IVCG    GPIGFRYWRNPG  GPGIIS +  E RFLGWVSSLINAAFTYQGTELVGITA
Sbjct: 220 IVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITA 279

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQ 349
           GEAANPRK VPRAI KV  RIL FYI SLFFIGL VPY+D +L++T + ++SSPF+I+IQ
Sbjct: 280 GEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQ 339

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           NAGT+VLPHIFNA+++ TIISA NSNVYVGSR+L+S+A +G APK     T QGVPYL V
Sbjct: 340 NAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGV 399

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
           +  +  G L+++ ++    +AFNWL+NI+ +AG  AWL IS SHVRFMQ LKHRGISR+D
Sbjct: 400 IVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISRED 459

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIY 529
           LP+KA  MPW AYYA FF+ VII+IQGF +F P F   DF  +YIS+ L  V +   Q++
Sbjct: 460 LPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLF 519

Query: 530 FRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           +RCR IW L+D+DID+DRREI+++VWEDD PK LW+KFW  VA
Sbjct: 520 YRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/518 (60%), Positives = 390/518 (75%), Gaps = 1/518 (0%)

Query: 56  EKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
           E DE  L+   VKR+LK RH                    PL++AGPVGAL+AY+FMG++
Sbjct: 43  EDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSI 102

Query: 115 VFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           V+ VTQS+GEMATFIPVTSS +VF+ RFLSPA G ANGYMY+ +W  T+A+E+SV+GQ+I
Sbjct: 103 VYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 162

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           Q+WT  VPLAAWI IFWV +T  N FPV+FYGE EFW+ASIKV+A++G+L+Y+L IVCG 
Sbjct: 163 QYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGG 222

Query: 235 GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
            K GPIGFRYWRNPG  G GIIS +  + RFLGWV+SLINA+FTYQGTELVGITAGEAAN
Sbjct: 223 SKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAAN 282

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           PRK VP+AI KV  RIL FYI SLFF+GL VPYN P L    S ++SSPF+I+IQ+AGTR
Sbjct: 283 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTR 342

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
           +LP IFNAV+L TIISA NSNVYVGSRILFS+A  G+APK  +  T QGVPYL V+  + 
Sbjct: 343 ILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTAL 402

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
            G L+++ +     + FNWL+NI+ +AG  AWL IS SH+RFMQ LK RGISRDDLP+K+
Sbjct: 403 LGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKS 462

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
             MP+ AYYA F++ VII +QGF +F P F   +F   YIS+ L  V +   Q+Y+RCR 
Sbjct: 463 KLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRF 522

Query: 535 IWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
             +LED+DID+DRREI++++WE++ P TLW KFW  VA
Sbjct: 523 FNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 399/560 (71%), Gaps = 15/560 (2%)

Query: 27  DSHNSNTGELGR--RKRKTSVSSTQYEDLATEKDELLEHH---------DVKRSLKQRHX 75
           D+  S T    R  +K KT  +  + + +     E  E H         +VKR+LK RH 
Sbjct: 5   DTAVSETSTRSRYIKKGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHI 64

Query: 76  XXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSF 135
                              PL  AGPVG+L+AY+F+GTVV+S+TQSLGEMATFIPVTSS 
Sbjct: 65  SMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSV 124

Query: 136 SVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLT 195
           +VF++RFLSPA G ANGYMY+ +W  TFA+ELSVVGQIIQ+WT +VP+AAWI IFWVL+T
Sbjct: 125 TVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVT 184

Query: 196 AFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGI 255
             N FPV+FYGE EFWIAS+KVL ++G+LIY+  IVCG  K GPIG        A G   
Sbjct: 185 LVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARG-AR 243

Query: 256 ISSNTGEAR--FLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLF 313
            SS T   R  FLGWVSSLI AAFTYQGTELVGITAGE+ NPRK VP+AI KV  RIL F
Sbjct: 244 ASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFF 303

Query: 314 YIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAG 372
           YIGSL F+GL VPY+DP+L S  S  V++SPF+I+I+NAGT++LP IFNAV+L T+ISA 
Sbjct: 304 YIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAA 363

Query: 373 NSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFN 432
           NSNVY+GSR+ +S+A  G APK LA  T QGVPY  VL  S  G +S++ L+   + AF+
Sbjct: 364 NSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFD 423

Query: 433 WLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVII 492
           WL+NI+ +AG  AWL IS +H+RFMQ LKHRGISRDDLP+KA +MPW AYYA FF+ VII
Sbjct: 424 WLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVII 483

Query: 493 LIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552
            IQG+T+F P F    F  +YIS+ L L+ +   QIY++CR +W +ED+DID+DRREI++
Sbjct: 484 FIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDA 543

Query: 553 VVWEDDAPKTLWDKFWDFVA 572
           +VWE+D PK +WDKFW  VA
Sbjct: 544 IVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/513 (59%), Positives = 383/513 (74%), Gaps = 3/513 (0%)

Query: 62  EHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVT 119
           + HD  VKR+LK RH                    PL+ +GPVG+L+AY+FMG+VV+ VT
Sbjct: 96  KFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVT 155

Query: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           QSLGEMATFIPVTSS +VF +RFLSPALG +NGYMY+ +W  TFA ELSV GQIIQ+WT+
Sbjct: 156 QSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTY 215

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
           KVPLAAWI IFWV++   N FPVK YGE EFW++S+KVLA++G+LIY+L IVCG  + GP
Sbjct: 216 KVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGP 275

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IGFRYWR+  A G G IS N  EARFLGWVSSLINAAFTYQGTELVGI+AGEAANPRK V
Sbjct: 276 IGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTV 335

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           PRAI KV+ RI LFYI SLFFIGL VPYND +L+   + ++SSPF+I++ NAGT  LP I
Sbjct: 336 PRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALPDI 395

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
           FNAVIL T++SA NS+VY+ SR+L+++A  G APK        GVPYL V      G L+
Sbjct: 396 FNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLA 455

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++ +S     AFNWL+NI+ +AG  AW  I  +H+RFMQALKH+GISRDDLP+KA +MPW
Sbjct: 456 FLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPW 515

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLE 539
            AYYA FF+ +II IQG+ +F P +  + F  +YIS+ LF V +    IY+R R++ K+E
Sbjct: 516 GAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKIE 574

Query: 540 DVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572
           D+DIDTDR+E+E+ VWE+DAP+  W+KFW  VA
Sbjct: 575 DIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/549 (56%), Positives = 406/549 (73%), Gaps = 9/549 (1%)

Query: 22  DGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXX 81
           DG+ S +  +  G +  +    + ++++ E L  + ++     DVKR LK RH       
Sbjct: 11  DGSSSSTITAKPGAI--KAEVLNHNTSEVESLCEKPNQ----SDVKRELKPRHVTMISLG 64

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQR 141
                        P+ NAGPVG+L+AY+F+ T+ + VTQSLGEMATFIPVTSSF+VFA R
Sbjct: 65  GTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASR 124

Query: 142 FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP 201
           F+SPALGAANGY+Y+LSWC TFALE+SV+G++I +W+  VP+ AW++IFWVLLTA N+ P
Sbjct: 125 FVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIP 184

Query: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTG 261
           VKFYGEFEFWIAS+KV+A++ FL Y L +VCG  K G IGFRYW++PG  G GI+S    
Sbjct: 185 VKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIH 244

Query: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321
            A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+ VP+AI  V  RILLFYIGSL  I
Sbjct: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304

Query: 322 GLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379
           GL V Y+DP+L    S    ++SPF++ I  AGT+VLP I N VI+ TIISAGNSN+YVG
Sbjct: 305 GLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVG 364

Query: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439
           SR+L+ + ++GLAP F+++TT +GVPY++VLA S FG+L Y+ +S+     F+WLL+IT 
Sbjct: 365 SRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITA 424

Query: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499
           V+GFF WLLIS SH+RFMQ LK RGISRDDLP+KA +MP+ AYYA FF++VIIL+QGFT+
Sbjct: 425 VSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTA 484

Query: 500 FAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDA 559
           F P FS  DFVA YIS  +F+V W  FQ  F+ R    ++++DIDTDRR+I++++W+DD 
Sbjct: 485 FTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDDK 543

Query: 560 PKTLWDKFW 568
           P TLW K W
Sbjct: 544 PTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  356 bits (914), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/538 (35%), Positives = 308/538 (57%), Gaps = 14/538 (2%)

Query: 38  RRKRKTSVSSTQYEDLATE-KDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPL 96
            +   +S++S + ED + +  D   +   +K+ LK RH                     L
Sbjct: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTAL 80

Query: 97  ANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYF 156
              GP   L+AY F+G +VF V   LGEMAT+IP+   F+ +A R+  PALG A GY Y 
Sbjct: 81  RTGGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYL 139

Query: 157 LSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214
             +      +L+    +IQ+W  +  V    WI+IF V++   N   V+++GEFEFW++S
Sbjct: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199

Query: 215 IKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273
            K++ + G +++   I+ G G     +GFRYW+NPGA  P   S    + +F+ +V+  +
Sbjct: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFV 259

Query: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL- 332
            A F Y G EL GI A EA NPR+ +PRAI+  + RI+LFYI ++F +G+ V YNDP+L 
Sbjct: 260 YALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLL 319

Query: 333 --TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNG 390
                 +  ++SPF++ IQN+G R LPHIFN  +L  + SA NS++YVG+R L+S+A +G
Sbjct: 320 AAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDG 379

Query: 391 LAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLIS 450
            APK  AKT   GVPY ++     F  L+YM +S+G A+ FN+ +N+  + G  +W+ I 
Sbjct: 380 KAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISIL 439

Query: 451 CSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFV 510
            +++ F +A   + + R+   Y+A + P+ AY  +FF V+I  I+ FT F   F  + F+
Sbjct: 440 ITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFI 499

Query: 511 AAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563
             YI + L+++F+  ++I ++ +++ K E+ D+ +     DR E E  + E +A + L
Sbjct: 500 TGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDREEAEGKIKEAEAKERL 556

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/534 (37%), Positives = 301/534 (56%), Gaps = 21/534 (3%)

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
            + +  E H +K+ L+ RH                     L+  GP G L +Y+ +  V+
Sbjct: 39  SESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVI 98

Query: 116 FSVTQSLGEMATFIPVTS-----SFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
           + V  +LGEM  ++P +      S S    R+  P+LG A G+ Y+  +    A E +  
Sbjct: 99  YPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAA 158

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
             ++ +WT  VP AAWI+IF  ++T  N  PVKFYGE EFW A +K+L ++G L  S  +
Sbjct: 159 SGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFIL 218

Query: 231 VCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGIT 288
             G G +   +GFRYW+ PGA    I + NTG  RFL   + +I   F +  G ELV +T
Sbjct: 219 FWGGGPSHDRLGFRYWQKPGAFAYHITTGNTG--RFLDVWTGVIKGGFAFILGPELVAVT 276

Query: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP----KLTSTDSYVSSSPF 344
           + EA + R+ + +A R+   R++ FY+ S   IG+ V  NDP     L S  +  +SSPF
Sbjct: 277 SSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPF 336

Query: 345 IITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGV 404
           +I IQNA  ++LPHI NA IL++  S+GNS ++  SR L SMA++G+APK   K    GV
Sbjct: 337 VIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGV 396

Query: 405 PYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRG 464
           PY +V   +AF  L+Y+ +S+G AKAF W  NI+ ++GF  W+ I  +++RF +A+  RG
Sbjct: 397 PYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRG 456

Query: 465 ISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFW 523
           +  D +P+K+ + P+  Y+ I  + +I L  G+ +F P F  G DFVAAYI++ +F+V W
Sbjct: 457 L-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 524 GFFQIYFRCRIIW--KLEDVDIDTDRREIESVVWEDDA----PKTLWDKFWDFV 571
              +IY R    W   + +VD+ T   EIE +  E DA    P + W+KF D++
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMDWL 569

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  349 bits (896), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/520 (35%), Positives = 305/520 (58%), Gaps = 13/520 (2%)

Query: 44  SVSSTQYEDLATEKDELL----EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           S  S++ ED   + D +     EH  +++ LK RH                     L  A
Sbjct: 60  STVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTA 119

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSW 159
           GP+   +AY F+G +VF    +LGEMA++IP+   F+ +A R+  PALG A GY Y   +
Sbjct: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKY 178

Query: 160 CFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
                 +L+    +IQ+W  +  V    WI+IF V++ A N   VKF+GEFEFW+++ KV
Sbjct: 179 LILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKV 238

Query: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
           + ++G +I    I+ G G T   +GFR++ +PGA  P   S +  + +F+ +V+ L+ A 
Sbjct: 239 IVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYAL 298

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP---KLT 333
           F Y G EL GI A EAANPRK++P+AI+  + RI++FY+ ++F +G+ V Y+DP   K  
Sbjct: 299 FAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAK 358

Query: 334 STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393
           ++ +  ++SP+++ I N+G + LPHIFNA +L  + SA NS++YV SR L+ +A +  AP
Sbjct: 359 TSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP 418

Query: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453
           K  A T   GVPY S+L  S F  L+YM +S+G AK FN+ +N+  + G  +W+ I  ++
Sbjct: 419 KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITY 478

Query: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAA 512
           + F +A+K + + R    Y+A + P+ +Y+ + F ++I  I+ FT F   HF  ++F+  
Sbjct: 479 LCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITG 538

Query: 513 YISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552
           YI + +F++ +  ++   + + IWK E+VD+ T +  I+ 
Sbjct: 539 YIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/514 (36%), Positives = 303/514 (58%), Gaps = 14/514 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           E+  +++ LK RH                     L   GPV  L+AY F+G +VF     
Sbjct: 78  ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMAC 137

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK- 180
           LGEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    +IQ+W  + 
Sbjct: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 181 -VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
            V    WI+IF V++ A N+  VKF+GEFEFW++S KV+ ++G ++    I+ G G    
Sbjct: 197 RVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHD 256

Query: 240 -IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            +GFRYWR+PGA      +   G+ +F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---VSSSPFIITIQNAGTRV 355
           VP+AI+  + RI++FY+ ++F +G+ V YNDP+L ST       ++SPF++ IQN+G  V
Sbjct: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           LPHIFNA +L  + SA NS++YV SR L+++A +G APK  AKT+  GVPY +++    F
Sbjct: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
             L+YM +S+G AK FN+ +N+  + G  +W+ I   ++ F +A + +GI +    Y A 
Sbjct: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
              + AY+A+FF ++I LI+ FT F  H F  + F+  YI + ++++ W  +++ ++ ++
Sbjct: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556

Query: 535 IWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563
           I K  DVD+ T     DR E E  + + +  + L
Sbjct: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  344 bits (883), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/569 (35%), Positives = 323/569 (56%), Gaps = 31/569 (5%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL--EHHD-- 65
           + S  +D++ I+  +++ S +    +L  +           +D+++++  L     HD  
Sbjct: 5   QDSYRKDLEKIVSNSNTTSKDVENLDLSNQ-----------DDISSQESHLNIDGKHDGI 53

Query: 66  -VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124
            +K+ L+ RH                     L+ AGPV  L+AY F+G +V+ V   LGE
Sbjct: 54  RLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGE 113

Query: 125 MATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--KVP 182
           MAT+IP+   F+ +A R+  PALG A GY Y   +      +L+    ++Q+W    KV 
Sbjct: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IG 241
              WI+IF V++   N+  VKF+GEFEFW++S KVL ++  ++    I+ G G +   +G
Sbjct: 173 PGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232

Query: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301
           FR++++PGA  P   + +  + +F+ +V+  + A F Y GTEL GI A E  NPR+ VPR
Sbjct: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292

Query: 302 AIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRVLPH 358
           AI+  L RI++FY+ ++F +G+TV YNDP L       +S   SPF++ I+NAG  VLPH
Sbjct: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPH 352

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
           IFNA +L  + SA NS++YV SR L+ +A +  APK  AKT   GVPY S++    F  L
Sbjct: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           +YM +S+G A+ FN+ +N+  + G  +W+ I  +++ F +AL+ +G+ +  L Y A    
Sbjct: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472

Query: 479 WLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLV-FWGFFQIYFRCRIIW 536
             AY+A+FF  +I LI+ FT F  H F  ++F+  YI + +F++ F+G+   Y R     
Sbjct: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGY--KYIRGTKFV 530

Query: 537 KLEDVDIDTDRREIESVVWEDDAPKTLWD 565
           K E+ D+ T +  I+    E++  K LWD
Sbjct: 531 KPEEADLYTFKELID---LEEEEGK-LWD 555

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 305/510 (59%), Gaps = 15/510 (2%)

Query: 62  EHHD-VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           +H D +K++L+ RH                     L+ AGP    +AY F+G +VF    
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
           ++GEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    +IQ+W  +
Sbjct: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212

Query: 181 --VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KT 237
             V    WI+IF V++   N+  VKF+GEFEFW++S KVL ++G ++    ++ G G   
Sbjct: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDH 272

Query: 238 GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297
             +GFRYW++PGA  P   + +    +F+ +VS  + A F Y G EL GI A EA NPRK
Sbjct: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332

Query: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD---SYVSSSPFIITIQNAGTR 354
           +VPRA++  + RI++FY+ ++F +G+ V YNDP+L +     +  ++SPF++ IQN+G R
Sbjct: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIR 392

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
           VLPHIFNA +L  + SA NS++YVGSR L+S+A +G AP    +TT  G+P+ S+     
Sbjct: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
           F  L+YM +S+G A+ FN+ +N+  + G  +W+ I  +++ FM+A+K +G+ R    Y A
Sbjct: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533
            + P+  Y+++ + V I  I+ FT F  H F  ++F+  YI + +F++F+  ++   + +
Sbjct: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572

Query: 534 IIWKLEDVDIDT-----DRREIESVVWEDD 558
           I+ K  +VD+ T     D++EIE  + + +
Sbjct: 573 IV-KSHEVDLFTGKEVFDQQEIEGKILDQE 601

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/585 (33%), Positives = 320/585 (54%), Gaps = 37/585 (6%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65
           +DL+++S    I + ++ N     +S    +G R          ++D  TE   L     
Sbjct: 18  TDLQKQSDQVTISSDLEQNSISIASSRNSSIGDRD--------IFDDGKTEGFRL----- 64

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
            K++LK RH                     LA AGP    + Y F+G +VF     LGEM
Sbjct: 65  -KKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPL-- 183
           A FIP+   F+ +A R++ PALG A GY Y   +    A +L+    ++Q+W  +  L  
Sbjct: 124 AAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNP 182

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGF 242
             +I+IF +L+   N+F VK +GEFEFW++S KVL ++G ++    I+ G G     +GF
Sbjct: 183 GVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGF 242

Query: 243 RYWRNPGAMGP---GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           RYWR+PG+  P    IIS +    +F+ + S  + A F Y G EL GI A EA NPRK +
Sbjct: 243 RYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNI 302

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDP---KLTSTDSYVSSSPFIITIQNAGTRVL 356
           P+AI+  + RI++FY+ ++  + + V YNDP   K T   +  ++SPF++ I+N+G  +L
Sbjct: 303 PKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINIL 362

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHIFN  +L  ++SA NS++YV SR L+S+A +  APKF  KT   G+PY S+   +AF 
Sbjct: 363 PHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFS 422

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+YM +S+  +  FN+ +N   + G  +W+ I  +++ F +A K +G+ + +  Y A W
Sbjct: 423 CLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPW 482

Query: 477 MPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRII 535
            P+ AY+A+FF  V+ L++ FT F    F  ++F+  YI + +F + +  ++I ++ +  
Sbjct: 483 QPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTK-T 541

Query: 536 WKLEDVDIDT-----DRREIESVVWEDDAPKTL------WDKFWD 569
            + E+VD+ T     D+ E +  + + +  + L      W  F+D
Sbjct: 542 HRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYD 586

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  340 bits (872), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/523 (36%), Positives = 304/523 (58%), Gaps = 17/523 (3%)

Query: 53  LATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
           +A  KDE   +  +K+ LK RH                     L   GPV  L+AY F+G
Sbjct: 70  IADGKDE---NTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVG 126

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
            +VF     LGEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    
Sbjct: 127 LLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185

Query: 173 IIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
           +IQ+W  +  V    WI+IF V++ A N+  VKF+GEFEFW++S KV+ ++G ++    I
Sbjct: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFII 245

Query: 231 VCGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           + G G     +GFRYWR+PGA      +      +F  +V+  + + F+Y G EL GI  
Sbjct: 246 MLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVC 305

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---VSSSPFII 346
            EA NPRK+VP+AI+  + RI++FY+ ++F +G+ V YNDP+L ST       ++SPF++
Sbjct: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365

Query: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406
            IQN+G +VLPHIFNA +L  + SA NS++YV SR L+++A +G APK  AKT+  GVPY
Sbjct: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425

Query: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466
            +++    F  L+YM +S+G AK FN+ +N+  + G  +W+ I   ++ F +A + +GI 
Sbjct: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485

Query: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGF 525
           +    Y A    + AY+A+ F ++I LI+ FT F  H F  + F+  YI + ++++ W  
Sbjct: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAG 545

Query: 526 FQIYFRCRIIWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563
           +++ ++ ++I K  DVD+ T     DR E E  + + +  + L
Sbjct: 546 YKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 295/513 (57%), Gaps = 17/513 (3%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K+ LK RH                     L  AGP   L+AY F+GT+VF    +LGEM
Sbjct: 82  LKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEM 141

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK--VPL 183
           A +IP+   F+ +A R+  PALG A GY Y   +      +L+    +IQ+W  +  V  
Sbjct: 142 AAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNP 200

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGF 242
             WI+IF V++ A N   VK++GEFEFW++S K++ ++G +I+   I+ G G     +GF
Sbjct: 201 GVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGF 260

Query: 243 RYWRNPGAMGP---GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           RYW+ PGA  P    +++      +F+ +V+  + A F Y G EL GI A EA NPR+ +
Sbjct: 261 RYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNI 320

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTRVL 356
           PRAI+  + RIL FY+ ++F +G+ V Y+DP L    +  +  ++SPF++ IQN+G  VL
Sbjct: 321 PRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVL 380

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHIFN  +L  + SA NS++YVG+R L+S+A +G APK  AKT   GVPY ++     F 
Sbjct: 381 PHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFC 440

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+YM +S+G A+ FN+ +N+  + G  +W  I  + + F +A++ +GI R    Y A +
Sbjct: 441 LLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPF 500

Query: 477 MPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRII 535
            P+ +Y+A+FF V++ LI+ F+ F    F  + F+  YI + ++   +  +++Y++ + +
Sbjct: 501 QPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTV 560

Query: 536 WKLEDVDIDT-----DRREIESVVWEDDAPKTL 563
            K  + D+++     DR E E  + E +  + L
Sbjct: 561 -KPHEADLNSYKAAVDREEEEGKIKEAERKERL 592

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/541 (35%), Positives = 306/541 (56%), Gaps = 14/541 (2%)

Query: 24  NDSDSHNSNTGELGRRKR-----KTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXX 78
           +D+     N G L   +       T  S  Q   ++   D   E   +K+ L+ RH    
Sbjct: 3   SDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMI 62

Query: 79  XXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVF 138
                            LA+AGPV  L++Y F+G +V++V   LGEMA FIP+   F+ +
Sbjct: 63  AIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSY 121

Query: 139 AQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTA 196
           A R++ PA+G A GY Y   +      +L+    ++QFW  +  V    WI+IF  L+  
Sbjct: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181

Query: 197 FNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGI 255
            N   V+F+GEFEFW++S+KVL ++G ++    I+ G G      GFR+WR+PGA  P  
Sbjct: 182 INTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYS 241

Query: 256 ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI 315
            + +  + +F+ + S    A F Y GTEL GI A EA NPR++VPRAI+  L RI++FY+
Sbjct: 242 EAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYV 301

Query: 316 GSLFFIGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRVLPHIFNAVILTTIISAG 372
            ++  +G+TV YNDP+L       +S   SPF++ I+NA   VLPHIFN  +L  + SA 
Sbjct: 302 ITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSAC 361

Query: 373 NSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFN 432
           NS++YV SR L+ +A +G AP+  A T   GVPY S+     F  L+YM +S+G A+ FN
Sbjct: 362 NSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFN 421

Query: 433 WLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVII 492
           + +N+  + G  +W+ I  +++RF +A++ +   +  L Y A + PW  Y A+FF  +I 
Sbjct: 422 YFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIG 481

Query: 493 LIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIE 551
           LI+ +T F  H F  + F++ YI + ++L+ +  +++ +R ++I K EDVD+ T +  I+
Sbjct: 482 LIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAID 540

Query: 552 S 552
           +
Sbjct: 541 A 541

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  335 bits (859), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/553 (34%), Positives = 313/553 (56%), Gaps = 15/553 (2%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSS-TQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXX 82
            + + +N +  E     R ++ +S +  +D     D   E   +++ LK RH        
Sbjct: 38  KEQEIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGG 97

Query: 83  XXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRF 142
                        L   GPV  L+AY F+G +VF     LGEMA++IP+   F+ +A R+
Sbjct: 98  SLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRY 156

Query: 143 LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMF 200
           + PALG A GY Y   +      +L+    +IQ+W  +  V    WI+IF V++ A N+ 
Sbjct: 157 VDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVI 216

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KTGPIGFRYWRNPGAMGPGIISSN 259
            VKF+GEFEFW++S KVL ++G ++    I+ G G     +GFRYWR+PGA      +  
Sbjct: 217 GVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIG 276

Query: 260 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLF 319
            G+ +F+ +++  + + F+Y G EL GI   EA NPRK+VP+AI+  + RI++FY+ ++F
Sbjct: 277 GGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVF 336

Query: 320 FIGLTVPYNDPKLTSTDSYV---SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNV 376
            +G+ V YNDP+L ST       ++SPF++ IQN+G +VLPHIFNA +L  + SA NS++
Sbjct: 337 LLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDL 396

Query: 377 YVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLN 436
           YV SR L+++A +G APK  +KT   GVPY +++    F  L+YM +S G AK FN+ +N
Sbjct: 397 YVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVN 456

Query: 437 ITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQG 496
           +  + G  +W+ I   ++ F +A + +GI +    Y A    + AY+A+ F + I LI+ 
Sbjct: 457 VVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKN 516

Query: 497 FTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDT-----DRREI 550
           FT F  H F  + F+  YI + +++  W  +++ ++ ++I K  DVD+ T     DR E 
Sbjct: 517 FTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI-KSTDVDLYTFKEIYDREEE 575

Query: 551 ESVVWEDDAPKTL 563
           +  + + +  + L
Sbjct: 576 QGKIEDQEKEERL 588

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/568 (33%), Positives = 319/568 (56%), Gaps = 17/568 (2%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65
            D++++ +  D + +I+ +    ++  +    +    TS   +  +++ T   E    HD
Sbjct: 18  EDIEKQQLFGDDNIVIERSSQLFYDGQSDS--KVHGITSGHGSDVKNVVTHTSEFDGKHD 75

Query: 66  ---VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
              +K++L+ RH                     LA AGP   L+AY F+G +VF V   L
Sbjct: 76  GIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCL 135

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--K 180
           GEMA +IP+   F+ ++ R+  PALG A GY Y   +      +L+    +IQ+W    K
Sbjct: 136 GEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDK 194

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240
           V    WI+I  V +   N   V+F+GE E++I+++K+  ++G +I  L + CG G    +
Sbjct: 195 VNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEV 254

Query: 241 -GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
            GF+YW+NPGA      +    + RF+ + S  + A F Y GTEL GI   E  NPRKAV
Sbjct: 255 LGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAV 314

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---VSSSPFIITIQNAGTRVL 356
           P+AI+  + RI++FY+ S+F +G+ VP+NDP L S  S     S+SPF++ I NAG  VL
Sbjct: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVL 374

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHI NA IL  + SA NS++YV SR L+ +A +  AP+  AKT  QGVPY S+L    F 
Sbjct: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+YM +S+G ++ F + +N   + G  +W+ I  +++RF +A + +GI +  L Y++  
Sbjct: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494

Query: 477 MPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRII 535
            P+ A++++FF ++I LI+ F +F    F  + F+  YI +  +++ +  ++++++ +II
Sbjct: 495 QPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKII 554

Query: 536 WKLEDVDIDTDRREIESVVWEDDAPKTL 563
              E+VD+ + +   E+V  E++  K L
Sbjct: 555 -PSEEVDLVSFK---EAVDLEEEEGKML 578

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/553 (37%), Positives = 313/553 (56%), Gaps = 20/553 (3%)

Query: 25  DSDSHNSNTGELGRRKRKTSVS-STQYEDL--ATEKDELLEHHDVKRSLKQRHXXXXXXX 81
           DS +  +   EL     + ++S ST  ED   +   D   E   +K+ L+ R        
Sbjct: 27  DSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIG 86

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQR 141
                         LA AGPV  L+AY F+G +VF    SLGEMA++IP+   F+ +A R
Sbjct: 87  GSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATR 145

Query: 142 FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT--FKVPLAAWISIFWVLLTAFNM 199
           +  PALG A GY Y   +      +L+    +IQ+W    KV    WI+IF V++ A N 
Sbjct: 146 YADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINT 205

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMG--PGII 256
             V+F+GEFEFW++S KVL +   +I    ++ G G     +GFR+W++PGA       I
Sbjct: 206 LGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAI 265

Query: 257 SSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
           + +TG  +F+ +VS  + A F Y GTELVGI  GEA NPRK+VP+AI+  + RI++FY+ 
Sbjct: 266 TGDTG--KFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLI 323

Query: 317 SLFFIGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRVLPHIFNAVILTTIISAGN 373
           S+  +G+ V Y+DP L    +  +S   SPF++ I N+G +VLPHIFNA +L  + SA N
Sbjct: 324 SILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACN 383

Query: 374 SNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNW 433
           S++YV SR L+S+A +  APK  A+T   G+PY S+     F  L+YM +S+G AK FN+
Sbjct: 384 SDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNY 443

Query: 434 LLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIIL 493
            +N+  + G  +W+ I  +++ F +A++ +GI +    Y A    + AY+A+FF  +I L
Sbjct: 444 FVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIAL 503

Query: 494 IQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR----R 548
           I+ FT F  H F  + F+  YI + +F + +  +++ ++ +II  LE VD+ T +    +
Sbjct: 504 IKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLE-VDLYTFKAAIDQ 562

Query: 549 EIESVVWEDDAPK 561
           E E    ED A K
Sbjct: 563 EEEDGKLEDIARK 575

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/514 (35%), Positives = 296/514 (57%), Gaps = 14/514 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           E   +++ LK RH                     L   GPV  L+AY F+G +VF     
Sbjct: 76  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMAC 135

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK- 180
           LGEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    +IQ+W  + 
Sbjct: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRD 194

Query: 181 -VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KTG 238
            V    WI+IF V++ A N+  V+F+GEFEFW++S KV+ ++G ++    I+ G G    
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            +GFRYWR+PGA      +    + +F+ + S  + + F+Y G EL GI   EA NPRK+
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKS 314

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRV 355
           VP+AI+  + RI++FY+ ++F +G+ V YNDP+L ST     S   SPF++ IQN+G +V
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKV 374

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           LPHIFN  +L  + SA NS++YV SR L+++A +G APK  AKT+  GVPY +++    F
Sbjct: 375 LPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLF 434

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
             L+YM +S G AK FN+ +N+  + G  +W+ I   ++ F +A + +G+ +    Y A 
Sbjct: 435 CCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAP 494

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
              + AY+A+FF ++I LI+ FT F  H F  + F+  YI + +++  W  +++ ++ ++
Sbjct: 495 GQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKV 554

Query: 535 IWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563
           + K  D D+ T     DR E +  + + +  + L
Sbjct: 555 V-KPADADLYTLKEIYDREEEQGKLQDQEKEERL 587

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/595 (32%), Positives = 313/595 (52%), Gaps = 32/595 (5%)

Query: 1   MEIGPSDLKEKSVIQDIDTI-IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDE 59
           +E  PS   E   + D++   ++ +DS     N  + G  K  T  S T    L  +   
Sbjct: 14  LEDIPSSKNELKELGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYTN 73

Query: 60  LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVT 119
            L     K+ LK RH                     L   GP G  +AY  + +V++ + 
Sbjct: 74  TL-----KQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIM 128

Query: 120 QSLGEMATFIP-----VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
            ++GEM  ++P        S +   +R++  +L  A G+ YF  +    A E +    ++
Sbjct: 129 NAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVV 188

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           ++WT  VP AAWI+IF  ++   NM  VK++GE EFW ASIK+L +MG +I S  +  G 
Sbjct: 189 EYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGG 248

Query: 235 GKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEA 292
           G +   +GFRYW+NPGA    +   + G   FL   S +I  AF +  G ELV +T+ E 
Sbjct: 249 GPSHDRLGFRYWKNPGAFAHHVTDGSLGN--FLDIYSGIIKGAFAFILGPELVALTSSEC 306

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSPFIITI 348
           ++ R+ + +A ++ + R++ FYI     IG+ V +NDP L S  S       SSPF+I I
Sbjct: 307 SDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGI 366

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           QNAG  VLPHI NA ILT+  S+GN+ ++  SR LF+MA+NG APK   +    GVPY++
Sbjct: 367 QNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMA 426

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           V+  +    L+Y+  S+  A+ F WL NI+ ++GF  W+    +++RF +A+ +  +  D
Sbjct: 427 VILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YD 485

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQ 527
            +P+K    P+L  +++  + +I +  G+ +F P F +  DF+AAYI++ +FL  +   +
Sbjct: 486 RMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHK 545

Query: 528 IYFR-------CRIIWKLEDVDIDTDRREIESVVWEDDA----PKTLWDKFWDFV 571
           +Y          ++ + +ED+D+ T   EIE+   E D     P   W++F D++
Sbjct: 546 VYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERFIDWL 600

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/502 (37%), Positives = 293/502 (58%), Gaps = 9/502 (1%)

Query: 58  DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           D   E   +K++L+ RH                     LA+AGP   L++Y F+G +V++
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
           V   LGEMA FIP+   F+ +A R++ PALG A GY Y   +      +L+    ++Q+W
Sbjct: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 178 TF--KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG 235
               KV    WI+IF VL+   N   V+F+GEFEFW++S+KVL ++G ++    I+ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 236 KTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
                 GFRYWR+PGA  P   + +  + +F+ + S    A F Y GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP---KLTSTDSYVSSSPFIITIQNA 351
           PR++VPRAI+  L RI+LFY+ S+  +G+TV YNDP   K     +  ++SPF++ I+NA
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLA 411
           G  VLPHIFNA +L  + SA NS++YV SR L+ +A +  APK  AKT   GVPY S+  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 412 ISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLP 471
              F  L+YM +S+G A+ FN+ +N+  + G  +W+ I  +++RF +A+  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 472 YKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYF 530
           Y A + PW  + ++FF  +I LI+ +T F  H F  + F++ YI + ++ + +  +++  
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 531 RCRIIWKLEDVDIDTDRREIES 552
           R ++I K EDVD+ T +  I++
Sbjct: 522 RSKLI-KPEDVDLYTFKAAIDA 542

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/519 (36%), Positives = 288/519 (55%), Gaps = 21/519 (4%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K+ L+ RH                     L+  GP G L +Y+ +  V++ V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 126 ATFIPVTS-----SFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
             F+P ++     S S    R+  P+LG A G+ Y+  +    A E +    ++ +WT  
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP- 239
           VP  AWI+IF  ++T  N  PVK YGE EFW A +K+L ++G L  S  +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKA 298
           +GFRYW++PGA    I + NTG  RFL   + +I   F +  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNTG--RFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST----DSYVSSSPFIITIQNAGTR 354
           + +A R+   R++ FY+ S   IG+ V   DP L +      +   SSPF+I IQNA  +
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
           VLPHI NA IL++  S+GNS ++  SR L SMA++G AP+ L +   QGVPY +V   +A
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
           F  L+++ +S+G AKAF W  NI+ ++GF  W+ I  ++++F +A+  RG+  + +P+K+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
              P+  Y+ I  + +I L  G+ SF  +++  DFVAAYI++ +F+V W   +IY R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 535 IWKL--EDVDIDTDRREIESVVWEDDA----PKTLWDKF 567
            W L   +VD+ T   EIE      DA    P   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 302/533 (56%), Gaps = 12/533 (2%)

Query: 35  ELGRRKRKTSVSSTQYEDLATE-KDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXX 93
           E+   +   S+  +  + LA+E  D   E   +K+ LK RH                   
Sbjct: 33  EVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATG 92

Query: 94  XPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGY 153
             L  AGPV  L+AY F+G +VF     LGEMATFIP+   F+ +A R+  PALG A GY
Sbjct: 93  ESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGY 151

Query: 154 MYFLSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFW 211
            Y + +      +L+    ++Q+W  +  V    W+++ + ++T  N+F V+F+GEFEFW
Sbjct: 152 AYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFW 211

Query: 212 IASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVS 270
           ++S+KVL ++G +I    I+ G AG    +GFRYW++PGA        +    +F+ +V+
Sbjct: 212 LSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVA 271

Query: 271 SLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP 330
            L+   F Y G EL GI A EA+NPR++VP+AI+    RIL+FY+ S+F +G+ VPYND 
Sbjct: 272 VLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDE 331

Query: 331 KL-TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKN 389
           KL T+ ++ +++SPF I I NAG  VLP IFN  +L  + SA NS++YV SR L+S+A +
Sbjct: 332 KLVTTNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVD 391

Query: 390 GLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLI 449
             APK  A T   G+PY S+     F  L+YM +S+  A+ F + +N+  +AG   W+ I
Sbjct: 392 NKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISI 451

Query: 450 SCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDF 509
             +++ F +A++ + + +    Y A + P+ AY ++FF  +I +I+ FT F  HF  + F
Sbjct: 452 LITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTF 511

Query: 510 VAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDT-----DRREIESVVWED 557
           +  YI + +F++ +  ++I  +   I     VD+ +     DR ++E  + E 
Sbjct: 512 ITGYIGLPIFVLCYFGYKITCKSE-IRSARYVDLVSQKSLVDREQVEYELIEQ 563

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/526 (35%), Positives = 303/526 (57%), Gaps = 22/526 (4%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K+ L+ RH                     L+ AGP+  L+AY  MG VVF+V   LGEM
Sbjct: 58  LKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEM 117

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--KVPL 183
           A +IP+   F+ +A R+  PALG A GY Y   +      +L+    ++Q+W    KV  
Sbjct: 118 AAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNP 176

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT-GPIGF 242
             WI++F  ++   N+  VKF+GEFEFW++S KVL ++  +   L +V G G +   +GF
Sbjct: 177 GVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGF 236

Query: 243 RYWRNPGAMGP--GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           RYW++PG   P  G +S   G+ +F+ + S  + A F Y GTEL GI A E  NPR+ VP
Sbjct: 237 RYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVP 296

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRVLP 357
           RAI+  L RI++FY+ ++F +GL+V YNDP L  T    +S   SP+++ I+NAG  VLP
Sbjct: 297 RAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVLP 356

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           HIFNA +LT + SA NS++YVGSR L+ +A +  APK  AKT   GVPY S+   + F  
Sbjct: 357 HIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCC 416

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           L+YM +S+     F++ +N+T + G  +W+ I  +++ F +A + +GI ++ L Y+A + 
Sbjct: 417 LAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQ 476

Query: 478 PWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW 536
           P  A+ A+ F +++ L++ FT F    F  + F+  YI + ++++ +  ++I  + + I 
Sbjct: 477 PVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWI- 535

Query: 537 KLEDVD-------IDTDRRE--IESVVWEDDAPKT--LWDKFWDFV 571
           K  +VD       ID +  E  +E +  +++  +    W +F+D++
Sbjct: 536 KSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYI 581

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/544 (34%), Positives = 293/544 (53%), Gaps = 29/544 (5%)

Query: 43  TSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 102
           T   S  Y D+          H++K+ LK RH                     L   GP 
Sbjct: 60  TEKHSPHYTDMTG--------HELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPA 111

Query: 103 GALVAYLFMGTVVFSVTQSLGEMATFIPVTSS----FSVF-AQRFLSPALGAANGYMYFL 157
           G  ++Y  + +V++ + Q +GEM  ++P + S    F+ +   +++  +LG A+ + Y+ 
Sbjct: 112 GLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYY 171

Query: 158 SWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
            +    A E +    ++++WT  VP AAWI+IF   +   N   VKFYGE EFW ASIK+
Sbjct: 172 CYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKI 231

Query: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
           L ++G +I S  +  G G     +GFRYW+NPG     I   + G   FL   + +I   
Sbjct: 232 LCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGS--FLDIYTGIIKGG 289

Query: 277 FTY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST 335
           F +  G E++ +T+ E  + R+ + +A R+ + R++ FYI     I + V YNDP L + 
Sbjct: 290 FAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENA 349

Query: 336 DSY----VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGL 391
            +       SSPF+I IQNAG +VLPHI NA IL++  SAGN+ ++  SR L +MA+NG 
Sbjct: 350 LAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQ 409

Query: 392 APKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISC 451
           AP+  AK    GVPY +V   SA   L+Y+  S+  A  FNW  NI+ ++GF  W+ +  
Sbjct: 410 APRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCI 469

Query: 452 SHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFV 510
           +++RF +A+   G+ +  LPY A  MP+L Y+ +  + +I L  G+  F P F   ++FV
Sbjct: 470 AYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFV 528

Query: 511 AAYISVGLFLVFWGFFQIYFRCRII----WK-LEDVDIDTDRREIESVVWEDDAPKTLWD 565
           AAYI++ +F V W   ++Y R +I     WK +E++D+ T   EIE    E DA + L  
Sbjct: 529 AAYITLPVFWVLWIGHRVYRR-KIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPT 587

Query: 566 KFWD 569
           K+W+
Sbjct: 588 KWWE 591

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  325 bits (832), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/522 (36%), Positives = 306/522 (58%), Gaps = 13/522 (2%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           +R  S +S+Q E+ +   D   E   +K++LK RH                     LA A
Sbjct: 42  ERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALA 101

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSW 159
           GPV  L+AY F+G +VF     LGEMAT+IP+   F+ +A R+  PALG A GY Y   +
Sbjct: 102 GPVSTLIAYAFVGLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKY 160

Query: 160 CFTFALELSVVGQIIQFWT--FKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
                 +L+    +IQ+W    KV    W++IF V++ + N+F V+F+GEFEFW++S KV
Sbjct: 161 FILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKV 220

Query: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGP--GIISSNTGEARFLGWVSSLIN 274
           L ++G ++    ++ G G     +GFRYWR+PG+       I+ +TG  RF+ +VS  + 
Sbjct: 221 LVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTG--RFVAFVSVFVY 278

Query: 275 AAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP---K 331
           A + Y G EL GI A EA NPRK++P+AI+  + RI++FY+ S+F +G+ V Y+DP   K
Sbjct: 279 ATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIK 338

Query: 332 LTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGL 391
             ++ +  ++SPF++ I N+G   LPHI NA +L  + SA NS++YV SR L+S+A +  
Sbjct: 339 AKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNK 398

Query: 392 APKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISC 451
           APK  AKT   G+PY ++     F  L+YM +S+  AK FN+ +N+  + G  +W+ I  
Sbjct: 399 APKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILI 458

Query: 452 SHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFV 510
           +++ F +A++ +G+ +    Y A + P+ A++++FF  +I LI+ FT F  H F  ++F+
Sbjct: 459 TYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFI 518

Query: 511 AAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552
             YI + +F   +  ++  ++ ++I  L+ VD+ T +  I+ 
Sbjct: 519 TGYIGLPVFFFCYFGYKFTYKTKVIDPLK-VDLYTFKAAIDQ 559

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  315 bits (808), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/541 (34%), Positives = 285/541 (52%), Gaps = 19/541 (3%)

Query: 39  RKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLAN 98
            K KT  S T  E+L T+     E++ + + L+ RH                     L N
Sbjct: 20  HKVKTPHSRTSLEELETQSAGS-EYNTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHN 78

Query: 99  AGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLS 158
            G    L++++ + T+V+ +  SL EM  ++P   S      R++ P+LG A G+ Y  +
Sbjct: 79  CGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYA 138

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           +    A ELS    ++ +W   VP+AAWI+IF V++   N   VK+YGE EFW ASIK++
Sbjct: 139 YAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLI 198

Query: 219 ALMGFLIYSLCI-VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            ++G L+ S+ I   GA      GFRYW+NPG     +   +TG  RFL    ++I +AF
Sbjct: 199 CILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTG--RFLDVWRAVIKSAF 256

Query: 278 TY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
            +    EL+GI   EA + R+   +A R+ + RI+ FY+     IG+ +   DPKL    
Sbjct: 257 AFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEAL 316

Query: 337 SY----VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLA 392
                  +SSPF+  I NAG  VL H+ N  IL++  SAGNS +Y  +R++ ++A+ G A
Sbjct: 317 ETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNA 376

Query: 393 PKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCS 452
           PKFL K    GVPY +V+  +    L+Y+ + T  A  F WL NI  ++GF  W  +  +
Sbjct: 377 PKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIA 436

Query: 453 HVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR----D 508
            +RF + +    + +  +PY+    P++AYY  F  VV+ L  GF  F     GR    D
Sbjct: 437 FIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVF---LKGRWNVVD 492

Query: 509 FVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTD--RREIESVVWEDDAPKTLWDK 566
           FVAAY+++ ++LV +   +++FR R    +E +D+ T     E ES +     PK LW+K
Sbjct: 493 FVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEK 552

Query: 567 F 567
           F
Sbjct: 553 F 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/567 (32%), Positives = 294/567 (51%), Gaps = 25/567 (4%)

Query: 27  DSHNSNTGELGRRKRKTSVSSTQYEDLAT---EKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           D +N     +    ++++ S+T  E L     + D       +++ LK RH         
Sbjct: 35  DKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGA 94

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-----VTSSFSVF 138
                       LA  GP G  ++Y+ + +VV+ +    GEM  ++P      + S +  
Sbjct: 95  IGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHL 154

Query: 139 AQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFN 198
             R++  +LG A  + Y+  +    A E +    ++++WT  VP   WI IF  ++   N
Sbjct: 155 VARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILN 214

Query: 199 MFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIIS 257
             PVK+YGE EFW ASIK+L ++G +I S  +  G G     +GFRYW+ PGA    I+ 
Sbjct: 215 FGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMK 274

Query: 258 SNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
              G  RFL   S +I   F +  G ELV +T+ E  + R+ + +A R+ + R++ FY+ 
Sbjct: 275 GGFG--RFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVL 332

Query: 317 SLFFIGLTVPYNDPKLTST----DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAG 372
               I + V YNDP L S          SSPF+I IQNAG RVLPHI NA IL++  SAG
Sbjct: 333 GTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAG 392

Query: 373 NSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFN 432
           N+ ++  +R L +MA+NG AP+   K    GVPY+++        L+++ +S+  A  FN
Sbjct: 393 NAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFN 452

Query: 433 WLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVII 492
           W  NI+ ++GF  W+    +++RF +A+   G+  D LP+K    P+  YY++F + +I 
Sbjct: 453 WFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLIT 511

Query: 493 LIQGFTSFAP-HFSGRDFVAAYISVGLFLVFWGFFQIYFRC---RIIWKLEDVDIDTDRR 548
           L  G+ +F P ++ G DFVAAYI++ +F+V W   +++ R    R   +++ +D+ T   
Sbjct: 512 LTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWRRVDQIDVTTGLV 571

Query: 549 EIESVVWEDD----APKTLWDKFWDFV 571
           +IE      D     P T W KF D V
Sbjct: 572 DIEERTKILDETRVEPSTRWQKFMDAV 598

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  313 bits (803), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/493 (37%), Positives = 271/493 (54%), Gaps = 22/493 (4%)

Query: 40  KRKTSVSSTQYEDLATEK-DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLAN 98
           K +  ++  + + L T+  +E   H  VKR+LK RH                     L  
Sbjct: 15  KLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNK 74

Query: 99  AGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLS 158
            GP+  L+ +  +G V FS+ +S+GE+ T  P    F   A+RF S  L A +GY Y + 
Sbjct: 75  GGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVV 134

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           +    A E + +  I+QFW  +VP+  +  IFW     F +  V  +GE E+W+A  K+L
Sbjct: 135 FFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKIL 194

Query: 219 ALMGFLIYSLCIVCGA--GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
            L+ F I+S+  + G   GK  PIGF+YW+NPGA+  G          F G     +  +
Sbjct: 195 GLVAFYIFSIVYMSGGIPGKP-PIGFQYWKNPGALSHG----------FRGIAVVFVFCS 243

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
             Y GTE V + A E+ NPRKAVP A+R+   RIL+ Y+G  FF G+TVPYNDP L +  
Sbjct: 244 TFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQT 303

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
             + S P  I +  AG     H+ NA IL T ISA NS++Y+GSR L  +A  GLAP+ L
Sbjct: 304 KSLKS-PISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRIL 362

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
           A T  +GVP  +++  +A G +S M +S G + A+N+++N++GV  F  W  IS +H+RF
Sbjct: 363 AWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRF 422

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYI-- 514
            +A   +G S  +LPY+AL+ PW   +++   + + LIQG+TS  P F  +DFV AYI  
Sbjct: 423 RKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYILL 481

Query: 515 -SVGLFLV---FW 523
            + GL  V   FW
Sbjct: 482 PAAGLLYVGINFW 494

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  313 bits (802), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 191/573 (33%), Positives = 295/573 (51%), Gaps = 23/573 (4%)

Query: 15  QDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRH 74
           ++ +T  +GN  D       E+         SST    +   KD  LE   +++ L  RH
Sbjct: 7   KEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTN-RGINGNKDAKLEGK-LQQGLSARH 64

Query: 75  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP---- 130
                                L   GP G  ++Y+ + TV++ +  + GEM  ++P    
Sbjct: 65  IQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGD 124

Query: 131 -VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISI 189
               S S    R++ P+L  A G+ YF  +    A E +    ++++WT  VP AAWI+I
Sbjct: 125 DSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTDAVPTAAWITI 184

Query: 190 FWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNP 248
           F  ++   N+  VK+YGE EFW ASIKVL ++G +I S  +  G G     +GFRYW+NP
Sbjct: 185 FLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNP 244

Query: 249 GAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAVPRAIRKVL 307
           G     I   N G   FL   S +I  AF +  G EL+ + + E  + R+ + +A ++ +
Sbjct: 245 GGFAHHITGGNLGN--FLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRFV 302

Query: 308 IRILLFYIGSLFFIGLTVPYNDPKLTST----DSYVSSSPFIITIQNAGTRVLPHIFNAV 363
            R++ FYI     I + V  NDP LTS          SSPF+I IQNAG ++LPHI NA 
Sbjct: 303 WRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINAC 362

Query: 364 ILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMEL 423
           ILT+  SAGN+ ++  SR L +MA NG APK   K    GVP+++V   +    L+Y+ +
Sbjct: 363 ILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNV 422

Query: 424 STGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYY 483
           S+  A  F W  NI+ ++GF  W     +++RF +A+K+ G+  + LPY   +  ++ ++
Sbjct: 423 SSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWW 481

Query: 484 AIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW--KLED 540
           +I  + ++I   G+  F P F +  DF+AAYI++ LF+V W   +IY R    W   +E+
Sbjct: 482 SILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEE 541

Query: 541 VDIDTDRREIES----VVWEDDAPKTLWDKFWD 569
           +D+ T   EIE     +  E   PK  + KF D
Sbjct: 542 IDVVTGLTEIEERTRILDEERVEPKGAFPKFMD 574

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  313 bits (803), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 196/543 (36%), Positives = 299/543 (55%), Gaps = 11/543 (2%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           N SD+ ++          K S  S   +D   + D       +K+ LK RH         
Sbjct: 20  NHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGS 79

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                       LA AGPV  L++Y F+G +VF V   +GEMA +IP+   F+ +A R+ 
Sbjct: 80  LGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYC 138

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT--FKVPLAAWISIFWVLLTAFNMFP 201
            PALG A GY Y + +      +L+    +IQ+W    KV    WI+I  V++   N F 
Sbjct: 139 DPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFG 198

Query: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNT 260
           VKF+GEFEFW++S KV+ ++G +I    I+ G   T   +GFRYW++PGA      S + 
Sbjct: 199 VKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHG 258

Query: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320
              RF+ +VS  +   F Y G EL GI A EA NPRK +P+AI+  + RI++FYI ++F 
Sbjct: 259 DIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFL 318

Query: 321 IGLTVPYNDPKLTSTDSYVSS---SPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVY 377
           +G+ V  NDP L    +  +S   SPF++ I N+G   LPHIFNA +L  + SA NS++Y
Sbjct: 319 LGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLY 378

Query: 378 VGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNI 437
           V SR L+S+A +  APK  AKT   G+PY S+     F  L+YM +S+G AK FN+ +N+
Sbjct: 379 VASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNV 438

Query: 438 TGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGF 497
             + G   W+ I  +++ F +A++ +GI +    Y A   P+ AY+++FF  ++ LI+ F
Sbjct: 439 VSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNF 498

Query: 498 TSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWE 556
           T F  H F  R+F+  YI + LF + +  ++   + + I K E+VD+ + +  I+    E
Sbjct: 499 TVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTK-IRKPEEVDLFSFKAAIDQ--EE 555

Query: 557 DDA 559
           +D 
Sbjct: 556 EDG 558

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  313 bits (802), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 198/590 (33%), Positives = 310/590 (52%), Gaps = 30/590 (5%)

Query: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           +  G  D  +KS     D II   D ++ N+ T +L + K K ++  ++   L  EK + 
Sbjct: 10  LPTGTWDKADKS-----DPIISEVDIEA-NTITEQLTKDKHKETIDYSETSSLDEEKQQQ 63

Query: 61  LEHH-DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVT 119
            E +  +K+ LK RH                     LA  GP G   +YL + T ++ + 
Sbjct: 64  PEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIM 123

Query: 120 QSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
            + GEM  ++P   S S        ++++  +LG A+ + Y+  +    A E +    ++
Sbjct: 124 NAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVV 183

Query: 175 QFWTF--KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           ++W +  KVP  AWI+IF   + A NM PV FYGE EFW ASIK+L ++G +I S  +  
Sbjct: 184 EYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFW 243

Query: 233 GAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAG 290
           G G +   +GFRYW+ PGA    I     G   FL   + +I   F +  G ELV +T+ 
Sbjct: 244 GGGPSHDRLGFRYWQRPGAFADHITDGTGG--NFLDVYTGVIKGGFAFVLGPELVSLTSS 301

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTS----TDSYVSSSPFII 346
           E  + R+ + +A R+ + R+++FY+     I + V YNDP L +    +     SSPF+I
Sbjct: 302 ECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVI 361

Query: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406
            IQNAG +VLPHI N  I+T+  SAGN+ ++  SR L +MA +G APKF +K    GVPY
Sbjct: 362 GIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPY 421

Query: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466
           ++V     F  L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +A+    + 
Sbjct: 422 VAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL- 480

Query: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGF 525
            D LPYK     +L +Y++F + +I L  G+  F P F   +DF+AAYI++ +F+V W  
Sbjct: 481 YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIG 540

Query: 526 FQIYFRCRIIW--KLEDVDIDTDRREIESVVWEDDA----PKTLWDKFWD 569
            ++  R    W   ++ +D+ T   EIE +  E D     P   WDKF D
Sbjct: 541 HKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLD 590

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  314 bits (804), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 188/598 (31%), Positives = 303/598 (50%), Gaps = 35/598 (5%)

Query: 4   GPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL-- 61
           G    KE+ V+Q  ++   G+ ++  + N  +   R  K S + +   +    +D ++  
Sbjct: 30  GGDTKKEEDVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDV 89

Query: 62  ------------EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYL 109
                       E H +K+ L+ RH                     L   GP G  ++Y+
Sbjct: 90  DLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYI 149

Query: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFA 164
            +  V++ +  +LGEM  F+P   S S         R++ P+LG A G+ YF  +    A
Sbjct: 150 IISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVA 209

Query: 165 LELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFL 224
            E +    ++++WT  VP   WI+IF  ++   N   VK YGE EFW ASIK+L ++G +
Sbjct: 210 AECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLI 269

Query: 225 IYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGT 282
           I S  +  G G     +GFRYW++PGA    +   + G   F    + +I  AF +  G 
Sbjct: 270 ILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGN--FTDIYTGIIKGAFAFILGP 327

Query: 283 ELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---- 338
           ELV +T+ E A+ R+ + +A R+ + R++ FY+     I + VPYNDP L +  +     
Sbjct: 328 ELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPG 387

Query: 339 VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAK 398
             SSPF+I IQNAG +VLPHI N  ILT+  SA N+ ++  +R L +MA+ G APK L +
Sbjct: 388 AGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGR 447

Query: 399 TTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQ 458
               GVPY++V        L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +
Sbjct: 448 INKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRK 507

Query: 459 ALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVG 517
           A+ + G+  D LP+K    P+  ++++  + +I +  G+  F P +    DF+AAYI++ 
Sbjct: 508 AIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLP 566

Query: 518 LFLVFWGFFQIYFRCRIIWKL--EDVDIDTDRREIESVVWEDDA----PKTLWDKFWD 569
           +FLV W   ++Y R    W L   ++D+ T   EIE    E +     P    DKF D
Sbjct: 567 IFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLD 624

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  313 bits (803), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 191/586 (32%), Positives = 309/586 (52%), Gaps = 37/586 (6%)

Query: 16  DIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYE--------DLATEKDELLE----H 63
           D+D  I+   S+ +N    ++   ++  S    Q          D   EK++  E    +
Sbjct: 34  DVDIDIEATASNDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSN 93

Query: 64  HDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLG 123
            ++K+ LK RH                     LAN GP G  ++YL + T V+ +  +LG
Sbjct: 94  GELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALG 153

Query: 124 EMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT 178
           EM  F+P   S S         +++ P+LG A  + Y+  +    A E+S    +I++W 
Sbjct: 154 EMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWA 213

Query: 179 F--KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG- 235
           +   VP  AWI+IF  L+   N  PV  YGE EFW ASIK+L + G +I S  +  G G 
Sbjct: 214 WAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGP 273

Query: 236 -KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAA 293
              G +GFRYW+NPG+    I  +  G   FL   + +I   F+   G ELV +T+ E A
Sbjct: 274 KSDGILGFRYWKNPGSFAHHI--TGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECA 331

Query: 294 NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP----KLTSTDSYVSSSPFIITIQ 349
           + R+ + +A ++ + R++ FYI     IG+ V YNDP     L  + +   SSPF+I IQ
Sbjct: 332 DQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQ 391

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           NAG R +PHI N  ILT+  SAGN+ ++  SR L +MA+NG APK   +    GVPY +V
Sbjct: 392 NAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAV 451

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
            A      L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +A+ +  ++   
Sbjct: 452 GASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH-R 510

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFVAAYISVGLFLVFWGFFQI 528
           +P++A    +  +Y++F++ +I L  G+  F P +++ +DF+AAYI++ +F+V W   ++
Sbjct: 511 IPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKV 570

Query: 529 YFRCRI---IWKLEDVDIDTDRREIESVVWEDD----APKTLWDKF 567
           + R  +   +  ++ +D+ T   EIE +  E +    APK  W+KF
Sbjct: 571 FTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNKWEKF 616

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  311 bits (797), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 189/582 (32%), Positives = 300/582 (51%), Gaps = 34/582 (5%)

Query: 12  SVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEK----DELLEHHDVK 67
           S +QD+    D  ++   +  TG++        +    Y  ++  K    D     H +K
Sbjct: 2   SGLQDLK---DAGETTVTDKQTGQV------YEIDIESYSQISGPKVSSSDAPQGDHTLK 52

Query: 68  RSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT 127
           + LK RH                     L   GP G   +Y  +  +++ V  +LGEM  
Sbjct: 53  KGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVC 112

Query: 128 FIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           ++P   S S         R++ P+LG A G+ Y+  +    A E +    ++Q+WT  VP
Sbjct: 113 YLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVP 172

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KTGPIG 241
             AWI+IF  ++   N   VKFYGE EFW AS+K+L ++G L  S  +  G G     +G
Sbjct: 173 KGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLG 232

Query: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAVP 300
           FRYW+ PGA    I S NTG  RFL   + +I   F +  G ELV +T+ EA + R+ + 
Sbjct: 233 FRYWQKPGAFAYHITSGNTG--RFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQ 290

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST----DSYVSSSPFIITIQNAGTRVL 356
           +A R+ + R++ FY+ S   IG  V YND  L++          SSPF+I IQNAG +VL
Sbjct: 291 KASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVL 350

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHI N  IL++  S+GNS ++  SR L SM++ G APK L +    GVPY +V   S   
Sbjct: 351 PHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLS 410

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            ++Y+ +S+  A  F W  NI+ ++GF  W+ I  +++RF +A+  + +  + +P+K  +
Sbjct: 411 CIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPF 469

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRII 535
            P+  ++ I  + VI L  G+  F P +++  DF+AAY+++ +FLV W   +++ R    
Sbjct: 470 QPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKT 529

Query: 536 WKL--EDVDIDTDRREIESVVWEDD----APKTLWDKFWDFV 571
           W +   ++D+ T  +EIE    E D     P T   KF +++
Sbjct: 530 WAIPVPEIDVTTGLKEIEEESKECDEKRIVPTTAGGKFMEWL 571

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  311 bits (797), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 190/586 (32%), Positives = 302/586 (51%), Gaps = 37/586 (6%)

Query: 5   PSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHH 64
           PS  KE+   ++  T+ D      +  +   L R K   S SS++ E     K       
Sbjct: 8   PSYSKEE---EEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEGNGK------- 57

Query: 65  DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124
            +K+ L  RH                     L   GP G +++Y+ + TV++ +  +LGE
Sbjct: 58  -LKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGE 116

Query: 125 MATFIP-----VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           M  ++P        S +    R++  +L  A G+ Y+  +    A E +    ++ +WT 
Sbjct: 117 MVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTT 176

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTG- 238
            VP A WI+IF  ++T  N   VK++GE EFW ASIK+L ++G ++ S  +  G G +  
Sbjct: 177 SVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHV 236

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 297
            +GF YW++PG     I   + G   FL   + +I  AF +  G ELV +T+ E  + R+
Sbjct: 237 RLGFHYWKDPGTFAHHITGGSWGS--FLDIYTGIIKGAFAFILGPELVALTSSECNDQRR 294

Query: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP----KLTSTDSYVSSSPFIITIQNAGT 353
            + +A ++ + R++ FYI     I + V YNDP     L       +SSPF+I IQNAG 
Sbjct: 295 NIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGI 354

Query: 354 RVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAIS 413
           +VLPHI NA IL++  SAGNS ++  SR L +MA NG APK   K    GVPY SV   +
Sbjct: 355 KVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSA 414

Query: 414 AFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYK 473
               L+++ +S+  A+ F+W  NI+ ++GF  W+    +++RF +A+ +  +  D LP+K
Sbjct: 415 MLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFK 473

Query: 474 ALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQIYFR- 531
               P+L +Y++  + VI L  G+ +F P F SG DFVAAYI++ LFL+ W   + + R 
Sbjct: 474 TFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARY 533

Query: 532 ------CRIIWKLEDVDIDTDRREIESVVWEDD----APKTLWDKF 567
                  ++ + ++++D+ T   E E V  + D     P T W KF
Sbjct: 534 KHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKF 579

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  311 bits (796), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 193/579 (33%), Positives = 314/579 (54%), Gaps = 30/579 (5%)

Query: 2   EIGPS--DLKEKSVIQDIDTIIDGNDS--DSHNSNTGELGRR--------KRKTSVSSTQ 49
           E GPS  D K K+ I + + +++   S  D  NS+  + G +        KR  SV    
Sbjct: 8   EGGPSVIDEKNKNYISNQENVVESGASQEDYSNSSYPKSGSKWKDFKDSFKRMDSVDLDP 67

Query: 50  YEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYL 109
               A +   L     ++R LK RH                     L  AGP G L+ + 
Sbjct: 68  NLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWG 127

Query: 110 FMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
            M T++  +  SLGEMA   PV+  ++ +A RF+  + G AN   Y +       LE+  
Sbjct: 128 LMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVA 187

Query: 170 VGQIIQFWTFKVPL-AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSL 228
               + +W  K    AA++++FW+ + + NMF VK YGE EF  + IKV+ ++GF+I  +
Sbjct: 188 ASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGV 247

Query: 229 CIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGI 287
            +VCG G T   IG ++W NPGA        +T   +F G  S  + AAF++  TELVG+
Sbjct: 248 ILVCGGGPTHEYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGL 302

Query: 288 TAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFII 346
            A E  +PRK+VP+A ++V  RI LFYI SL  +GL VPY DP+L  S+    ++SPF++
Sbjct: 303 AAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVL 362

Query: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406
            ++N G + LP + N VILT ++S GNS+V+  SR L ++++ G  P        +G P 
Sbjct: 363 ALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPL 422

Query: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466
           +S++  SAFG L ++ +S    + F+W+L+++G++  F WL IS  H+RF +AL  +  S
Sbjct: 423 VSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRS 482

Query: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF---SGRDFVAAYISVGLFLVFW 523
            D+L + +    W +YY++F ++V++++Q + +  P     S  +F  AY+S+ + +  +
Sbjct: 483 IDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMY 542

Query: 524 GFFQIYFRCRIIWKL----EDVDIDTDRREIESVVWEDD 558
              +IY +    WKL    + +DIDT RRE++  +++ +
Sbjct: 543 LGHKIYTKN---WKLLIDPKYMDIDTGRRELDIELFKQE 578

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  311 bits (796), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 186/568 (32%), Positives = 306/568 (53%), Gaps = 29/568 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRR-----KRKTSVSSTQYEDLATEKDEL 60
           +D  EK+ +Q        N    +  N G L RR     KR    ++   ED +   D+ 
Sbjct: 41  TDYLEKTSVQ--------NSGFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDK- 91

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
              + +K+++K RH                     L N GP G ++ Y  MG+ ++ + Q
Sbjct: 92  -GDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQ 150

Query: 121 SLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GE+A  +  ++  F+ +    + PALG +  ++Y L W     LEL      I++WT 
Sbjct: 151 AAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT 210

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTG 238
            V    +++IF+V++   N+F  + Y E EF+  + KVL + GFLI  + + CG AG  G
Sbjct: 211 SVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDG 270

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG +YW +PG+      S +     F G VS+L+ AAF +  TE + +TA E ANPRK+
Sbjct: 271 YIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKS 325

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLP 357
           +P A +K+L RIL+ Y+GS+  IG  VP+N  +L  S  S   +SP++I I + G +V+P
Sbjct: 326 IPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVP 385

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           H+ NAVIL ++IS GNS  Y  SR+L ++A+ G AP FL     +G P L+++  S FG 
Sbjct: 386 HLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGL 445

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           +S++  S      F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +K+   
Sbjct: 446 ISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVG 505

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCR 533
            W +YYA   M++I++ Q +T+ AP   G+     F   Y+++ + +  +  ++++ R  
Sbjct: 506 VWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDW 565

Query: 534 IIW-KLEDVDIDTDRREI-ESVVWEDDA 559
            ++     +D+ ++RR   E V+ ++DA
Sbjct: 566 TLYIPASKIDLISNRRIFDEDVLKQEDA 593

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  310 bits (795), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 187/572 (32%), Positives = 304/572 (53%), Gaps = 34/572 (5%)

Query: 19  TIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXX 78
           T I  NDS S   N  EL    + + V+ +  +  + E+D+     ++K+++K RH    
Sbjct: 102 TPISTNDSSSQLDN--EL--NPKGSFVTESGIKQPSQEQDQ--NQENLKKTIKPRHIVMM 155

Query: 79  XXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSV 137
                            L NAGP G ++ Y  MG+ ++ + Q+ GE+A  +  +   F+ 
Sbjct: 156 SLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNT 215

Query: 138 FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAF 197
           +    + PALG +  ++Y L W     LEL      I++WT KV    ++ IF+VL+   
Sbjct: 216 YPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVI 275

Query: 198 NMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGII 256
           N+F  K Y E +F+    K+L ++GF I ++ I CG AG  G IG RYW NPGA      
Sbjct: 276 NVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAF----- 330

Query: 257 SSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
             NTG  RF G V++ + AAF +  +E + +TA E +NPRKA+P A +K++ RIL  ++G
Sbjct: 331 RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLG 390

Query: 317 SLFFIGLTVPY-NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSN 375
           SL  +G  VPY +D  L ++ S   +SP++I + + G RV+PH  NAVIL +++S  N  
Sbjct: 391 SLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGA 450

Query: 376 VYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLL 435
            Y  SRIL S+AK G APK       +G P +++L  S FG +++   S      F WLL
Sbjct: 451 FYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLL 510

Query: 436 NITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQ 495
            I+G++  F W+ I  SH+RF +A+K +G S  ++ YK+    W + YAI  MV+ ++ Q
Sbjct: 511 AISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQ 570

Query: 496 GFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----EDVDIDTD 546
            + + +P       S + F   Y+++ + +  + F++++   +  W L    + +D+ TD
Sbjct: 571 FWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVW---KKDWTLFIPADKIDLVTD 627

Query: 547 RR--EIESVVWEDDAPKT------LWDKFWDF 570
           R+  + E +  ED+  +        W +  DF
Sbjct: 628 RQIFDEELLKQEDEEYQEKLRNGPYWKRVVDF 659

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  307 bits (786), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 188/530 (35%), Positives = 286/530 (53%), Gaps = 23/530 (4%)

Query: 27  DSHNSNTGELGRRKRKTSVSSTQYEDLATEKD--ELLEHHDVKRSLKQRHXXXXXXXXXX 84
           D+ N    + G  K  +++   +  D++ E D  +   +  VKR+LK RH          
Sbjct: 9   DTANVEKTDKGDAKSPSALI-IKAVDISEEPDVSKFDPNTGVKRALKNRHISLLALGGVI 67

Query: 85  XXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLS 144
                      L   GP+  L+ +  +G + F+V +S+GE+ T  P    F+  A+RF  
Sbjct: 68  GPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHG 127

Query: 145 PALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKF 204
            AL A  GY Y + +    A E + +  I+QFW  +VPL  +I IFW     F +  V  
Sbjct: 128 DALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSL 187

Query: 205 YGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEA 263
           +GE E+W++  K++ L+ + I+S+  + G  K  P  GF YW +PG++  G         
Sbjct: 188 FGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG--------- 238

Query: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323
            F G     +  +  Y GTE V + A E+ NP KAVP A+R+ L R+L+ YIG   F G 
Sbjct: 239 -FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGA 297

Query: 324 TVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRIL 383
           TVP++DP L++T + V  SP  I I  AG     H+ NA IL T ISA N ++Y+GSR L
Sbjct: 298 TVPFDDPNLSAT-TKVLKSPISIAISRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTL 356

Query: 384 FSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
            ++A  GLAPK LA T  +GVP  ++   +A G +S M +S G + A+++++N++GV  F
Sbjct: 357 TNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVF 416

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
             W +IS +H+R  +A   +G S ++LPYKAL  PW   +++   V + LIQG+TSF P 
Sbjct: 417 IVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP- 475

Query: 504 FSGRDFVAAYI----SVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRRE 549
           F   +FV AYI    ++ L++    F   +FR   I  L+ VD+D  RR+
Sbjct: 476 FDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVDLKSVDLDEGRRK 522

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  306 bits (785), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 192/524 (36%), Positives = 278/524 (53%), Gaps = 32/524 (6%)

Query: 39  RKRKTSVSSTQYEDLATEKDELLEHHD----VKRSLKQRHXXXXXXXXXXXXXXXXXXXX 94
             R   +S    E+  T   +  E  D    VKR+LK RH                    
Sbjct: 13  ESRSDDLSKFSKEEPDTHNIKSFEQFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGN 72

Query: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYM 154
            L+  GP+  L+ +  +G V F+V +S+GEM T  P  S FS  ++RF S AL A +GY 
Sbjct: 73  ALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYA 132

Query: 155 YFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214
           Y + +    A E + +  I+QFW  +VPL  +I IF V    F M  V  +GEFE+W+A 
Sbjct: 133 YVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAW 192

Query: 215 IKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273
            K++ L+ + I+S+  + G  K  P  GF YW NPGA+  G          F G     +
Sbjct: 193 FKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVFV 242

Query: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT 333
             +  Y GTE V + A E+ NP KAVP AI++   RI++ Y+G   F G TVPYND  L 
Sbjct: 243 FCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSLG 302

Query: 334 STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393
           +    + S P  I I  AG     H+ NA IL T +SA N ++Y+GSR L  +A  GLAP
Sbjct: 303 AHTKALKS-PIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAP 361

Query: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453
           KFL  T  +GVP  ++   +A G +S M +S G + A+++++N++GV  F  W +IS +H
Sbjct: 362 KFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTH 421

Query: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAY 513
           +RF +A   +G S  +LPYK+L  PW   +++   + + LIQG+T+F P FS +DFV AY
Sbjct: 422 LRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP-FSAKDFVDAY 480

Query: 514 I----SVGLFLVF----WGFFQIYFRCRIIWKLEDVDIDTDRRE 549
           I    +V L++V      G F++         L  VD++  RRE
Sbjct: 481 ILLPAAVILYIVISLVKIGGFKLV-------DLRTVDLEEGRRE 517

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  306 bits (784), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 286/515 (55%), Gaps = 12/515 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           + +++++ L  RH                     L N GP+   ++++ +  +V+ V  +
Sbjct: 42  DENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNT 101

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181
           L EM  ++P   +      R++ P+LG A G+ Y  S+    A ELS    ++Q+WT KV
Sbjct: 102 LAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKV 161

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-I 240
            +A WI+IF V++   N  PVKFYGE EFW AS+K++ ++G LI S+ I  G   +   +
Sbjct: 162 HVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRL 221

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAV 299
           GFRYW NPG     I   NTG  RFL   +++I + F +    EL+G+   EA + R+ +
Sbjct: 222 GFRYWNNPGPFAYHITGGNTG--RFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNI 279

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPK----LTSTDSYVSSSPFIITIQNAGTRV 355
            +A R+ + RI+ FYI S   IG  +  +DPK    LTS     +SSPF+  I NAG  V
Sbjct: 280 EKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPV 339

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           L HI NAVIL++  S+ NS +Y  SR + ++AK G APK   +    GVPY +V   +A 
Sbjct: 340 LNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAV 399

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
             L+Y+  S+  A+ F WL NI  ++GF  W LI  +++RF +A+ +  +  + +P+K+ 
Sbjct: 400 SCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSA 458

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
             P+  Y+ + F+V++ L  G+ +F P + +  DFVAAYI++ +F + +   +I+F+ R 
Sbjct: 459 LQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRW 518

Query: 535 IWKLEDVDIDTD--RREIESVVWEDDAPKTLWDKF 567
                ++D+ T     E E+ + +   PK +W+KF
Sbjct: 519 YIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  308 bits (788), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 190/595 (31%), Positives = 303/595 (50%), Gaps = 39/595 (6%)

Query: 9   KEKSVIQDIDTIIDG------NDSDSHNSNTGELGRRKRKTSVSSTQYEDL--------- 53
           KE +V+Q  +++  G       D++  ++   E   +    S + T  EDL         
Sbjct: 39  KEDNVVQVTESLSSGLRRNHPYDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKS 98

Query: 54  -ATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
            + E D   E H +K+ L+ RH                     L   GP G  ++Y+ + 
Sbjct: 99  PSVEGDN--EPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIIS 156

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALEL 167
            V++ +  +LGEM  F+P   S S         R++  +LG A G+ YF  +    A E 
Sbjct: 157 AVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAEC 216

Query: 168 SVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYS 227
           +    ++++WT  VP   WI+IF  ++   N+  VK YGE EFW ASIK+L ++G +I S
Sbjct: 217 TAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILS 276

Query: 228 LCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELV 285
             +  G G     +GFRYW++PGA    +   + G   F    + +I  AF +  G ELV
Sbjct: 277 FILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGN--FTDIYTGIIKGAFAFILGPELV 334

Query: 286 GITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSS 341
            +T+ E A+ R+ + +A R+ + R++ FY+     I + VPYNDP L +  +       S
Sbjct: 335 CMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGS 394

Query: 342 SPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTL 401
           SPF+I IQNAG +VLPHI N  IL++  SA N+ ++  +R L +MA+ G APK L +   
Sbjct: 395 SPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINR 454

Query: 402 QGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALK 461
            GVPY++V        L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +A+ 
Sbjct: 455 WGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF 514

Query: 462 HRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFL 520
           + G+  D LP+K    P+  + ++  + +I L  G+  F P +    DF+AAYI++ +FL
Sbjct: 515 YNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFL 573

Query: 521 VFWGFFQIYFRCRIIWKL--EDVDIDTDRREIESVVWEDDA----PKTLWDKFWD 569
           V W   ++Y R    W L   ++D+ T   EIE    E +     P +  DKF D
Sbjct: 574 VLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMD 628

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  303 bits (775), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 181/499 (36%), Positives = 276/499 (55%), Gaps = 20/499 (4%)

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
           +  E   +  VKR+LK RH                     L   GP+  L+ ++ +G + 
Sbjct: 22  DVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIA 81

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
           F+V +S+GEM T  P    F+  A+RF S AL A  GY Y + +    A E + +  I+Q
Sbjct: 82  FAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQ 141

Query: 176 FWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG 235
           FW  +VPL A+  IFW++   F +  V  +GE E+W++ +K+L L+ + I+S+  + G  
Sbjct: 142 FWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGV 201

Query: 236 KTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
           +  P  GF YW++PG++  G          F G     +  +  Y GTE V +TA E+ N
Sbjct: 202 RNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKN 251

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           P K+VP A+R+ L RI++ YIG   F G TVP+NDP L S ++ V  SP  I I  AG  
Sbjct: 252 PTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRAGWA 310

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
              H+ NA IL + ISA N ++Y+GSR L ++A  GLAPKFLA T  +GVP  ++   +A
Sbjct: 311 GGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNA 370

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
            G +S M +S G + A+++++N++GV  F  W +IS +H+R  +A   +G   ++LPYKA
Sbjct: 371 LGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKA 430

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYI----SVGLFLVFWGFFQIYF 530
           L+ PW   +++   + + LIQG+TS  P F   +FV AYI    ++ L++    F    F
Sbjct: 431 LFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKNHNF 489

Query: 531 RCRIIWKLEDVDIDTDRRE 549
           R   I  L  V++D  RR+
Sbjct: 490 R---IVDLTSVNLDEGRRK 505

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  304 bits (779), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 184/547 (33%), Positives = 296/547 (54%), Gaps = 18/547 (3%)

Query: 14  IQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSS--TQYEDLATEKDELLEHHDVKRSLK 71
           I   D  ID + S S  +   +  +R  K  V    T+ E +A    +      +K +LK
Sbjct: 45  IDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEAERIAINTAK----APLKHTLK 100

Query: 72  QRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPV 131
            RH                     L  AGP G ++ +    T+++ +  +LGE+A   PV
Sbjct: 101 GRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPV 160

Query: 132 TSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLAAWISIF 190
           +  F+ +A RF+  + G A+ + Y L W  T  LE+      + +W T +     ++++F
Sbjct: 161 SGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDGFVALF 220

Query: 191 WVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPG 249
           W+++   N+F V+ +GE EF  ++IKVL ++GF+I  + +V G G  G     RYW NPG
Sbjct: 221 WLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPG 280

Query: 250 AMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIR 309
           A     +  N G  +F G  S  + AAF++ G+ELVGITA EAANPRK+VPRA ++V+ R
Sbjct: 281 AF----VGDNAG-TQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWR 335

Query: 310 ILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAVILTTI 368
           I+LFY+GSL  IGL VPY DP+L    S   S+SPF+I I   G R LP + N VIL  +
Sbjct: 336 IVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILIAV 395

Query: 369 ISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGA 428
           +S GNS ++ GSR + ++++ G  P+       +G P + ++ IS FG ++++  S    
Sbjct: 396 LSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQG 455

Query: 429 KAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFM 488
           + F WL+ ++G++  F W  I   H+RF  ALK +G S ++LP+ +      + + +F +
Sbjct: 456 EVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFML 515

Query: 489 VVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDID 544
           +++ + Q + +  P     S   F  +Y+S  + L F+   +IY +  ++  K ED+DID
Sbjct: 516 LLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDID 575

Query: 545 TDRREIE 551
           T RRE +
Sbjct: 576 TGRRETD 582

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 180/580 (31%), Positives = 297/580 (51%), Gaps = 21/580 (3%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD- 65
           D++  +  +  D  ID  +    +S   ++    ++  V          EK  +      
Sbjct: 24  DVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEVPELDPNLTEAEKIAIATARSP 83

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           ++  LK RH                     L  AGP G L+ ++  G++++ +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLA 184
           A   PV   F+ +A RF+  + G AN + Y L W  T  LE+      + +W T K    
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-R 243
            ++++FWV++   NMF V+ YGE EF  +  K+L ++GF+I ++ ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
           YW +PGA      + +T   +F G+ S  + AAF++ G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNA 362
           ++V  RI +FY+  L  IG+ VPY DP+L    S   ++SPF+I I+N G   LP + N 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNV 378

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL  ++S GNS VY  SR L ++A  G  PK  +     G P + +   SAFG ++++ 
Sbjct: 379 VILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVA 438

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S    + F+WL+ ++G++  F W  I   H+RF +AL  +G S ++L + +    W A 
Sbjct: 439 QSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAA 498

Query: 483 YAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKL 538
           + +F  ++++  Q + +  P     S  DF   Y+S+ + L  W   +I+ +  ++  K 
Sbjct: 499 WGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKA 558

Query: 539 EDVDIDTDRREIE-----SVVWEDD---APKTLWDKFWDF 570
           ED+DIDT RRE++       V E+    A K +W + + F
Sbjct: 559 EDMDIDTGRRELDLDLLRQQVEEERAALAAKPMWYRIYKF 598

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  303 bits (775), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 189/599 (31%), Positives = 306/599 (51%), Gaps = 42/599 (7%)

Query: 7   DLKEKSVIQDIDTIIDGN-------DSDSHNSNTGELGRRKRKTSVSSTQYEDLATE--- 56
           D K+ +V+Q  ++   G+       D++  +    E   + +  S + T +E+L  +   
Sbjct: 31  DKKDDNVVQVTESASSGSRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDL 90

Query: 57  -----KDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFM 111
                 D   E   +K+ L+ RH                     L   GP G  ++Y+ +
Sbjct: 91  EKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIII 150

Query: 112 GTVVFSVTQSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALE 166
             V++ +  +LGEM  F+P   S S         R++  +LG A G+ YF  +    A E
Sbjct: 151 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 210

Query: 167 LSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIY 226
            +    ++++WT  VP   WI++F +++   N   VK YGE EFW ASIK+L ++G +I 
Sbjct: 211 CTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIIL 270

Query: 227 SLCIVCGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTEL 284
           S  +  G G K   +GFRYW++PGA    +   + G   F    + +I  AF +  G EL
Sbjct: 271 SFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSLGN--FTDIYTGIIKGAFAFILGPEL 328

Query: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VS 340
           V +T+ E A+ R+ + +A R+ + R++ FY+     I + VPYNDP L +  +       
Sbjct: 329 VCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAG 388

Query: 341 SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTT 400
           SSPF+I IQNAG +VLPHI N  ILT+  SA N+ ++  +R L +MA+ G APK L K  
Sbjct: 389 SSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKIN 448

Query: 401 LQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQAL 460
             GVPY++V A      L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +A+
Sbjct: 449 RWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAI 508

Query: 461 KHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLF 519
            + G+  D LP+K    P+  ++++  + +I +  G+  F P +    DF+AAY+++ +F
Sbjct: 509 FYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIF 567

Query: 520 LVFWGFFQIYFRCRIIWKLEDVDIDTDR---------REIESVVWEDDAPKTLWDKFWD 569
           LV W   ++Y R    W L   +ID  R         REIE +      P ++ DKF D
Sbjct: 568 LVLWLGHKLYTRTWHQWWLPVSEIDVTRGLVEIEEKSREIEELRLP---PTSIKDKFMD 623

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  304 bits (779), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 303/588 (51%), Gaps = 30/588 (5%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGR-----RKRKTSVSSTQYEDLATEK----DE 59
           K+ +V+Q  ++   G+ +  + +   +  R     + +  S + T  E+L  EK    D 
Sbjct: 96  KDPNVVQVTESPSSGSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADG 155

Query: 60  LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVT 119
               H +K+ L+ RH                     L   GP G  ++Y+ +  V++ + 
Sbjct: 156 DAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIM 215

Query: 120 QSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
            +LGEM  F+P   S S         R++  +LG A G+ Y+  +    A E +    ++
Sbjct: 216 CALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVV 275

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           ++WT  VP   WI+IF  ++   N   VK YGE EFW ASIK+L ++G +I S  +  G 
Sbjct: 276 EYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGG 335

Query: 235 G-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEA 292
           G K   +GFRYW++PG+    +   + G   F    + +I  AF +  G ELV +T+ E 
Sbjct: 336 GPKHDRLGFRYWQHPGSFAHHLAGGSLGN--FTDIYTGIIKGAFAFILGPELVCMTSAEC 393

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSPFIITI 348
           A+ R+ + +A R+ + R++ FY+     I + VPYNDP L +  +       SSP++I I
Sbjct: 394 ADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGI 453

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           QNAG +VLPHI N  ILT+  SA N+ ++  +R L +MA+ G APK L K    GVPY++
Sbjct: 454 QNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVA 513

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           V        L+Y+ +S+  A  FNW  NI+ ++GF  W+    +++RF +A+   G+  D
Sbjct: 514 VGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YD 572

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQ 527
            LP+K    P+  ++++  + +I +  G+  F P + +  DF+AAYI++ +FLV W   +
Sbjct: 573 RLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHK 632

Query: 528 IYFRCRIIW--KLEDVDIDTDRREIESVVWEDDA----PKTLWDKFWD 569
           +Y R    W   + ++D+ T   EIE    + +     P T  +KF D
Sbjct: 633 LYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMD 680

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  302 bits (774), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/546 (32%), Positives = 293/546 (53%), Gaps = 28/546 (5%)

Query: 44  SVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVG 103
           SV  T   +++   +++ E   +K++++ RH                     L++AGP G
Sbjct: 79  SVFDTAVVEISAVDNQINEK--LKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAG 136

Query: 104 ALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFT 162
            ++ Y  M T ++ V Q++GEMA  ++ +   FS +    + P L  A  ++Y + W   
Sbjct: 137 LIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCV 196

Query: 163 FALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALM 221
             LEL      IQ+WT KV    ++ IF++L+   N+F   + Y E EF+    K+L + 
Sbjct: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMT 256

Query: 222 GFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQ 280
           GF I  + ++CG AG +G IG RYW +PGA        + G  RF G VS+L+ AAF + 
Sbjct: 257 GFFILGIILICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFG 311

Query: 281 GTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYV 339
           GTE + ITA E ANPRKA+P A +KV+ R L+ Y+GS+  +G  VPYN  +L  S+    
Sbjct: 312 GTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPAT 371

Query: 340 SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT 399
            +SP++I + + G RV+PH  NAVIL ++ S  +S  Y  SR+L ++A+ G APK     
Sbjct: 372 KASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYV 431

Query: 400 TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQA 459
             +G P L  +  +    +S+   S+  A  FNWLL+I+G++  F W +IS SH+RF +A
Sbjct: 432 DKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRA 491

Query: 460 LKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRD------FVAAY 513
           +K +G S D++ +K+    W + YA   M+++++ Q +    P   G D      F  AY
Sbjct: 492 MKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVP--VGEDSADAVSFFQAY 549

Query: 514 ISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDR--------REIESVVWEDDAPKTLW 564
           +++ +F+V +  ++I+ R  R+  + +++D+   R        R+    + E      LW
Sbjct: 550 LAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLW 609

Query: 565 DKFWDF 570
            K ++F
Sbjct: 610 RKIYNF 615

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  300 bits (769), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/542 (32%), Positives = 283/542 (52%), Gaps = 20/542 (3%)

Query: 40  KRKTSVSSTQYEDLATEKDELLE--HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLA 97
           K       T + +L ++  +++    H++K+ L  RH                     L 
Sbjct: 23  KSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLT 82

Query: 98  NAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFL 157
             GP    ++++ + T+V+ +  +L EM  ++P   S      R++ P+LG A G+ Y  
Sbjct: 83  QCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAY 142

Query: 158 SWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
           S+    A EL+    I+++WT +VP   WI+IF +++   N   V+FYGE EFW AS+K+
Sbjct: 143 SYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKI 202

Query: 218 LALMGFLIYSLCI-VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
           + ++  L+ S+ I   GA     +GFRYWRNPGA G  I   N G  RFL   +++I +A
Sbjct: 203 ICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGNLG--RFLDLWTAIIKSA 260

Query: 277 FTY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPK---- 331
           F +    ELVG+   EA + R+ + +A R+ + RI+ FY+ S   IG+ V  ND      
Sbjct: 261 FAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLA 320

Query: 332 LTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGL 391
           L       +SSPF+  I N+G  VL H+ N  ILT+  SAGNS  Y  SR + +++K G 
Sbjct: 321 LEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGD 380

Query: 392 APKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISC 451
           APK  +K    GVPY +V   S    L+Y+ +S+  +K F WL NI  ++GF  W LI  
Sbjct: 381 APKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGV 440

Query: 452 SHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFV 510
           +++RF +A+    +  D +PY++   P+ AY+    + +I L  G+  F    +  +DF+
Sbjct: 441 AYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFL 499

Query: 511 AAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIE-----SVVWEDDAPKTLWD 565
            +YIS+ +FL F+   +  ++ R    ++ +D+ T   E E     SVV     PK  W+
Sbjct: 500 TSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEEAEEEAKLSVV---RVPKNAWE 556

Query: 566 KF 567
           KF
Sbjct: 557 KF 558

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  302 bits (773), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 175/536 (32%), Positives = 289/536 (53%), Gaps = 24/536 (4%)

Query: 52  DLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFM 111
           +++   DEL E   +K++++ RH                     LA+AGP G ++ Y  M
Sbjct: 87  EISQVDDELNEK--LKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIM 144

Query: 112 GTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
            + ++ + Q++GEMA  ++ +   F+ +    + PAL  +  ++Y + W     LEL   
Sbjct: 145 ASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTA 204

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLC 229
              IQ+WT KV    ++ IF++L+ A N+F   + Y E EF   S K+L ++GF I  + 
Sbjct: 205 SMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIV 264

Query: 230 IVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288
           I+CG AG  G IG +YWR+PGA        + G  RF G VS+L+ AAF++  TE + IT
Sbjct: 265 IICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAIT 319

Query: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIIT 347
           A E +NPRKA+P A +KV+ R LL Y+ S+  +GL VPY+  +L  S+ +   +SP+++ 
Sbjct: 320 ASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLA 379

Query: 348 IQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYL 407
           +   G RV+PH  NAVIL ++ S  +S  Y  SR+L ++A+ G APK        G P L
Sbjct: 380 VSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSL 439

Query: 408 SVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISR 467
             L  +    +++   S+   + FNWLL I+G++  F W LI  SH+RF +A+K +G S 
Sbjct: 440 GFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSI 499

Query: 468 DDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG----RDFVAAYISVGLFLVFW 523
           D++ YK+    W + YA   M++I++ Q +    P   G    + F   Y+++ +F+V +
Sbjct: 500 DEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLY 559

Query: 524 GFFQIYFRC-RIIWKLEDVDIDTDR--------REIESVVWEDDAPKTLWDKFWDF 570
             ++I+ R  R+  + +D+D+ + R        R+      E      +W + +DF
Sbjct: 560 LGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDF 615

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  300 bits (769), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 175/542 (32%), Positives = 286/542 (52%), Gaps = 22/542 (4%)

Query: 22  DGNDSDSHN--SNTGELGRRKRKTSVSS--TQYEDLATEKDEL-LEHHDVKRSLKQRHXX 76
            G+ +++H+      E  +R  +  +    T+ E +A +  +  L+HH     LK RH  
Sbjct: 35  QGSSTEAHSRWGRFKESFKRAEEMELDPNLTEAERIAIKTAQSPLKHH-----LKNRHLQ 89

Query: 77  XXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFS 136
                              L  AGP G L+ +   GT+++S+  ++GE+A   PV   F+
Sbjct: 90  MIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFT 149

Query: 137 VFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLAAWISIFWVLLT 195
            +A RF+  + G A  ++Y L W     LE+      + +W T       ++++F+V++ 
Sbjct: 150 TYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIV 209

Query: 196 AFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPG 254
             NMF VK YGE EF  + IKV+ ++GF+I ++ ++CG GK    IG +YW NPGA    
Sbjct: 210 IINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF--- 266

Query: 255 IISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFY 314
               +T   +F G+ +  + AAF++ G+ELVG+   EA  PRK+VP A ++V  RI LFY
Sbjct: 267 --VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFY 324

Query: 315 IGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGN 373
           I  L  IG+ VP + P+L    S   ++SPF+I I N G + LP + N VIL  ++S GN
Sbjct: 325 ILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGN 384

Query: 374 SNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNW 433
           S +Y  SR L ++A  G  P         G P + +   + FG ++++  S      FNW
Sbjct: 385 SAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNW 444

Query: 434 LLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIIL 493
           L+ ++G++  F W  I   H+R+  AL  +G S D+LP++A    W +Y+  F  +++ +
Sbjct: 445 LMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFI 504

Query: 494 IQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRRE 549
            Q +    P     +  DF  AY+S  +F+  + F +I+ R  ++   L+D+DIDT RRE
Sbjct: 505 AQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRRE 564

Query: 550 IE 551
           ++
Sbjct: 565 VD 566

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 182/556 (32%), Positives = 292/556 (52%), Gaps = 36/556 (6%)

Query: 25  DSDSHNSNTGELGRRKRKTSVSSTQYEDLA-----TEKDEL-------------LEHHDV 66
           ++     ++ E G    +T  S ++++D        E +EL                  +
Sbjct: 18  EAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPNLTEAEKIAIITAQSPL 77

Query: 67  KRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA 126
           +R LK RH                     L   GP G L+ +  +G +++ V  S+GE+A
Sbjct: 78  QRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELA 137

Query: 127 TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLAA 185
              PV+  F+ +A RF+  + G A  Y Y L W     LE+      + FW T       
Sbjct: 138 VTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDG 197

Query: 186 WISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RY 244
           ++++F++++   N F V+ YGE EF  + IKV+ ++GF+I  + +VCG G  G     +Y
Sbjct: 198 FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKY 257

Query: 245 WRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIR 304
           W NPGA      S +   +RF G  S  + AAF++ GTELVG+ + E ANPRKA+PRA +
Sbjct: 258 WHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAK 312

Query: 305 KVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAV 363
           +V  RILLFYI SL  IGL VP+   +L  T S   ++SPF++ IQ  G + LP + N V
Sbjct: 313 QVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVV 372

Query: 364 ILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMEL 423
           IL +++S GNS VY  SR + ++A+ G  P   A    +G P ++++    FG LS++  
Sbjct: 373 ILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQ 432

Query: 424 STGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYY 483
           S      FNWLL ++G++  F+W  I   H+RF +AL  +G S D+L + +      +Y+
Sbjct: 433 SEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYF 492

Query: 484 AIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL-- 538
            +  ++++++ Q + +  P     +  DF +AY+S  + L F+ F +I+ R    WKL  
Sbjct: 493 GVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRN---WKLFT 549

Query: 539 --EDVDIDTDRREIES 552
             +D+DIDT RRE+++
Sbjct: 550 RAKDIDIDTGRREMDT 565

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  300 bits (768), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 182/567 (32%), Positives = 295/567 (52%), Gaps = 34/567 (5%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           NDS S   N  EL R+    +V   +      E+    +  ++K+S+K RH         
Sbjct: 109 NDSSSQLDN--ELNRKSSYITVDGIKQAPQEQEQ----KQENLKKSIKPRHTVMMSLGTG 162

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFAQRF 142
                       L NAGP G ++ Y  MG+ V+ + Q+ GE+A  +  +   F+ +    
Sbjct: 163 IGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFL 222

Query: 143 LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPV 202
           + PALG +  +++ L W     LEL      I++WT KV    ++ IF+VL+   N+F  
Sbjct: 223 VDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGA 282

Query: 203 KFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTG 261
           K Y E +F+    K+L ++GF I ++ I CG AG  G IG +YWR+PGA        +T 
Sbjct: 283 KGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTP 337

Query: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321
             RF G V++ + AAF +  +E + +TA E +NPRKA+P A +K++ RIL  ++ SL  +
Sbjct: 338 IQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLV 397

Query: 322 GLTVPY-NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGS 380
           G  VPY +D  L +  S   +SP++I + + G RV+PH  NAVIL +++S  NS  Y  S
Sbjct: 398 GFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSS 457

Query: 381 RILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGV 440
           RIL S+AK G APK       +G P +++L  + FG +++   S      F WLL I+G+
Sbjct: 458 RILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGL 517

Query: 441 AGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF 500
           +  F W+ I  SH+RF +A+K +G S  ++ YK+    W + YA+  M++ ++ Q + + 
Sbjct: 518 SQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAI 577

Query: 501 AP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----EDVDIDTDRR--E 549
           AP       S + F   Y+++ + +  + FF+++   +  W L      VD+ + R   +
Sbjct: 578 APIGGGGKLSAQSFFENYLAMPILIALYIFFKVW---KNDWSLFIPANKVDLVSHRNIFD 634

Query: 550 IESVVWEDDAPKT------LWDKFWDF 570
            E +  ED+  K        W +  DF
Sbjct: 635 EELLKQEDEEYKERLRNGPYWKRIVDF 661

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  296 bits (759), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 175/519 (33%), Positives = 273/519 (52%), Gaps = 25/519 (4%)

Query: 14  IQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQR 73
           ++ +DT+  GN     N    EL             +++   E  + L+     R  KQR
Sbjct: 11  VKRVDTLDTGNSDTQQNGEVYEL------------DFQEAIGESSQTLQ-----RGFKQR 53

Query: 74  HXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTS 133
           H                     L   GP   L+A++F G+++  V  SL EMA+F P+  
Sbjct: 54  HVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDK 113

Query: 134 SFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVL 193
           SFS +A R++ PALG A G+ YFL +    A ELS +G ++Q+W   + +A +I +F V+
Sbjct: 114 SFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVV 173

Query: 194 LTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMG 252
           L + N   +KFYGE EFW A +K L L+   +  L + CG G +   IGFRYWR   A  
Sbjct: 174 LLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFV 232

Query: 253 PGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILL 312
           P ++   TG  RFLGW + +I + + Y G+E +G+  GEA NP+K +P A R V+ RI  
Sbjct: 233 PYLVKGTTG--RFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITG 290

Query: 313 FYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISA 371
           FYI  +  +GL +  +D  L +   S  S SPF+I   NAG + LP   NA+++  I SA
Sbjct: 291 FYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASA 350

Query: 372 GNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAF 431
            N+ +YV SR  + +AK+G+APK        GVP+   L       LS+M +S   +  F
Sbjct: 351 ANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIF 410

Query: 432 NWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVI 491
            +L +   V G   WL +  S++ + +A     + RD +P++  + P+ AY  +FF+ +I
Sbjct: 411 GYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLI 470

Query: 492 ILIQGFTSFAPHFSGRDFVAAYISVGLFL---VFWGFFQ 527
           I   G+++F   F  + F+ +YI + +F+   +FW F++
Sbjct: 471 IFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKFWK 509

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  297 bits (760), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 183/512 (35%), Positives = 274/512 (53%), Gaps = 24/512 (4%)

Query: 47  STQYEDLATEKDELLEHHD----VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 102
           ++  E +  ++D  +  +D    VKR+LK RH                     L   GP+
Sbjct: 26  ASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPL 85

Query: 103 GALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFT 162
             L+ +  +G + FSV +S+GEM T  P    F+  A+RF S AL A  GY Y + +   
Sbjct: 86  ALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAV 145

Query: 163 FALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMG 222
            A E + +  I+QFW  +VPL  +I IFW     F +  V  +GE E+W+A +K++ L+ 
Sbjct: 146 LANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVA 205

Query: 223 FLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQG 281
           + I+S+  + G  +  P  GF YW +PGA+  G          F G     +  +  Y G
Sbjct: 206 YYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG----------FKGIAIVFVFCSTFYSG 255

Query: 282 TELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS 341
           TE V + A E+ NP KAVP A+R+ L RIL+ YIG   F G TVP++DP L S  + V  
Sbjct: 256 TESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL-SASTKVLK 314

Query: 342 SPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTL 401
           SP  I I  AG     H+ NA IL T ISA N ++Y+GSR L  +A  GLAPK LA T  
Sbjct: 315 SPIAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDR 374

Query: 402 QGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALK 461
           +GVP  ++   +A G +S M +S G A A+++++N++GV  F  W +IS +H+R  +A  
Sbjct: 375 RGVPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWV 434

Query: 462 HRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYI----SVG 517
            +G S ++LPY+AL+ PW    ++   + + LIQG++ F P F   +FV AYI     + 
Sbjct: 435 AQGRSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGIL 493

Query: 518 LFLVFWGFFQIYFRCRIIWKLEDVDIDTDRRE 549
           L++    F   +FR      L  +++D  RR+
Sbjct: 494 LYIGICVFKSNHFRTV---DLRSINLDEGRRK 522

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  296 bits (758), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 187/535 (34%), Positives = 273/535 (51%), Gaps = 20/535 (3%)

Query: 16  DIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHX 75
           +I T   G+D+   +  +  +   + +T         L   K        VKR+LK RH 
Sbjct: 7   NILTKGKGDDASCESYTSSGITPDQIETGEGKNHNASLYDPKT------GVKRALKDRHI 60

Query: 76  XXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSF 135
                               LA  GP+  L+ +  +G + F++ +S+GEM T  P    F
Sbjct: 61  SLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGF 120

Query: 136 SVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLT 195
           +  A+RF S +L A  GY Y + +    A E + +  I QFW  +VPL  +I IFW    
Sbjct: 121 TTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQ 180

Query: 196 AFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPG 254
           AF M  V  +GE E+W++  K+L L+ F I+S   + G  K  P  GF YW NPGA+  G
Sbjct: 181 AFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG 240

Query: 255 IISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFY 314
                     F G     +  +  Y GTE V  +A E+ NP +A+P AIR+   RIL+ Y
Sbjct: 241 ----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVY 290

Query: 315 IGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNS 374
           IG  FF G+TVPYND  L +    + S P  I I  AG     H+ NA IL T ISA N 
Sbjct: 291 IGIGFFYGVTVPYNDHNLNAGTKALKS-PISIAITRAGWEGGTHLVNAFILVTCISAING 349

Query: 375 NVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWL 434
           ++++GSR + ++A  GLAPKFLA T  +GVP  ++   +A G +S M +S G + A++++
Sbjct: 350 SLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYI 409

Query: 435 LNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILI 494
           +N++GV  F  W  I  +H+RF +A   +G +  +LPYKAL+ P+     I   + + LI
Sbjct: 410 VNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLALI 469

Query: 495 QGFTSFAPHFSGRDFVAAYISVGLFLVFW-GFFQIYFRCRIIWKLEDVDIDTDRR 548
           QG+TSF P F   DFV AY+ +    V + G   +         L  +D+D  RR
Sbjct: 470 QGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTVDLLTIDLDEGRR 523

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 184/546 (33%), Positives = 293/546 (53%), Gaps = 13/546 (2%)

Query: 14  IQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL-LEHHDVKRSLKQ 72
           ++  D  ID ++  SH S  G      ++  V          EK  +      ++  LK 
Sbjct: 35  LESFDNQIDSSNYASHRSAWGNFLDSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKS 94

Query: 73  RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVT 132
           RH                     L  AGP G L+ +   GT++F++  +LGE+A   PV+
Sbjct: 95  RHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVS 154

Query: 133 SSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA-AWISIFW 191
             F+ +A RF+  + G A  + Y L W     LE+      + +W   V     ++++FW
Sbjct: 155 GGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVALFW 214

Query: 192 VLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGA 250
           +++   NMF V+ YGE EF  + IKV A++GF+I  + +VCG G  G     RYW NPGA
Sbjct: 215 LVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGA 274

Query: 251 MGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRI 310
                + S +G+ +F G+ S  + AAF++ G+EL+G+   EA NPRKAVP A ++V  RI
Sbjct: 275 F----VGSTSGQ-KFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRI 329

Query: 311 LLFYIGSLFFIGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTII 369
           LLFYI  L  IG  VPYNDP+L +S+    S+SPF+I I   G   LP + N VIL +++
Sbjct: 330 LLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVL 389

Query: 370 SAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAK 429
           S GNS +Y  SR L ++++ G  PK ++    +G P + +   S FG ++++  S    +
Sbjct: 390 SVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNE 449

Query: 430 AFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMV 489
            FNWLL I+G++ FF W  I   H+RF  ALK +G   D+LP+ +      +Y+ +F  +
Sbjct: 450 MFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNI 509

Query: 490 VIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDT 545
           ++++ Q + +  P     S  +F +AY++  + L F+   +++ +  + +  LEDVDIDT
Sbjct: 510 LMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDT 569

Query: 546 DRREIE 551
            RR+ +
Sbjct: 570 GRRDTD 575

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  296 bits (759), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 172/494 (34%), Positives = 267/494 (54%), Gaps = 18/494 (3%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +KR LK RH                     L   GP   ++A++  G++V+SV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA- 184
           A  +PV+ S+  +  RF+ P+ G A  Y Y +    T  LEL      + +W      A 
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT--GPIGF 242
           A++++F++++   N+F VK YGE EF  + IKV A++GF+I  + +VCG G +  G IG 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 243 RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 302
           RYW NPG    G          F G+ +  + +AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 303 IRKVLIRILLFYIGSLFFIGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFN 361
            ++V  RI LFY+ SL  IG  VPY D  L  ++    S+SPF+I I  AG + LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 362 AVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYM 421
            VIL  ++S GN  VY  SR + S+A  G  P+       +G P + +L  + FG LS++
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 422 ELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLA 481
             S+   + F+W+L I+G+  FF W  I   H+RF +AL  +G S D+L YKA    W +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 482 YYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWK 537
            Y I  + +++  Q + +  P     +   F +AY+S+ + + F+   ++Y R    + K
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIK 558

Query: 538 LEDVDIDTDRREIE 551
             D+DIDT RRE++
Sbjct: 559 SSDIDIDTGRREMD 572

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  297 bits (760), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 187/598 (31%), Positives = 307/598 (51%), Gaps = 52/598 (8%)

Query: 22  DGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEK--------------------DELL 61
           DGN    ++SN+  L   K   + +S++ E+   E                     +EL+
Sbjct: 35  DGNYILEYDSNS-SLRIEKETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELI 93

Query: 62  EHHDVKRSLKQ----RHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
                K  LKQ    RH                     L   GP G + +YL + T+V+ 
Sbjct: 94  NEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 118 VTQSLGEMATFIPVTSSFSV-----FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           +   LGEM  ++P   S S        +R+L  +L  A G+ Y+  +    A E +    
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           ++++WT  VP  AWI +F +++   NM PV+ YGE EFW A  K+L ++G +I S  +  
Sbjct: 214 VVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFW 273

Query: 233 GAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAG 290
           G G     +GFRYW  PG+    I + + G   FL     +I  AF++  G ELV + + 
Sbjct: 274 GGGPNHDRLGFRYWITPGSFANTITNGSFG--NFLDVYKGIILGAFSFILGPELVVLPSS 331

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST----DSYVSSSPFII 346
           E ++PR+ + +A ++ + R++ FYI     I + V YNDP L++          SSPF+I
Sbjct: 332 ECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVI 391

Query: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406
            IQNAG  VLPHI N  IL +  S+GN+ ++  SR L +MA N  APK L K    GVPY
Sbjct: 392 GIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPY 451

Query: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466
           ++V+       ++Y+  S   +  F W  N++ ++GF  W+++S +++RF +A+++ G+ 
Sbjct: 452 VAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM- 510

Query: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFVAAYISVGLFLVFW-- 523
           +D LPY     P+L  Y++   ++I +  GF    P +++  DF+AAY+++ +FL+ W  
Sbjct: 511 KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIG 570

Query: 524 -GFFQIYFR-----CRIIWKLEDVDIDTDRREI--ESVVWEDD--APKTLWDKFWDFV 571
             F++  F+     CR  +++ED+D+ T   EI  ES  +E +   P+T+  KF D++
Sbjct: 571 HKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESEYVKPETVGGKFVDWL 628

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  296 bits (758), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 183/560 (32%), Positives = 300/560 (53%), Gaps = 27/560 (4%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRK-----TSVSSTQYEDLATEKDEL- 60
           DL+ +S+  DI       ++ ++N    E G + R+       V   + +   TE++ + 
Sbjct: 29  DLESESI--DIK-----KETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIA 81

Query: 61  --LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSV 118
               H  +K  LK RH                     L  AGP   ++ +   G++++S+
Sbjct: 82  IITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSM 141

Query: 119 TQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT 178
             ++ EMA   P++  F+ +A RF+  + G AN + Y L W     LE+      + +W 
Sbjct: 142 VMAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWG 201

Query: 179 FKVPLA-AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
                   ++++FW+++   N+F VK YGE EF  ++IKV+ ++GF+I  L +VCG G T
Sbjct: 202 TPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPT 261

Query: 238 GPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
           G     +YW +PGA         T  A+F G+ S  + AAF++ G+EL+GI   EA NPR
Sbjct: 262 GGYVGAKYWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPR 316

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRV 355
           KAVP A ++V  RILLFYI SL FIGL VP ND +L  S++   ++SPF+I I   G R 
Sbjct: 317 KAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRG 376

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           LP + N VIL  ++S GNS +Y  SR L ++A+ G  PK ++     G P + +   S F
Sbjct: 377 LPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFF 436

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
           G ++++  S      FNWLL I+G++ FF W  I   H+RF  ALK +  S D+LP+ + 
Sbjct: 437 GLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSP 496

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC 532
              + +Y+ +F +V+++  Q + +  P     S  +F +AY+S+ + LV +   +++ + 
Sbjct: 497 LGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN 556

Query: 533 -RIIWKLEDVDIDTDRREIE 551
            +I   L  +D+DT R++++
Sbjct: 557 WKIFIPLGQLDLDTGRKQLD 576

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  296 bits (757), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 184/568 (32%), Positives = 305/568 (53%), Gaps = 29/568 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRR-----KRKTSVSSTQYEDLATEKDEL 60
           +D  EK+ +Q+ D          +  N G L RR     KR    ++   ED +   D+ 
Sbjct: 41  TDYLEKTSVQNSDF--------EYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDK- 91

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
              + +K+++K RH                     L N GP G ++ Y  MG+ ++ + Q
Sbjct: 92  -GDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQ 150

Query: 121 SLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GE+A  +  ++  F+ +    + PALG +  ++Y L W     LEL      I++WT 
Sbjct: 151 AAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT 210

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTG 238
            V    +++IF+VL  A N+F  + Y E EF+  + KVL + GF I  + + CG AG  G
Sbjct: 211 SVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDG 270

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG +YW +PG+      S +     F G VS+L+ AAF +  TE + +TA E ANPRK+
Sbjct: 271 YIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKS 325

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLP 357
           +P A +KVL RI++ ++GS+  +G  VP+N  +L  S  S   +SP++I I + G +V+P
Sbjct: 326 IPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVP 385

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           H  NAVIL +++S GNS  Y  SR+L S+A+ G AP FL     +G P L+++  + FG 
Sbjct: 386 HFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGL 445

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           +S++  S      F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +K+   
Sbjct: 446 ISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVG 505

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCR 533
            W +YYA   M++I++ Q +T+ AP   G+     F   Y+++ + +  +  ++++ R  
Sbjct: 506 VWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDW 565

Query: 534 IIW-KLEDVDIDTDRREI-ESVVWEDDA 559
            ++     +D+ ++RR   E V+ ++DA
Sbjct: 566 TLYIPASKIDLISNRRIFDEDVLKQEDA 593

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  296 bits (758), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 184/577 (31%), Positives = 303/577 (52%), Gaps = 26/577 (4%)

Query: 2   EIGPSDLKEKSVIQD-IDTIIDGNDSDSHNSNTGELGRRKR-----KTSVSST-----QY 50
           ++ PSD K+KS I+  ID+       +S   +  EL   +       TSVS +     + 
Sbjct: 56  DLNPSDKKKKSNIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGITTSVSPSAPNLRKL 115

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
             L T  D   ++  +K++++ RH                     L NAGP G ++ Y  
Sbjct: 116 NQLRTPTDAN-DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSI 174

Query: 111 MGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           MG++++ + Q+ GEMA  +  +   ++V+    +    G A  ++Y + W     LEL  
Sbjct: 175 MGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVT 234

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
               I++WT  V    +++IF+ L+   N+F  K Y E EF+    KVL ++GF I S+ 
Sbjct: 235 ASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSIT 294

Query: 230 IVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288
           I  G AG  G +G  YW  PGA        ++    F G   +L+ AAF Y GTE + +T
Sbjct: 295 ITAGGAGNDGYLGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALT 349

Query: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIIT 347
           A E +NPR A+P A +KVL RI+  Y+ S+  IG  VP++  +L  +D S  S+SP+++ 
Sbjct: 350 AAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLA 409

Query: 348 IQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYL 407
               G RV+PH  NAVIL +++S GNS  Y  SR+L S+A+ G APK+      +G P  
Sbjct: 410 ASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPAR 469

Query: 408 SVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISR 467
           ++L  + FG +++   S    + F WLL I+G++  F W  I  SH+RF  A+K +G S 
Sbjct: 470 AMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSL 529

Query: 468 DDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFW 523
            ++ Y A    W ++YA+F M +I + Q + + AP      S ++F   Y+++ + +V +
Sbjct: 530 GEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLY 589

Query: 524 GFFQIYFRC-RIIWKLEDVDIDTDRREI-ESVVWEDD 558
             ++IY++   ++ K ED+D+ + R+   E ++ E+D
Sbjct: 590 LGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEED 626

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/562 (30%), Positives = 295/562 (52%), Gaps = 19/562 (3%)

Query: 7   DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDV 66
           D  +++  Q+   I      D  + N  + G+      V   Q   + TEK    ++ ++
Sbjct: 51  DSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQ---VLTEKSNQ-KNKEL 106

Query: 67  KRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA 126
           K+++K RH                     L NAGP G L+ Y  MGT ++ + Q+ GE+A
Sbjct: 107 KQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELA 166

Query: 127 -TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAA 185
            ++  ++  F+V+    + PA G +  ++Y + W     LEL      I++WT  V    
Sbjct: 167 VSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADI 226

Query: 186 WISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIGFRY 244
           ++ IF+VL+   N F  + Y E EF+    K+L ++GF I  + I   GAG  G IG RY
Sbjct: 227 FVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRY 286

Query: 245 WRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIR 304
           W  PGA      + +     F G +++++ AAF +  TE + +TA E +NPRKA+P A +
Sbjct: 287 WHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAK 341

Query: 305 KVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLPHIFNAV 363
           KVL RIL  ++GS+  +G  VPY+  +L  S  S   +SP+++ +   G +V+PH  NAV
Sbjct: 342 KVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAV 401

Query: 364 ILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMEL 423
           IL +++S GNS  Y  SR+L+S+A+ G APKF      +G P+ +++    F  +S+   
Sbjct: 402 ILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAA 461

Query: 424 STGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYY 483
           S    + F WLL I+G++  F W  I  SH+RF +A+  +  S  ++ +KA    W +YY
Sbjct: 462 SPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYY 521

Query: 484 AIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRC-RIIWKL 538
             F +V+I++ Q + + AP   G+     F   Y+++ + ++F+  ++I+ +   +  + 
Sbjct: 522 VCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRA 581

Query: 539 EDVDIDTDRR--EIESVVWEDD 558
            ++D+D  R+  + E +  ED+
Sbjct: 582 NNIDLDKHRQIFDEELLKQEDE 603

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  295 bits (754), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 189/597 (31%), Positives = 303/597 (50%), Gaps = 39/597 (6%)

Query: 5   PSDLKEKSVIQDIDTI------IDGNDSDSHNSNTGELGR----RKRKTSVSSTQYEDLA 54
           P +LK   +  D + +      I  N S + N   G   +    +     V   + +   
Sbjct: 12  PENLKHNGITIDSEFLTQEPITIPSNGSATTNDEAGSGSKWQDFKDSFRRVEPVEVDPNL 71

Query: 55  TEKDEL---LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFM 111
           TE +++        +K  LK RH                     L   GP   L+ +   
Sbjct: 72  TEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGST 131

Query: 112 GTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVG 171
           GT+++S+  +LGE+A   P++  F+ +A RF+  + G AN + Y L W     LE+    
Sbjct: 132 GTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSAS 191

Query: 172 QIIQFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
             + FW T       ++++FW+++   NMF VK YGE EF  + IKV+ ++GF+I  + +
Sbjct: 192 ITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIIL 251

Query: 231 VCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
            CG G  G     +YW +PGA      + +T  A+F G  S  + +AF++ G+ELVG+ A
Sbjct: 252 NCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAA 306

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITI 348
            E+ +PRK+VP+A ++V  RI LFYI SL  +GL VPYNDP L    S   ++SPF+I I
Sbjct: 307 SESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAI 366

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           +  G + LP + N VIL  ++S GNS +Y  SR + ++A+    P+  A    +G P + 
Sbjct: 367 KTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVG 426

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           +   SAFG ++++  S      FNWLL ++G++  F W  I   H+RF +AL  +G   D
Sbjct: 427 IAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLD 486

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGF 525
           +L +K+    W +Y+ +F +V++ + Q + +  P     S   F  AY+S  L +  +  
Sbjct: 487 ELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLG 546

Query: 526 FQIYFRCRIIWKL----EDVDIDTDRREIESVVWEDD--------APKTLWDKFWDF 570
            +IY R    WKL    ED+DIDT RRE++  + + +        A K  W + W+F
Sbjct: 547 HKIYKRN---WKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNF 600

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  293 bits (751), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/465 (37%), Positives = 248/465 (53%), Gaps = 13/465 (2%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           E     +D       VKR LK RH                     LA  GP+  L+ +  
Sbjct: 41  EQSLNREDTFDPDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGI 100

Query: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
           +G + F + +S+GEM T  P    F+   +RF S AL A  GY Y + +    A E + +
Sbjct: 101 IGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTL 160

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
             I+QFW  +VPL  +I IFW     F +  V  +GE E+W+A  K+L L+ + I+S+  
Sbjct: 161 SSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVY 220

Query: 231 VCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           + G  K  P  GF+YW +PGA+  G          F G  +  +  +  Y GTE V + A
Sbjct: 221 ISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAA 270

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQ 349
            E+ NPR+AVP AIR+   RIL+ Y+G   F G+TVPYND  L    + V  SP  I I 
Sbjct: 271 TESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVLKSPIAIAIS 329

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
            AG     H+ NA IL T ISA N ++Y+GSR L  +A  GLAPK LA T  +GVP  ++
Sbjct: 330 RAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAI 389

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
              +A G +S M +S     A+N+++N++GV  F  W +IS +H+RF +A K +G +RD+
Sbjct: 390 TVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDE 449

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYI 514
           LPYKA   P     +I   + + L+QG++ F P F  ++FV AYI
Sbjct: 450 LPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYI 493

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 183/590 (31%), Positives = 314/590 (53%), Gaps = 26/590 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLA---TEKD 58
           +I  +      ++ +  + +  N++D+ +  +      +   S    + E+L    T+ +
Sbjct: 17  DIESTTFGMDDIVHEPCSTLSSNNNDNESRGSIRCKWTRFVDSFKRIELEELDPNLTDAE 76

Query: 59  EL---LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
           ++        +K +LK RH                     L  AGP G L+ +   GT++
Sbjct: 77  KIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMI 136

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
           +S+  ++GE+A   PV+  F+ +A RF+  + G A  + Y L W  T  LE+      + 
Sbjct: 137 YSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVN 196

Query: 176 FWTFKVPLA-AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA 234
           +W         ++++FWV     N+F VK YGE EF  A IKV+ ++GF+I ++ ++CG 
Sbjct: 197 YWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGG 256

Query: 235 GKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAA 293
           G  G     +YW +PGA        +T   +F G+ +  I A+F++ G+E+VG+   E+ 
Sbjct: 257 GPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESE 311

Query: 294 NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAG 352
           NPRK+VP A ++V  RI LFY+  L  IG+ VPYND +L    S   ++SPF+I + N G
Sbjct: 312 NPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQG 371

Query: 353 TRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAI 412
            R LP + N VIL +++S GNS++Y+ SR L ++A+ G  PK +A     G P +++   
Sbjct: 372 IRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIA 431

Query: 413 SAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPY 472
           SAFG ++++  S+   + FNWLL ++G++  F+W  I   H+RF +AL  +G S D+LP+
Sbjct: 432 SAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPF 491

Query: 473 KALWMPWLAYYAIFFMVVIILIQGFTSFAPHFS---GRDFVAAYISVGLFLVFWGFFQIY 529
            +      +Y+ IF  V++++ Q +    P  +    +DF  AY+S  + L F+ F +I+
Sbjct: 492 VSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIW 551

Query: 530 FRC-RIIWKLEDVDIDTDRREIESVVWE--------DDAPKTLWDKFWDF 570
            +  ++  K ED+DIDT RRE++  + +        D A + +W + W F
Sbjct: 552 KKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWKF 601

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 174/538 (32%), Positives = 279/538 (51%), Gaps = 23/538 (4%)

Query: 32  NTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD----------VKRSLKQRHXXXXXXX 81
           N  E G      S S    E++ ++   + +  +          + + L  RH       
Sbjct: 44  NAVEYGEHTSLKSSSFDSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVG 103

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQR 141
                         L   GP   +VA++ + T +F++  +LGE+A   PV   F+V+  R
Sbjct: 104 GAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITR 163

Query: 142 FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP 201
           F+ P+ G A    Y   W     LEL      I++W   +   AW++IF+  +   NM  
Sbjct: 164 FVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLD 223

Query: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNT 260
           VK +GE EF ++ IK+LA++GF I  + + CG G +G  IG RYW +PGA        +T
Sbjct: 224 VKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-----VGDT 278

Query: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320
              RF G  +  + AAF+Y GTELV ++A E+ NPR  +P+A ++    I L YI  L  
Sbjct: 279 PGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTI 338

Query: 321 IGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYV 378
           IG  VPYND +L + +S V  ++SP +I I+N G + LP + NA+IL  I+S  NS VY 
Sbjct: 339 IGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYA 398

Query: 379 GSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNIT 438
            SR + +MA+ G  PK L     +G P  ++ A   FG LS++  S    + F WL  ++
Sbjct: 399 CSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALS 458

Query: 439 GVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFT 498
           G++  F W  I+ SH+RF QA+K +  S ++LP+ ++   + ++Y    + ++++   +T
Sbjct: 459 GLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWT 518

Query: 499 SFAPHFS----GRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           S  P  S       F   Y+S+ +F+V +   ++Y +  R+  K +D+D+DT RREI+
Sbjct: 519 SLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREID 576

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  294 bits (752), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/534 (31%), Positives = 281/534 (52%), Gaps = 15/534 (2%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           KR       Q  DL  + D ++    +K+++K RH                     L  A
Sbjct: 49  KRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKA 108

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP   ++AY  +  V + + Q+ GEMA   P +  +F+ +   F+S   G A  +++F+ 
Sbjct: 109 GPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQ 168

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      +Q+W   +    ++ IF+V L   + F VK YGE EF     K+L
Sbjct: 169 WLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKIL 228

Query: 219 ALMGFLIYSLCI-VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            + GF+I+S+ + V GAG +G IG +YW +PGA      +S+T   RF G    L+ A F
Sbjct: 229 FVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYF 283

Query: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STD 336
           +Y G EL  ++  E  NPR++ P A ++ + RI++ Y+ ++  +G  VP N  +L  S  
Sbjct: 284 SYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGG 343

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
           S   +SP+++     G +V+PHI NAVIL ++IS GNS +Y   R++ ++A+ G APKF+
Sbjct: 344 SVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFM 403

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                +G P  +++  S FG + ++  S+   + FNWL  I G+A  F W  I  SH+RF
Sbjct: 404 DYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRF 463

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAA 512
            QA+K +  S D++ YK+ +  + +Y+ +FF +++ + Q + + AP      S   F  +
Sbjct: 464 RQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFES 523

Query: 513 YISVGLFLVFWGFFQIYFRCRIIWK-LEDVDIDTDRR--EIESVVWEDDAPKTL 563
           Y++  +F  F+  + I+ R   ++  LE VD+D  RR  + E V  ED+  K +
Sbjct: 524 YLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEM 577

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  295 bits (755), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 181/572 (31%), Positives = 295/572 (51%), Gaps = 34/572 (5%)

Query: 19  TIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXX 78
           T I   DS S   N  EL R+    +V   +      E+    +  ++K+S+K RH    
Sbjct: 104 TPISTKDSSSQLDN--ELNRKSSYITVDGIKQSPQEQEQ----KQENLKKSIKPRHTVMM 157

Query: 79  XXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSV 137
                            L NAGP G ++ Y  MG+ V+ + Q+ GE+A  +  +   F+ 
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 138 FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAF 197
           +    + PALG +  +++ L W     LEL      I++WT  V    ++ IF+VL+   
Sbjct: 218 YPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVI 277

Query: 198 NMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGII 256
           N+F  K Y E +F+    K+L ++GF I ++ I CG AG  G IG +YWR+PGA      
Sbjct: 278 NVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF----- 332

Query: 257 SSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
             +T   RF G V++ + AAF +  +E + +TA E +NPRKA+P A +K++ RIL  ++ 
Sbjct: 333 RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLA 392

Query: 317 SLFFIGLTVPY-NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSN 375
           SL  +G  VPY +D  L +  S   +SP++I + + G RV+PH  NAVIL +++S  N  
Sbjct: 393 SLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGA 452

Query: 376 VYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLL 435
            Y  SRIL S+AK G APK       +G P  ++L  + FG +++   S      F WLL
Sbjct: 453 FYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLL 512

Query: 436 NITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQ 495
            I+G++  F W+ I  SH+RF +A+K +G S  ++ YK+    W + YA+  MV+ ++ Q
Sbjct: 513 AISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQ 572

Query: 496 GFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----EDVDIDTD 546
            + + AP       S + F   Y+++ +++  + F++++   +  W L    + VD+ + 
Sbjct: 573 FWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVW---KKDWSLFIPADKVDLVSH 629

Query: 547 RR--EIESVVWEDDAPKT------LWDKFWDF 570
           R   + E +  ED+  K        W +  DF
Sbjct: 630 RNIFDEELLKQEDEEYKERLRNGPYWKRVLDF 661

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  293 bits (749), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/577 (31%), Positives = 298/577 (51%), Gaps = 24/577 (4%)

Query: 14  IQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQR 73
           + ++  + D  ++   +  TG++      TS S+   ++ +         H++K+ LK  
Sbjct: 1   MSNLQDLKDAGETSVVDKQTGQV-YELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSA 59

Query: 74  HXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP--- 130
           H                     L   GP G  ++Y  M T+++ V  +L EM  F+P   
Sbjct: 60  HIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLP 119

Query: 131 ----VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAW 186
                  S S    R++  +LG A G+ Y   +    A E +    ++ +WT  VP AAW
Sbjct: 120 DENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAW 179

Query: 187 ISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYW 245
           I+IF  ++   N   V+FYG  E    S+K+  ++G +I S+ +  G G     +GFR+W
Sbjct: 180 ITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFW 239

Query: 246 RNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAVPRAIR 304
           ++PGA    +  ++ G  R    ++ +I A F +  G ELV +T+ EA + R+ + +A R
Sbjct: 240 KDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAAR 297

Query: 305 KVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSPFIITIQNAGTRVLPHIF 360
           + + R++ FY  S    G+ V  NDP L +  S       SSPF+I IQNAG +VLPHI 
Sbjct: 298 RFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHII 357

Query: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420
           N  IL++  S+GNS +Y  +R L S+++ G APK   +    GVPY  V   +AF  L+Y
Sbjct: 358 NVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAY 417

Query: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480
           + +S+  A  FNW  NI+ ++GF  W+    +++RF +A+    +  D LP+K  + P+ 
Sbjct: 418 LNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYF 476

Query: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW--KL 538
            ++ I  + +I LI G+ SF  H++ +DF+AAYI++ LFL+ W   + Y R    W   +
Sbjct: 477 TWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISV 535

Query: 539 EDVDIDTDRREIESVVWEDDA----PKTLWDKFWDFV 571
            ++D+ T  REIE    E +A    P+ LW+K  +++
Sbjct: 536 SEIDVTTGLREIEEETKELNARRIPPRNLWEKILEWL 572

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  294 bits (753), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 174/570 (30%), Positives = 291/570 (51%), Gaps = 33/570 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELG------RRKRKTSVSSTQY--------- 50
           S L   ++  D + I    ++ SH+    +        +R  K   S+ ++         
Sbjct: 44  SQLPSSTLSNDFEPISQDQNTTSHSRTRAKFQNFIDSFKRADKEQPSTLEHDLTKTFEGT 103

Query: 51  ----EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALV 106
               ED     +   +  ++K S+K RH                     LAN+GP G ++
Sbjct: 104 LEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVI 163

Query: 107 AYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFAL 165
            Y  MG+ ++ + Q+ GEMA  +  +   F+ +    + PALG +  ++Y + W     L
Sbjct: 164 GYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPL 223

Query: 166 ELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFL 224
           EL      I++WT KV    ++ IF+VL+   N+      Y E EF+  S K+L L+GF 
Sbjct: 224 ELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFF 283

Query: 225 IYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTE 283
           I  + ++CG AG  G IG RYW +PGA             RF G VS+L+NAAF +  +E
Sbjct: 284 ILGIILICGGAGDDGYIGGRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSE 338

Query: 284 LVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSS 342
           ++G+TA E +NPRKA+P A +K++ RI+  Y+GS+  +G  VP+N D  L S+   V +S
Sbjct: 339 MIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS 398

Query: 343 PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQ 402
           P+++ +   G RV+PH  NAVIL +++S  NS  Y  SR+L  +A+ G APK       +
Sbjct: 399 PYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDRE 458

Query: 403 GVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKH 462
           G P + +   +    +S+   S    + F WLL I+G++  F W  I  SH+RF +A+  
Sbjct: 459 GRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAV 518

Query: 463 RGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGL 518
           +G S  ++ +K+    W ++YA   M++I++ Q + + AP   GR     F   Y++  +
Sbjct: 519 QGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPI 578

Query: 519 FLVFWGFFQIYFRC-RIIWKLEDVDIDTDR 547
            +  +  ++IY +  R+  + +D+D+D +R
Sbjct: 579 LIALYFGYKIYTKDWRLFIRAKDIDLDINR 608

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  295 bits (754), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 178/572 (31%), Positives = 296/572 (51%), Gaps = 34/572 (5%)

Query: 19  TIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXX 78
           T I   DS S   N  EL  +    +V   +     + +++  +  ++K+S+K RH    
Sbjct: 104 TPISTKDSSSRLDN--ELNPKSSYITVDGIK----QSSQEQEPKQENLKKSIKPRHTVMM 157

Query: 79  XXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSV 137
                            L NAGP G ++ Y  MG+ V+ + Q+ GE+A  +  +   F+ 
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 138 FAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAF 197
           +    + PA+G +  +++ L W     LEL      I++WT KV    ++ IF+VL+   
Sbjct: 218 YPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVI 277

Query: 198 NMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGII 256
           N+F  K Y E +F+    K+L + GF I ++ I CG AG  G IG RYWR+PGA      
Sbjct: 278 NIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF----- 332

Query: 257 SSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
             +T   RF G V++ + AAF +  +E + +TA E +NPRKA+P A +K++ RIL  ++ 
Sbjct: 333 RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLA 392

Query: 317 SLFFIGLTVPY-NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSN 375
           SL  +G  VPY +D  L +  S   +SP++I + + G RV+PH  NAVIL +++S  NS 
Sbjct: 393 SLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSA 452

Query: 376 VYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLL 435
            Y  SRIL S+AK G APK       +G P ++++  + FG +++   S      F WLL
Sbjct: 453 FYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLL 512

Query: 436 NITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQ 495
            I+G++  F W+ I  SH+RF + +K +G S  ++ YK+    W + YA+  MV+ ++ Q
Sbjct: 513 AISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQ 572

Query: 496 GFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----EDVDIDTD 546
            + + +P       S + F   Y+++ + +  + F++++ R    W L    + +D+ + 
Sbjct: 573 FWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKR---DWSLFIPADKIDLVSH 629

Query: 547 RR--EIESVVWEDDAPKT------LWDKFWDF 570
           R   + E +  ED+  K        W +  DF
Sbjct: 630 RNIFDEELLKQEDEEYKDRLRNGPFWKRVLDF 661

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  292 bits (748), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 174/545 (31%), Positives = 290/545 (53%), Gaps = 16/545 (2%)

Query: 15  QDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRH 74
           +D  +I++G  S    S+  +L  +K    +     +  +T  +  + + ++ ++L  RH
Sbjct: 22  EDEKSILEGKSST--QSSLLDLTLKKCDNGIEVVN-DATSTVSNASVTNVNLNKNLSIRH 78

Query: 75  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSS 134
                                LA+ GP   ++ ++ + T +F+V  +LGEMA   PV   
Sbjct: 79  LLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGG 138

Query: 135 FSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLL 194
           F+V+  RF+ P++G A    Y   W     LEL      I++W   +   AW++IF+ ++
Sbjct: 139 FNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAWVAIFYAVI 198

Query: 195 TAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGP 253
              NM  VK +GE EF ++ +K+LA++GF I  + + CG G  G     +YW NPG+   
Sbjct: 199 AFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSF-- 256

Query: 254 GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLF 313
                +T   +F G  S  + AAF+Y G E+  ++A E+ +PR+ +P+A ++    I   
Sbjct: 257 ---VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITAS 313

Query: 314 YIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISA 371
           YI  L  IG  VPY++P+L S  S V  +SSP +I I+N G + LP + NA+IL +IIS 
Sbjct: 314 YITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILISIISV 373

Query: 372 GNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAF 431
            NS VY  SR + +MA  G  P+ L     +G P  ++L    FG LS++  S   A+ F
Sbjct: 374 ANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVF 433

Query: 432 NWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVI 491
            WL  ++G++  F W+ I+ SH+RF QA+K +  S D+LPY +    W ++Y +  + ++
Sbjct: 434 TWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLV 493

Query: 492 ILIQGFTSFAP-HFSGRD---FVAAYISVGLFLVFW-GFFQIYFRCRIIWKLEDVDIDTD 546
           +++  +TS  P   SG D   F   Y+S  + +  + G   +Y + +I+  LED+DIDT 
Sbjct: 494 LIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTG 553

Query: 547 RREIE 551
           RR+++
Sbjct: 554 RRQVD 558

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  292 bits (747), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 173/578 (29%), Positives = 300/578 (51%), Gaps = 31/578 (5%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69
              +I+++   +D       N+N  E+  +    ++ S Q+ D          ++ ++++
Sbjct: 33  HSKLIENLKDFVDSFKKIDDNNNQYEI-EKNEINNIKSDQFNDKL--------NNQLQKT 83

Query: 70  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TF 128
           ++ RH                     L NAGP G L+ Y+ M + ++ + Q+ GEMA  +
Sbjct: 84  IQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNY 143

Query: 129 IPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWIS 188
           + +   F+ +    +  A   A  ++Y + W     LEL      I++W  KV    +++
Sbjct: 144 LTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVT 203

Query: 189 IFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWR 246
           IF++L+ A N+F   + Y E EF+    K+L + GF I  + ++CG AG +G IG  YW 
Sbjct: 204 IFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWN 263

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           NPGA        +T   RF G VS+L+ AAF++  TE + ITA E +NPRKA+P A +KV
Sbjct: 264 NPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKV 318

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLPHIFNAVIL 365
           + R L  Y+GS+  +G  VPYN P+L  S  S   +SP++I + + G R+ PH  NAVIL
Sbjct: 319 IYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVIL 378

Query: 366 TTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELST 425
            +++S  NS+ Y  SR+L ++AK G APK       +G P   ++A S   ++++   S 
Sbjct: 379 ISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSP 438

Query: 426 GGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAI 485
              + F+WLL I+G++  F W  I  SH+RF +A+K +G S ++L YK+    W + YA 
Sbjct: 439 KETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAA 498

Query: 486 FFMVVIILIQGFTSFAPHFSG----RDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLED 540
             M +I++ Q + +  P  S      +F   Y+++ + L+F+  ++ + +   +  + +D
Sbjct: 499 TVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558

Query: 541 VDIDTDRREIESVVWEDDAPK--------TLWDKFWDF 570
           +D+ + R   +  V + +  +        +LW K + F
Sbjct: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAF 596

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 175/568 (30%), Positives = 288/568 (50%), Gaps = 33/568 (5%)

Query: 6   SDLKEKSVIQDID-TIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHH 64
           SD+ E S +   + ++ D ND +    N  +    ++    S    E  A E        
Sbjct: 3   SDMSESSDMATTNISVYDKNDKN----NIKDGVSFEKPIIYSEVDIESGAKESSS----R 54

Query: 65  DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124
           ++K  L+ RH                     LAN GP   +++Y+ + T+V+ +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 125 MATFIPVTSS-------FSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
           M  ++P            +    +++  +LG A  + Y+  +    A E +    I+++W
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
           T K+P A  I +F  ++   N  PVKFYGE EFW A IK+  + G +I +  I CG    
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 238 GP----IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEA 292
                 +GF YW+NP +    + + + G   FL   ++LI  AF +  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYVTNGSLGN--FLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSPFIITI 348
            + R+ + +A R+ + R++ FYI     I + VPYNDP L +  +       SSPF+I I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           QNAG  +LPHI N  ILT+ +SAGN+ ++  +R L +M KNG AP+  ++    GVPY++
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           +        L+++  S   AK F W  NI+ ++GF  W     +++RF + + + G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF-SGRDFVAAYISVGLFLVFWGFFQ 527
            LP+K     +L +Y+  F+ ++IL  G+    P F + +DF+AAYI++ +FLV +    
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHI 531

Query: 528 IY---FRCRIIWK-LEDVDIDTDRREIE 551
           IY   +R R  WK ++++D+ T   EIE
Sbjct: 532 IYSGRWRQRKWWKPVDEIDVVTGLEEIE 559

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  290 bits (741), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 181/527 (34%), Positives = 285/527 (54%), Gaps = 15/527 (2%)

Query: 37  GRRKRKTSVSSTQYEDLATEKDELLEHHDV--KRSLKQRHXXXXXXXXXXXXXXXXXXXX 94
           GR  R T  SST  E  + + +   +H  +  K+ L+ RH                    
Sbjct: 29  GRGLRHTH-SSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGS 87

Query: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYM 154
            L  AGP   L+AY  MG VVF+V   LGEMA +IP+   F+ +A R+  PALG A G+ 
Sbjct: 88  SLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWA 146

Query: 155 YFLSWCFTFALELSVVGQIIQFW--TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWI 212
           Y   +      +L+    +IQFW    +V    WI++   ++   N   V+F+GEFEFW+
Sbjct: 147 YLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWL 206

Query: 213 ASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAM---GPGIISSNTGEARFLGW 268
           +S KVL ++  +I  L +  G G T   +GFRYW +PGA             G  +F+ +
Sbjct: 207 SSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAF 266

Query: 269 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328
           +S  + A F Y GTEL GI A E  +PR+ VPRAI+  L RI++FY+ ++F +G+ V YN
Sbjct: 267 LSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYN 326

Query: 329 DPKLTSTDSYVSSS---PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFS 385
           DP L    S   S+   P+++ I+NA   VLP++FNA +LT + SA NS++YVGSR L+ 
Sbjct: 327 DPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYG 386

Query: 386 MAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFA 445
           +A +G APK  A+T   GVPY ++   + F  L+YM +S     AF + +N+T + G  +
Sbjct: 387 LAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMS 446

Query: 446 WLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF-APHF 504
           W+ I  +++ F +A + +GI +  L Y A   P+  + A+ F + + LI+ F +F     
Sbjct: 447 WVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEV 506

Query: 505 SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIE 551
               F+  YI + +++  +  ++I  + + I   ++VD+ T +  I+
Sbjct: 507 DVPTFITGYIGLPIYIFCFIGYKIVHKTKWI-PSKEVDLFTFKEAID 552

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  289 bits (740), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 176/558 (31%), Positives = 288/558 (51%), Gaps = 28/558 (5%)

Query: 30  NSNTGELGR-RKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXX 88
           N+N G  G  R    S    Q +D+    +E      +K+++K RH              
Sbjct: 27  NANGGGRGLFRDFVDSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGL 86

Query: 89  XXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPAL 147
                  LA AGP G ++ Y     +++ + Q+ GE+   +  +T +++ ++   + PAL
Sbjct: 87  LVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPAL 146

Query: 148 GAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGE 207
           G +  ++Y + W   F L+L      I++WT   P   +++I + L+   N+F  K Y E
Sbjct: 147 GFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAE 205

Query: 208 FEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFL 266
            EF   + KVL ++GF+I  + I CG AG  G IG RYW  PGA   G          F 
Sbjct: 206 AEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FK 255

Query: 267 GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVP 326
           G       AAF Y G E++ +TA E  NPRK++P A +KV+ RILL Y+ +   +   VP
Sbjct: 256 GVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVP 315

Query: 327 YNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386
           Y+ P+LTST S   +SPF+I I + G  V+PHI NAVIL  ++S GNS++Y   R+L S+
Sbjct: 316 YDAPELTSTGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSL 375

Query: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
           ++ G APK       QG P L  L     G L+++  S      F+WLL I+G++  F W
Sbjct: 376 SEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIW 435

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---- 502
           + I  SHVRF  A+K +G S  ++ YK+    W +++AI   + +++ Q + + AP    
Sbjct: 436 ISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNG 495

Query: 503 -HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRR-------EIESV 553
              S +DF  +Y++  + +  +  ++IY++  R+     +VD+++ R+       + E +
Sbjct: 496 GKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQEDL 555

Query: 554 VWEDDA-PKTLWDKFWDF 570
            W++     ++W K + F
Sbjct: 556 DWKEKMRTASIWVKIYHF 573

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  287 bits (735), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 162/508 (31%), Positives = 272/508 (53%), Gaps = 9/508 (1%)

Query: 46  SSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 105
           +S + E  + E DE  ++ ++ R LK R                      LA  GP+   
Sbjct: 14  ASGEDECESEEIDE--KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLF 71

Query: 106 VAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFAL 165
           +AYLF G+++  V  SL EMA+F P+   FS +  R++ PA G A G+ YFL +    + 
Sbjct: 72  IAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSA 131

Query: 166 ELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLI 225
            L+  G +I +W   V +  W+++ +V +   N   VK++GE E  +   K+L L+   I
Sbjct: 132 NLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYI 191

Query: 226 YSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTEL 284
             L I CG A      GFRYWR  GA+ P ++   TG  +FLGW + ++ + F + G+E+
Sbjct: 192 TCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGGGTG--KFLGWWACVVQSIFGFMGSEM 248

Query: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTV-PYNDPKLTSTDSYVSSSP 343
           +GI  GE ANP+K +P++   V  RI   Y+  +F +GL + P N   + +  +  ++SP
Sbjct: 249 IGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASP 308

Query: 344 FIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQG 403
           F+I I ++G +VLP+  NA +L  IIS+ N+++Y+ SR L+ +AK+G APK         
Sbjct: 309 FVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFK 368

Query: 404 VPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHR 463
           VP +  +  S  G L+YM      A  F+++ +   V G   W  I  +++ + +A+K +
Sbjct: 369 VPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAK 428

Query: 464 GISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFW 523
           GIS DD+P++  + P+ AY  +FF+ +I    G+ +F   F  + F+ +YI V   ++  
Sbjct: 429 GISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMV 488

Query: 524 GFFQIYFRCRIIWKLEDVDIDTDRREIE 551
             +++YF+ + + K  ++   T R E E
Sbjct: 489 IGYKLYFKTKFV-KPSEISFRT-RNEHE 514

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  290 bits (742), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 175/547 (31%), Positives = 281/547 (51%), Gaps = 20/547 (3%)

Query: 26  SDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXX 85
           +DS     G   R K+    +S    DL    + +     +K+S+K RH           
Sbjct: 55  ADSFKRAEGSTTRTKQINENTS----DLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIG 110

Query: 86  XXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLS 144
                     L   GP   ++ Y+ +  V + + Q+ GEMA   P + ++F+ ++  F+S
Sbjct: 111 TGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFIS 170

Query: 145 PALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKF 204
            + G A  ++Y   W     LEL      IQFW  K+    +I IF+V L   + F VK 
Sbjct: 171 KSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKA 230

Query: 205 YGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEA 263
           YGE EF     K+L + GF+I S+ I CG AG  G IG  YW NPGA      + +T   
Sbjct: 231 YGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIG 285

Query: 264 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGL 323
           RF      L+ A F++ G EL  ++  E +NPRK+ P A ++ + RI++ Y+ ++  IG 
Sbjct: 286 RFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGF 345

Query: 324 TVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRI 382
            VPYND +L     S   +SP+++     G +++PHI NAVIL +++S  NS++Y G R+
Sbjct: 346 NVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRL 405

Query: 383 LFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAG 442
           + S+A+ G APKFL     +G P  +++    FG ++++  S+     F WL  I G++ 
Sbjct: 406 ICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSE 465

Query: 443 FFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP 502
            F W  I  SH+RF QA+K +G S D+L YKA    W + Y +FF +++ + Q + + AP
Sbjct: 466 LFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAP 525

Query: 503 HFSG-----RDFVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVV 554
             +G       F   Y++  ++L F+  + +Y R   ++  L+ +D+D  RR  + E + 
Sbjct: 526 LGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMR 585

Query: 555 WEDDAPK 561
            ED+  K
Sbjct: 586 QEDEENK 592

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 189/587 (32%), Positives = 308/587 (52%), Gaps = 26/587 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTI-IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKD-- 58
           +IG  +LK  +  + ++ I + G+D   H  ++    RR  +T   +    D A+  D  
Sbjct: 18  DIGMQELKSNTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDVE 77

Query: 59  ---ELLEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGT 113
              E+    +  +K+++  RH                     L N GP G ++ Y  MG+
Sbjct: 78  FGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGS 137

Query: 114 VVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
            ++ + Q+ GE+A ++  ++ +F+ +    +  A G +  ++Y L W     LEL     
Sbjct: 138 CLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASI 197

Query: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
            I++WT  V    +++IF+VL+   NMF  + Y E EF+    KVL ++GF I  + + C
Sbjct: 198 TIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNC 257

Query: 233 G-AGKTGPIGFRYWRNPGAM-GPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290
           G AG  G IG RYW NPGA  G   I        F G +S+++ AAF +  TE + +TA 
Sbjct: 258 GGAGNDGYIGGRYWNNPGAFYGTKPIH------HFKGIISTMVTAAFAFGATEFIALTAA 311

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQ 349
           E ANPR+A+P A +KV+ RILL ++  +  IG  VP+N P+L  S  S   +SP++I + 
Sbjct: 312 EQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVA 371

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           + G RV+PH  NAVIL +++S GNS  Y  SR+L ++A    AP +L      G P  ++
Sbjct: 372 SHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAM 431

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
           L    FG +S++  S      F WLL I+G++  F W+ I  SH+RF +AL  +G    +
Sbjct: 432 LVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGE 491

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGF 525
           L YK+      +YYA F M  I++ Q + + AP  S +     F   Y+++ LF+V +  
Sbjct: 492 LGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFG 551

Query: 526 FQIYFRC-RIIWKLEDVDIDTDRREI-ESVVWEDDA--PKTLWDKFW 568
           F+I+ R  R+   LE +D+D+ R+   E ++ ++DA   + + +K W
Sbjct: 552 FKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 178/567 (31%), Positives = 286/567 (50%), Gaps = 30/567 (5%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLA--------------- 54
           +K+ +   +  ++G D    +  TG       K + S ++++D                 
Sbjct: 6   KKNFVYAQEEPLEGRDVGHSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDLDPNL 65

Query: 55  TEKDEL---LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFM 111
           T+ +++        ++R LK RH                     L   GP   L+ +  +
Sbjct: 66  TQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLI 125

Query: 112 GTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVG 171
           G +++SV  ++GE+A   PV   F+ +  RF+  + G A  Y+Y L W     LE+    
Sbjct: 126 GLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAAS 185

Query: 172 QIIQFWTFKVPLA-AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
             + +W         ++++F+V++   NMF VK YGE EF  + IKV  ++GF+I  + +
Sbjct: 186 ITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVL 245

Query: 231 VCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           +CG G  G     +YW NPGA        N G+ RF    S  + AAF++ GTELVG+ A
Sbjct: 246 ICGGGPVGGYVGGKYWHNPGAFN----GDNAGQ-RFKAVCSVFVTAAFSFAGTELVGLAA 300

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITI 348
            E  NPRKA+PRA ++V  RI LFYI SL  IGL VPY    L  + S   ++SPF++ I
Sbjct: 301 AETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAI 360

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
           +  G   LP + N VIL +++S GNS+VY  SR L ++A  G  P+  +    +G P + 
Sbjct: 361 KTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVG 420

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           +LA   FG L ++  S      FNWL+ ++G++  F W  I   H+RF +AL  +G S D
Sbjct: 421 ILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTD 480

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHF---SGRDFVAAYISVGLFLVFWGF 525
           +L + +    W +Y+ +  + ++ + Q + +  P     +  DF  AY+SV + L F+  
Sbjct: 481 ELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLA 540

Query: 526 FQIYFRCRIIWK-LEDVDIDTDRREIE 551
            ++Y R     K  +D+DIDT RRE++
Sbjct: 541 HKLYTRNWTFAKRAKDIDIDTGRRELD 567

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  290 bits (742), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 171/590 (28%), Positives = 298/590 (50%), Gaps = 26/590 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSST---QYEDLATEKD 58
           E G  ++   ++ + ID+        +   N  E       T++S     + ++  T   
Sbjct: 74  EFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNG 133

Query: 59  EL-LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           ++  E   +K+S+K RH                     L NAGP G ++ Y  MG+ ++ 
Sbjct: 134 QMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYC 193

Query: 118 VTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQF 176
           + Q+ GEMA  +  +   F+ +    + P  G A  ++Y L W     LEL      I++
Sbjct: 194 IIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKY 253

Query: 177 WTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAG 235
           WT  V   A++ IF+V++    +F  + Y E EF+    K+L ++GF I  + I   GAG
Sbjct: 254 WTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAG 313

Query: 236 KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 295
             G +G +YW +PGA          G  RF G +++ ++AAF +  TE + +TA E +NP
Sbjct: 314 NDGYLGAKYWHDPGAF-----RGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNP 368

Query: 296 RKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQNAGTR 354
           RKA+P A +KVL R++  ++G++  +G  VP++  +L     S   +SP+++ I   G R
Sbjct: 369 RKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVR 428

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
           V+PH  NAVIL ++ S  NS  Y  SR+L  +A+ G APKF      QG P+ ++   + 
Sbjct: 429 VVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAAL 488

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
           FG +++   S    + F WLL I+G++  F W+ I  SH+RF +A+  +G S  ++ +KA
Sbjct: 489 FGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKA 548

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIY 529
               + +YYA   MV+ ++ Q + + AP           F   Y+++ + + F+  ++++
Sbjct: 549 QLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLW 608

Query: 530 FRC-RIIWKLEDVDIDTDRR--EIESVVWEDDAPKT------LWDKFWDF 570
            R  R+  + +D+D+D+ R+  + E +  ED+  K       +W +  DF
Sbjct: 609 KRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDF 658

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  287 bits (734), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 179/570 (31%), Positives = 298/570 (52%), Gaps = 26/570 (4%)

Query: 13  VIQDIDTI--IDGNDSDSHNSNTGELGRRKRKTSVS-------STQYEDLATEKDEL-LE 62
           ++ D D+I   D N +++ NS   +LG   R + V            ED  ++ +E+ +E
Sbjct: 1   MVNDKDSIRTKDINFNETSNSTAVDLGGEGRASGVFHRFIDSFKPPVEDEKSDLEEMSME 60

Query: 63  HHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
             D  +K+++K RH                     L+  GP   ++ Y+ +  V + + Q
Sbjct: 61  STDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQ 120

Query: 121 SLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GEMA   P +  SF+ +   F+S  +G A  +++ + W     LEL      IQ+W  
Sbjct: 121 AAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWND 180

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTG 238
            +    WI IF+V L   ++F VK YGE EF   + K+L + GF+I+S+ +   GAG  G
Sbjct: 181 SINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDG 240

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG +YW+NPG+      +S+T   RF      L+ A F+Y GTEL  ++  E ANPR++
Sbjct: 241 YIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRS 295

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPY-NDPKLTSTDSYVSSSPFIITIQNAGTRVLP 357
            P+A ++ + RIL+ Y+ ++  IG  VP+ ND  + +  S   +SP+++     G +V+P
Sbjct: 296 TPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVP 355

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           HI NAVIL  + S GNS++Y   R+  S+A+ G APK LA    +G P +++ A +  G 
Sbjct: 356 HIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGV 415

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           +++   S+   + F WL  I  ++  F W  I  SH+RF  A+K +G   ++L YKAL  
Sbjct: 416 IAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTG 475

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFR-CR 533
            W + +   F V++ + Q + + +P     S   F  +Y++  L+L F+  + ++ R   
Sbjct: 476 VWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFT 535

Query: 534 IIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            + KLED+D+D  RR  + E +  ED+  K
Sbjct: 536 FLTKLEDIDLDAHRRIYDPEFLRQEDEERK 565

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  288 bits (737), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 181/581 (31%), Positives = 305/581 (52%), Gaps = 31/581 (5%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKR 68
           +  + + D+D   D   S S  S    L + K   ++SS+  E     ++E  +  D+K+
Sbjct: 67  RNSNPLHDLDN--DITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNE--KSEDLKK 122

Query: 69  SLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT- 127
           ++K RH                     L+ AGP   ++ Y  MGT ++ + Q+ GE+A  
Sbjct: 123 TIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVV 182

Query: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187
           +  +   F+ +    + PALG +  ++Y L W     LEL      I++WT KV    ++
Sbjct: 183 YSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFV 242

Query: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWR 246
            IF+VL+ A N F  + Y E EF+    KVL + GF I  + I  G AG  G +G +YW 
Sbjct: 243 VIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWH 302

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           +PGA      + +    RF G + + + AAF +  TE + +TA E +NPRKA+P A +KV
Sbjct: 303 DPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKV 357

Query: 307 LIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVIL 365
           L RI+  ++ S+  IG  VPYN D  L S  S + +SP++I + + G RV+PH  NAVIL
Sbjct: 358 LYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVIL 417

Query: 366 TTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELST 425
            +++S GNS  Y  SR+L S+A+ G APK+      +G P+ ++L  + FG +++   S 
Sbjct: 418 LSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSP 477

Query: 426 GGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAI 485
              + F+WLL I+G++  F W+ I  SH+RF +A++ +G S  ++ Y +    + + YA 
Sbjct: 478 KETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAA 537

Query: 486 FFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIWKL--- 538
             + + ++ Q + + AP   G+    +F   Y+++ + + F+  ++++ R    WKL   
Sbjct: 538 IMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKR---DWKLFIR 594

Query: 539 -EDVDIDTDRREIESVV--WEDDAPKT------LWDKFWDF 570
            +D+D+DT R+  +  +   ED+  K       +W +F  F
Sbjct: 595 AKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLAF 635

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  286 bits (733), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 178/549 (32%), Positives = 288/549 (52%), Gaps = 25/549 (4%)

Query: 38  RRKRKTSVSSTQYEDLA-TEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPL 96
           R + +   + ++ + +A    +  L+HH     LK RH                     L
Sbjct: 57  RERLEVDPNMSELDQIAFRTANSPLQHH-----LKNRHLQMIAIGGAIGTGLFVGSGTAL 111

Query: 97  ANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYF 156
             AGP G L+ +   GT+++S+  +LGE+A   PV+  F+ +A RF+  + G AN   Y 
Sbjct: 112 RTAGPAGILIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYM 171

Query: 157 LSWCFTFALELSVVGQIIQFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASI 215
           L W     LE+      + +W T       ++++FW+ +   N+F VK YGE EF  + I
Sbjct: 172 LQWLVVLPLEIVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSII 231

Query: 216 KVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLIN 274
           KV+ ++GF+I  + + CG G   G IG RYW +P     G    ++  ARF G  S  + 
Sbjct: 232 KVITVVGFIILGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVT 287

Query: 275 AAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTS 334
           AAF++ G+ELVG+ + E ANPRK+VP+A ++V  RI LFY+ +L  +GL VPY + +L  
Sbjct: 288 AAFSFAGSELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIG 347

Query: 335 TDSY-VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393
             S   ++SPF+I I   G R LP + N VIL  ++S GNS +Y  SR L ++A+    P
Sbjct: 348 ASSVDAAASPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLP 407

Query: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453
           KF       G P  S+L  S FG ++++  S    + FNWLL ++G++  F W  I   H
Sbjct: 408 KFFGYIDRSGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCH 467

Query: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFV 510
           +RF +AL  +G   D+L + +    + +Y+ +F ++++ + Q + +  P     + + F 
Sbjct: 468 IRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFF 527

Query: 511 AAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRRE-----IESVVWEDD---APK 561
            AY+S  + +  +   +IY +  +I  K ED+DIDT R++     +   V E+    A K
Sbjct: 528 EAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEERAVLATK 587

Query: 562 TLWDKFWDF 570
             W ++W F
Sbjct: 588 PWWYRWWVF 596

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  288 bits (738), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 171/538 (31%), Positives = 274/538 (50%), Gaps = 21/538 (3%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDV--KRSLKQRHXXXXXXX 81
           N   +++ N+ E+    +K        +DL      +    D+  K  +K RH       
Sbjct: 110 NIDTAYDMNSNEVDPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLA 169

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQ 140
                         L  +GP G +V Y  +  V + V Q+ GEMA   P +   F+ +  
Sbjct: 170 TGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQS 229

Query: 141 RFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMF 200
            F+S   G A  +++ L+W     LEL      +++WT  +    ++ IF++ L   +  
Sbjct: 230 LFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFI 289

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSN 259
            ++ Y E EF+  S K+L + GF+I+S+ + CG AG  G IG +YW +PG       +S+
Sbjct: 290 GLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASD 344

Query: 260 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLF 319
            G ARF      LINA F+Y GTEL  ++  E  NPRKAVP A +  + R+ + Y+ ++ 
Sbjct: 345 NGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMI 404

Query: 320 FIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379
            IG  VPYN P L    +   +SP+++  Q  G +++PH  NAVIL ++IS  NS ++ G
Sbjct: 405 LIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAG 464

Query: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439
            R+L ++A+ G APKFL      G P L++   S FG +++   S    + F WL  I G
Sbjct: 465 PRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAG 524

Query: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499
           ++  FAW  I  SH+RF  A+K+ G S D++ YKA+   W +YY +FF +++++ Q + +
Sbjct: 525 LSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVA 584

Query: 500 F-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWK--------LEDVDIDTDRR 548
             AP   G+    ++    L  V W FF   + C +I+         L+D+D+D  RR
Sbjct: 585 LSAPGSGGQVTAISFFESYLAFVIWVFF---YLCYMIYNKDWTILIPLKDIDVDYQRR 639

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  286 bits (731), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 173/557 (31%), Positives = 288/557 (51%), Gaps = 16/557 (2%)

Query: 4   GPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSST-QYEDLATEKDELLE 62
           GP + K+ S      T     DS    S  G  G  +    ++S+ ++      + E + 
Sbjct: 25  GPENEKDSSAFVTEQT--PKTDSGFPLSAKGSSGVNQTTNDITSSGRFHSDDDVQQEDIN 82

Query: 63  HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
           + ++ + L  RH                     L+  GP   ++ ++ + T +F+V  SL
Sbjct: 83  NTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINSL 142

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           GE++   PV   F+V++ RF+ P+   A    Y   W     LEL      I++W  K+ 
Sbjct: 143 GELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKIN 202

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF 242
             AW++IF+  +   NM  VK +GE EF ++ IK+LA++GF I  + + CG G  G    
Sbjct: 203 SDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIG 262

Query: 243 -RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301
            +YW +PGA     +  ++G  +F G  S  + AAF+Y G E+  ++A E+ NPR+ +P+
Sbjct: 263 GKYWNDPGAF----VGHDSG-TKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPK 317

Query: 302 AIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHI 359
           A ++    I + Y+  L  IG  VP NDP+L +  S V  +SSP +I I+N   + LP +
Sbjct: 318 AAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSL 377

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            NA+IL  ++S  NS VY  SR + +MA  G  PKFL +   +G P  +++    FG LS
Sbjct: 378 MNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLS 437

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S   A+ F WL  ++G++  F W+ I+ SH+RF QA+K +  S D+LP+ +    W
Sbjct: 438 FVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVW 497

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFS----GRDFVAAYISVGLFLVFWGFFQIYFRC-RI 534
            + Y    + ++++   +TS  P  S       F   Y+S  + +V +   +IY R  R+
Sbjct: 498 GSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDWRL 557

Query: 535 IWKLEDVDIDTDRREIE 551
           + KLED+D+DT R++++
Sbjct: 558 LVKLEDMDLDTGRKQVD 574

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 161/505 (31%), Positives = 263/505 (52%), Gaps = 13/505 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           E     + L  RH                     L   GP   ++ ++ + T +F++  +
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181
           LGE+++  PV   F+V+  RF+ P+ G A    Y   W     LEL      I++W   +
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTI 185

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIG 241
              AW++IF+ ++   N+  VK +GE EF ++ +K+LA++GF I  + + CG G  G   
Sbjct: 186 NSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYI 245

Query: 242 F-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
             +YW NPGA        NT   RF G  S  + AAF+Y GTEL+ ++A E+ NPR  +P
Sbjct: 246 GGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 300

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT--STDSYVSSSPFIITIQNAGTRVLPH 358
           +A ++    I + YI  L  +G  VP +DP+L   S+   V++SP +I I+N G + LP 
Sbjct: 301 KACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPS 360

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
           + NA+IL  ++S  NS VY  SR + SMA+ G  PK  +    +G P  ++LA   FG L
Sbjct: 361 LMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLL 420

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           S++  S      F WL  ++G++  F W  I+ SH+RF   +K RG S D+LP+ ++   
Sbjct: 421 SFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGV 480

Query: 479 WLAYYAIFFMVVIILIQGFTSFAPHFSG----RDFVAAYISVGLFLVFWGFFQIYFRC-R 533
           W +YY    + V++++  +T+  P   G      F   Y+S  + LV +   ++Y +  R
Sbjct: 481 WGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWR 540

Query: 534 IIWKLEDVDIDTDRREIESVVWEDD 558
           ++    ++DID+ RR ++  V +D+
Sbjct: 541 LLTPTTEIDIDSGRRAVDIEVLKDE 565

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  286 bits (731), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 168/538 (31%), Positives = 282/538 (52%), Gaps = 22/538 (4%)

Query: 23  GNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXX 82
           GND D    +T E  R  + T  +++  ED+         + ++ + L  RH        
Sbjct: 54  GND-DILKGDTKEYPRDVKATPEAASYVEDI--------NNTNLNKDLSVRHLLTLAVGG 104

Query: 83  XXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRF 142
                        L   GP   ++ ++ + T +F+V  SLGE+A   PV   F+V+  RF
Sbjct: 105 AIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRF 164

Query: 143 LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPV 202
           + P+   A    Y   W     LEL      I++W  K+   AW++IF+  +   NM  V
Sbjct: 165 IEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDV 224

Query: 203 KFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTG 261
           K +GE EF ++ +K+LA++GF I  + + CG G  G     +YW NPGA        ++ 
Sbjct: 225 KSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHSA 279

Query: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321
            ++F G  S  + AAF+Y G E+  ++A E+ NP++ +P+A ++    I + Y+G L  I
Sbjct: 280 GSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLI 339

Query: 322 GLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVG 379
           G  VPYNDP+L +  S V  ++SP +I I+N G + LP + NA+IL  I+S  NS VY  
Sbjct: 340 GCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYAC 399

Query: 380 SRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITG 439
           SR + SMA  G  PKFL+K   +G P  ++L    FG LS++  S    + F WL  ++G
Sbjct: 400 SRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSG 459

Query: 440 VAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTS 499
           ++  F W+ I+ S +RF  A+K +G S D++P+ +    W A+Y +  + ++++   +TS
Sbjct: 460 LSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTS 519

Query: 500 FAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIES 552
             P      S + F   Y+S+ + +  +   +++ R  R++  L ++D+D+ RR +++
Sbjct: 520 LFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLDA 577

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  285 bits (730), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 280/528 (53%), Gaps = 31/528 (5%)

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           L+HH     LK RH                     L   GP   L+ +   GT+++++  
Sbjct: 86  LKHH-----LKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVM 140

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TF 179
           +LGE+A   P++  F+ +A RF+  + G AN + Y L W     LE+      + FW T 
Sbjct: 141 ALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTD 200

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
                 ++++FW+ +   NMF VK YGE EF  + IKV+ ++GF+I  + + CG G TG 
Sbjct: 201 PKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGG 260

Query: 240 IGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
               +YW +PGA      + +T  A+F G  S  + AAF++ G+ELVG+ A E+  PRK+
Sbjct: 261 YIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKS 315

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLP 357
           VP+A ++V  RI LFYI SL  IGL VPYND  L    S   ++SPF+I I+  G + LP
Sbjct: 316 VPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLP 375

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
            + N VIL  ++S GNS +Y  SR + ++A+    P+  +    +G P + +   SAFG 
Sbjct: 376 SVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGL 435

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           ++++  S    + FNWLL ++G++  F W  I   H+RF +AL  +G   D+L +K+   
Sbjct: 436 IAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTG 495

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
            W +Y+ +F ++++ + Q + +  P     S   F  AY+S  L +V +   +IY R   
Sbjct: 496 VWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRN-- 553

Query: 535 IWKL----EDVDIDTDRREIESVVWEDD--------APKTLWDKFWDF 570
            WKL    E +DIDT RRE++  + + +        A K  W + W+F
Sbjct: 554 -WKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNF 600

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  285 bits (730), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 180/577 (31%), Positives = 284/577 (49%), Gaps = 35/577 (6%)

Query: 2   EIGPSDLKEKS----VIQDIDTIIDGNDSDSHNSNTGELGRRKR---------KTSVSST 48
           + G S  KE S     I+    + +   S S  + +G+  R  +         K +  ST
Sbjct: 6   DFGSSGKKEASPDSISIRSFSAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGST 65

Query: 49  QY--------EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 100
            +         DL  + +       +K+S+K RH                     L   G
Sbjct: 66  THTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGG 125

Query: 101 PVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSW 159
           P   ++ Y  +  V + + Q+ GEMA   P + ++F+ ++  F+S   G A  ++Y   W
Sbjct: 126 PAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQW 185

Query: 160 CFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLA 219
                LEL      I+FW   +    +I IF+V L   + F VK YGE EF     K+L 
Sbjct: 186 LTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILM 245

Query: 220 LMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFT 278
           + GF+I S+ I CG AG  G IG +YWRNPGA      + +T   RF      L+ A F+
Sbjct: 246 IAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFS 300

Query: 279 YQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-S 337
           + G EL  ++  E ANPRK  P A ++ + RIL+ Y+ ++  IG  VPYND +L     S
Sbjct: 301 FGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGS 360

Query: 338 YVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLA 397
              +SP+++     G +V+PHI NAVIL ++IS  NS++Y G R++ S+A+ G  PKFL 
Sbjct: 361 ATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLD 420

Query: 398 KTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFM 457
               +G P ++++  S FG + ++  S+     F WL  I G++  F W  I  SH+RF 
Sbjct: 421 YVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFR 480

Query: 458 QALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAA 512
           QA+K +G S D+L YKA    W + Y +FF +++ + Q + + AP       S   F  +
Sbjct: 481 QAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQS 540

Query: 513 YISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR 548
           Y++  +++ F+  + IY R    +  L+ +D+D  R 
Sbjct: 541 YLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRH 577

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  286 bits (731), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 280/532 (52%), Gaps = 12/532 (2%)

Query: 49  QYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAY 108
           Q  D    +   LE    +R L  R                      +   GP   L+A+
Sbjct: 100 QNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAF 159

Query: 109 LFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELS 168
                V   +++ +  M T++PVT SF  F +RF+  + G A G+ YF+        E++
Sbjct: 160 CLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEIT 219

Query: 169 VVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSL 228
            V  ++++WT K+P AA IS+  +L  + N++ V F+GE EF+++  KV+  +G +I+++
Sbjct: 220 AVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTV 279

Query: 229 CIVCGAGKTGPI-GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGI 287
            ++ G      + GF+ W NPGA    I   + G  RF G++S L+ A + + G + +G 
Sbjct: 280 VVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVG--RFHGFMSCLVFALYVFWGVDYLGN 337

Query: 288 TAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSP 343
            A EA NPRK +P + RKV  R+++FYIG    +G+ +PYNDP +            +SP
Sbjct: 338 AASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASP 397

Query: 344 FIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQG 403
           ++  ++  G RVLPHI N +ILT+IISAGNS++Y  SR+L  +A +  AP+    TT +G
Sbjct: 398 YVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKG 457

Query: 404 VPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHR 463
           VP    +A+     L+Y+ +S        W LN+   A    ++ I  S+++F +    +
Sbjct: 458 VPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQ 517

Query: 464 GISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFVAAYISVGLFLVF 522
            +    LPY +  +P+LA++++F++V+++L+ G+T F    +  + FV +Y  +  FLVF
Sbjct: 518 NVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVF 577

Query: 523 WGFFQIYFRCRIIWKLEDVDIDTDRREI--ESVVWEDDAPKTLW-DKFWDFV 571
               ++Y   + +  LE +D+ T   E+  E   W ++ P   W D+ + F+
Sbjct: 578 LFGHKLYKGTKSVRPLE-MDLFTGIEELADEDRYWAENPPTLNWFDRAFGFL 628

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  285 bits (729), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 173/563 (30%), Positives = 292/563 (51%), Gaps = 22/563 (3%)

Query: 25  DSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL-LEHHDVKRSLKQRHXXXXXXXXX 83
           DS    S  G  G ++    ++S++      + +++ + + ++ + L  RH         
Sbjct: 44  DSTFPLSTKGSPGMKQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGA 103

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                       L+  GP   ++ ++ +GT +F+V  SLGE++   PV   F+V+  RF+
Sbjct: 104 IGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFV 163

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVK 203
            P+   A    Y   W     LEL      I++W  K+   AW++IF+  +   NM  VK
Sbjct: 164 EPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVK 223

Query: 204 FYGEFEFWIASIKVLALMGFLIYSLCIVC-GAGKTGPIGFRYWRNPGAMGPGIISSNTGE 262
            +GE EF ++ IK+L+++GF I  + + C G    G IG +YWRNPGA     +  N+G 
Sbjct: 224 SFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF----VGHNSG- 278

Query: 263 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIG 322
            +F G  S  + AAF+Y G E+  ++A E+ NPR+ +P+A ++    I   Y+  L  IG
Sbjct: 279 TKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIG 338

Query: 323 LTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGS 380
             VP NDP+L +  S V  +SSP +I I+N   + LP + NA+IL  ++S  NS VY  S
Sbjct: 339 CLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACS 398

Query: 381 RILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGV 440
           R + +MA  G  PKFL +   +G P  ++L    FG LS++  S   A+ F WL  ++G+
Sbjct: 399 RCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGL 458

Query: 441 AGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF 500
           +  F W+ I+ SH+RF +A+K +  S D+LP+ +      ++Y    + ++++   +TS 
Sbjct: 459 STIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSL 518

Query: 501 AP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE---- 551
            P      S   F   Y+S  + +V +   +IY R   ++ K+ED+D+DT R++++    
Sbjct: 519 FPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLR 578

Query: 552 ----SVVWEDDAPKTLWDKFWDF 570
                +  E+ A K+   +F  F
Sbjct: 579 REEMKIERENLAKKSFITRFLHF 601

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  285 bits (728), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 280/530 (52%), Gaps = 19/530 (3%)

Query: 35  ELGRRKRKTSVSSTQYEDLATEKDELLEHH----DVKRSLKQRHXXXXXXXXXXXXXXXX 90
            L +      V   +YED+   +  +        ++ R L  RH                
Sbjct: 36  SLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFV 95

Query: 91  XXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAA 150
                L   GP   ++A+  + T +F++  +LGE+A   PV   F+V+  R + P+LG A
Sbjct: 96  NSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFA 155

Query: 151 NGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEF 210
               Y   W     LEL      I++W   V   AW+++F+V +   ++  VK +GE EF
Sbjct: 156 VNINYLAQWAVLLPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEF 215

Query: 211 WIASIKVLALMGFLIYSLCIVCGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWV 269
            ++ +K+LA+ GF I  + ++CG G K G IG +YW +PG+     + ++ G ++F G  
Sbjct: 216 ILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSF----VGASPG-SQFKGLC 270

Query: 270 SSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYND 329
           S  + AAF+Y GTELVG++A E+ANPR  +P+A ++    I L Y+  L  IG  V ++D
Sbjct: 271 SVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDD 330

Query: 330 PKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMA 387
           PKL S  S V  ++SP +I I+N G + LP + NA+IL  IIS  NS+VY  SR + SMA
Sbjct: 331 PKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMA 390

Query: 388 KNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWL 447
           + G  P+       +G P ++++    FG LS++  S    + F WL  ++G++  F WL
Sbjct: 391 EIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWL 450

Query: 448 LISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSG 506
            I+ SH+RF +AL  +G S D+LPY ++     ++Y    ++++++   +TS  P   SG
Sbjct: 451 AINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSG 510

Query: 507 RD---FVAAYISVGLFLVFWGFFQIYFRCRIIWKLED--VDIDTDRREIE 551
            D   F   Y+S+ +FL  +   ++Y R    W +    +D++T RR I+
Sbjct: 511 ADWESFFKGYLSLPIFLFCFVGHKLYKR-NWSWMIRSNKIDVNTGRRMID 559

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  285 bits (728), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 183/566 (32%), Positives = 289/566 (51%), Gaps = 36/566 (6%)

Query: 10  EKSVIQDID-TIIDGNDSDSH---NSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65
           EK+ +Q  D    +G+++      NS     GR   + S+                +H  
Sbjct: 41  EKASVQKSDFEYFEGDETKFRRFVNSFKKAPGRENDQESLQDNN------------KHEK 88

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K++++ RH                     L N GP G  V +  MGT V+ V Q+ GEM
Sbjct: 89  LKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEM 148

Query: 126 ATFIPVTSS-FSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA 184
           A   P  S  F+ +    + P  G A  ++Y + W   F LEL      I++WT  +   
Sbjct: 149 AVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAINPD 208

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKTGPIGFR 243
            ++++F++L+   N F  + Y E EF+  + KVL ++GF I  + +  GA G  G IG +
Sbjct: 209 IFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAK 268

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
           YWR PG+ G      +T    F G VS+L+NAAF+   +E V +TA E ANPRK+VP A 
Sbjct: 269 YWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVPSAA 323

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLPHIFNA 362
           +K+L ++ + ++GS+  IG  VP N  +L  STDS V  SP++I + + G RV+PH  NA
Sbjct: 324 KKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHFINA 383

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL +++S GNS  Y  SR+L S+A+ G AP        QG P ++++     G L ++ 
Sbjct: 384 VILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVA 443

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S      F WLL I+G++  F W  I  SH+RF +AL  +G   D L +KA    W +Y
Sbjct: 444 ASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSY 503

Query: 483 YAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIWKL 538
           Y+   M++  + Q +T   P  S +     F   Y++  +F+  +  ++IY +    W+L
Sbjct: 504 YSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKN---WQL 560

Query: 539 ----EDVDIDTDRREIES-VVWEDDA 559
               E +D+D  R+  ++ V+ ++DA
Sbjct: 561 FIPAEKIDLDLHRKIFDADVLKQEDA 586

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  284 bits (726), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 179/570 (31%), Positives = 294/570 (51%), Gaps = 36/570 (6%)

Query: 31  SNTGELGRR--KRKTSVSSTQYEDLATEKDELLEHHDVKRS------------LKQRHXX 76
           S+  E+G+   K +T     Q + LA EKD   + +DV+++            L  RH  
Sbjct: 16  SSLSEVGQSFAKEETWSVEKQLKPLAEEKD-YADMNDVEKAIYNTKDSKLNKDLSIRHLL 74

Query: 77  XXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFS 136
                              L+  GP   ++A+  + T +F++  SLGE++   PV   F+
Sbjct: 75  TLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFN 134

Query: 137 VFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTA 196
           V+  RF+ P+ G A  + Y   W     LEL      I++W   +   AW+SIF+V +  
Sbjct: 135 VYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIFYVAIAF 194

Query: 197 FNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC-GAGKTGPIGFRYWRNPGAMGPGI 255
            NM  VK +GE EF ++ +K+LA++GF I  + ++C G    G IG +YW +PGA     
Sbjct: 195 ANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAF---- 250

Query: 256 ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI 315
              +T   RF G  +  I AAF+Y G ELVG++A E+ NPR  +P+A ++    I + Y+
Sbjct: 251 -VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYL 309

Query: 316 GSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGN 373
             L  IG  VP NDP L +  S V  ++SP +I IQN G + LP + NA+IL  ++S  N
Sbjct: 310 VILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVAN 369

Query: 374 SNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNW 433
           S VY  SR + SMA+ G  P+ LA    +G P  ++      G LS++  S    + F W
Sbjct: 370 SAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTW 429

Query: 434 LLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIIL 493
           L  ++G++  F W  I+ +H+RF  A+KH+  S ++LPY ++   W ++Y    + ++++
Sbjct: 430 LSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLI 489

Query: 494 IQGFTSFAPH-FSGRD---FVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR 548
              +TS  P   +G D   F  +Y+S+ +F+  +   +I+ R  R+  KL +VD+D+ R 
Sbjct: 490 ASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRT 549

Query: 549 EIESVVWEDDAP--------KTLWDKFWDF 570
           + ++   + +          K  + + W+F
Sbjct: 550 DTDAATLKQEKEAEAELMKTKPFYIRLWNF 579

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  283 bits (723), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 171/534 (32%), Positives = 275/534 (51%), Gaps = 20/534 (3%)

Query: 41  RKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAG 100
           R+      +  DL      ++    +K+++K RH                     L  +G
Sbjct: 28  RRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSG 87

Query: 101 PVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSW 159
           P   ++ Y+ +  V + + Q+ GEMA   P +  SF+ +   F+S   G A  +++F+ W
Sbjct: 88  PASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQW 147

Query: 160 CFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLA 219
              F LEL      +++W  K+    +I IF+  L   + F VK YGE EF   S KVL 
Sbjct: 148 LTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLM 207

Query: 220 LMGFLIYSLCIVCG-AGKTGPIGFRYWRNPG--AMGPGIISSNTGEARFLGWVSSLINAA 276
           + GF+I S+ I CG AG  G IG +YW +PG  A GP I        RF G    L++A 
Sbjct: 208 VAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADGPPI-------TRFKGVCFILVSAY 260

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
           F+Y G EL  ++  E  NPRK+ P A ++ + RIL+ Y+ ++  IG  VP+N  +L    
Sbjct: 261 FSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAG 320

Query: 337 SYVS-SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKF 395
           S  + +SP+++       +V+PH  NAVIL ++IS  NS +Y   R++ S+A+ G APKF
Sbjct: 321 SAATHASPYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKF 380

Query: 396 LAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVR 455
           L     +G P   ++  + FG + ++  S+   + F WL  I G++  F W  I  SH+R
Sbjct: 381 LNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIR 440

Query: 456 FMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFV 510
           F QA+K  G S D++ +KA+   W +YY   F +++ + Q + + +P  SG       F 
Sbjct: 441 FRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFF 500

Query: 511 AAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            +Y++  ++LVF+  + IY R   I+  LE +D+D  RR  + + +  ED+  K
Sbjct: 501 QSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK 554

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 182/571 (31%), Positives = 289/571 (50%), Gaps = 42/571 (7%)

Query: 7   DLKEKSVI---QDIDTIIDGNDSDSHNSNTGEL----------GRRKRK-----TSVSST 48
           DLK+   +   QDI+T  +    D +   +             G R+ K      ++SST
Sbjct: 13  DLKKDQNLYFTQDIETSSENEGYDKYERESKSSSKSWIHNFVDGFREYKLDDVDPNLSST 72

Query: 49  QYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAY 108
           +   +AT +  L      KR LK RH                     L   GP   ++A+
Sbjct: 73  ERAAIATARSPL------KRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAW 126

Query: 109 LFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELS 168
           +  G++V+SV Q++GE+   +PV+ S+  +  RF+ P+ G A  Y Y +    T  LE+ 
Sbjct: 127 ILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIV 186

Query: 169 VVGQIIQFWTFKVPLA-AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYS 227
                + +W      A  ++++F+V +   N   VK YGE EF  + IKVLA++GF+I  
Sbjct: 187 AASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILG 246

Query: 228 LCIVCGAG--KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELV 285
           + +VCG G   TG IG +YW NPG    G          F G+ +  + +AF++ G+E+ 
Sbjct: 247 IVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMF 296

Query: 286 GITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL-TSTDSYVSSSPF 344
            + A E+ NPR+ +P+A ++V  RI LFY+ SL  IG  VPY +  L  S+    S+SPF
Sbjct: 297 ALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPF 356

Query: 345 IITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGV 404
           +I I+ AG   LP + N VIL  ++S GN+ V+  SR   S+A  G  PK  A    +G 
Sbjct: 357 VIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGR 416

Query: 405 PYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRG 464
           P   ++    FG LS++  S      F W+L ++G+  FF W  I   H+RF Q L+ +G
Sbjct: 417 PLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQG 476

Query: 465 ISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLV 521
            S D+L +KA    W + Y I  + V++  Q + +  P     S   F   Y+S+ + +V
Sbjct: 477 RSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIV 536

Query: 522 FWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           F+   ++Y R  R++   +++D+DT RRE++
Sbjct: 537 FYMGHKVYSRNWRLVIPAKELDLDTGRREVD 567

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  281 bits (720), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 164/504 (32%), Positives = 272/504 (53%), Gaps = 22/504 (4%)

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           L + ++ ++L  RH                     L++ GP   +V ++ + T +F+V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
           SLGE+A   P+   F+V+  RF+ P++G A    Y   W     LEL      I++W  K
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240
           +   AW++IF+V +   NM  VK +GE EF ++ +K+LA++GF I  + +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 241 G-FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
             F+YW NPGA   G     T  ++F G  S  + AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL----TSTDSYVSSSPFIITIQNAGTRV 355
           P+A ++    +   Y+  L  +G  VPYND +L    TS D+  ++SP +I I+N G + 
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDA--AASPLVIAIENGGIKG 330

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           LP + NA+IL  I+S  NS VY  SR + SMA  G  PK L+K   +G P  +++    F
Sbjct: 331 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIF 390

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
           G LS++  S    + F WL  ++G++  F W+ I+ S +RF +A++ +  S D+LPY + 
Sbjct: 391 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQ 450

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFR 531
              W A+Y +  + ++I+   +TS  P    H     F  +++S+ + LV +   ++YF 
Sbjct: 451 TGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFA 510

Query: 532 CRIIWKL----EDVDIDTDRREIE 551
               W+L    E++DID+ R+ I+
Sbjct: 511 RN--WRLQIGAEEMDIDSGRKIID 532

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  282 bits (722), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 168/545 (30%), Positives = 284/545 (52%), Gaps = 15/545 (2%)

Query: 16  DIDTIIDGNDSDSHNSNTGELGRRKRKTSV-SSTQYEDLATEKDELLEHHDVKRSLKQRH 74
           +ID      + DS  S    L  +     + ++T +  + + +D++  + ++ ++L  RH
Sbjct: 25  NIDANFALEEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDI-NNVNLNKNLSIRH 83

Query: 75  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSS 134
                                LA+ GP   ++ ++ + T +F+V  +LGEMA   PV   
Sbjct: 84  LLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGG 143

Query: 135 FSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLL 194
           F+V+  RF+ P++G A    Y   W     LEL      I++W   +   AW++IF+ ++
Sbjct: 144 FNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVI 203

Query: 195 TAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC-GAGKTGPIGFRYWRNPGAMGP 253
              NM  VK +GE EF ++ IK+LA++GF I  + + C G    G IG +YW +PG+   
Sbjct: 204 ALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF-- 261

Query: 254 GIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLF 313
             +  N+G  +F G  S  + AAF+Y G E+  ++A E+ +PR  +P+A ++    I   
Sbjct: 262 --VGHNSG-TKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITAS 318

Query: 314 YIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISA 371
           Y+  L  IG  VPY+DP+L S  S V  +SSP +I I+N G + LP + NA+IL +IIS 
Sbjct: 319 YVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISV 378

Query: 372 GNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAF 431
            NS VY  SR + +MA  G  P+ L +   +G P  +++    FG LS++  S   A  F
Sbjct: 379 ANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVF 438

Query: 432 NWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVI 491
            WL  ++G++  F W+ I+ SH+RF Q++  +  S D+LP+ +    W ++Y    + ++
Sbjct: 439 TWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLV 498

Query: 492 ILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCR-IIWKLEDVDIDTD 546
           ++   +TS  P          F   Y+S  + L  +   ++Y R R  +  L D+D+DT 
Sbjct: 499 LVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTG 558

Query: 547 RREIE 551
           RR+++
Sbjct: 559 RRQVD 563

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  282 bits (722), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 183/569 (32%), Positives = 286/569 (50%), Gaps = 37/569 (6%)

Query: 23  GNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLE--HHDVKRSLKQRHXXXXXX 80
           G+ +DS N+          K++    Q  D+     EL+E   H V R LK RH      
Sbjct: 31  GHSADSWNN---------EKSAYQVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIAL 81

Query: 81  XXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQ 140
                          L+  GP   L++Y+ M   V+ +   L EM   +P++   S+FA 
Sbjct: 82  GGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAM 141

Query: 141 R--FLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFN 198
              +L+  L    G   F +       E++    +IQ+WT     A +ISIF V+  +  
Sbjct: 142 TGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT-DANSAIFISIFIVVTVSLT 200

Query: 199 MFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG--KTGPIGFRYWRNPGAMGPGII 256
           M PV F+GE EFW++ IK+  + G +I  + I  G    +   +GF YW++PGA  P ++
Sbjct: 201 MLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLV 260

Query: 257 SSNTGEARFLGWVSSLINAAFTYQGT-ELVGITAGEAANPRKAVPRAIRKVLIRILLFYI 315
             NTG  +FL   +++I + F+Y    E+V   A EA +PR+ +PR  ++ + R+ LFY+
Sbjct: 261 PGNTG--KFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYV 318

Query: 316 GSLFFIGLTVPYNDPKLTST----DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISA 371
                IG+ V Y++ +L +     +S  ++SPF+I IQ  G RVLPHI NA ILT+  S 
Sbjct: 319 CGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSC 378

Query: 372 GNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAF 431
           G S +Y  SR+L SMA NG  PK  A T   G PY S  A S F  L+Y+  S   +  F
Sbjct: 379 GTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVF 438

Query: 432 NWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVI 491
            WL NI  ++GF  W+L+   ++RF + ++H  ++ D +P++  +M  LAY +  F  ++
Sbjct: 439 TWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAIL 497

Query: 492 ILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREI 550
            L  G+  F A +++  DF A Y ++GL  V +    IY++     KL D+D +     I
Sbjct: 498 SLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK---TIKLRDLD-EVAAEII 553

Query: 551 ESVVWEDD--------APKTLWDKFWDFV 571
             +   D+         PK   +K W F+
Sbjct: 554 PKIAMADEEEKGEVPIVPKNWLEKVWYFL 582

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  283 bits (724), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 173/532 (32%), Positives = 287/532 (53%), Gaps = 24/532 (4%)

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
           EKD+  +  ++K+++K RH                     LAN+GP G ++ Y  MG+ +
Sbjct: 101 EKDD--DARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCI 158

Query: 116 FSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           + + Q+ GE+A  +  +T  F+ +    + PA G A  ++Y + W     LEL      I
Sbjct: 159 YCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTI 218

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCIVCG 233
           ++WT KV    ++ IF+ L+   N+      Y E EF+  S K+L L GF I  + ++CG
Sbjct: 219 KYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICG 278

Query: 234 -AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292
            AG  G IG R W NPG+        +    RF G VS+L+NAAF +  +E +G+TA E 
Sbjct: 279 GAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQ 333

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNA 351
           +NPRKA+P A +K+L RI+  Y+GS+  +G  VPY+ D  L S+ +   +SP+++ I   
Sbjct: 334 SNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLH 393

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLA 411
           G RV+PH  NAVIL +++S GNS  Y  SR L S+++ G AP FL      G P  +   
Sbjct: 394 GVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCV 453

Query: 412 ISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLP 471
            +  G +++   S    + F WLL I+G++  F W  I  SH+RF +A++ +G S  ++ 
Sbjct: 454 SALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVG 513

Query: 472 YKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAA----YISVGLFLVFWGFFQ 527
           +K+    + + Y+   MV+I++ Q +T+  P   G+  V A    Y+++ +F+V +  F+
Sbjct: 514 FKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFK 573

Query: 528 IYFRC-RIIWKLEDVDIDTDRR--EIESVVWEDDAPKT------LWDKFWDF 570
           I+ +  R+  + ED+D+ + R   + E +  ED+  +       +W + +DF
Sbjct: 574 IWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDGPMWRRVYDF 625

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  282 bits (722), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 167/539 (30%), Positives = 278/539 (51%), Gaps = 21/539 (3%)

Query: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXX 80
           +   DS   N  T ++    R      T+ ED+         + ++ + L  RH      
Sbjct: 49  LSSKDSPGINQTTNDITSSDRFRRNEDTEQEDI--------NNTNLSKDLSVRHLLTLAV 100

Query: 81  XXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQ 140
                          L+  GP   ++ ++ + T +F+V  SLGE++   PV   F+V++ 
Sbjct: 101 GGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSM 160

Query: 141 RFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMF 200
           RF+ P+   A    Y   W     LEL      I++W  K+   AW++IF+  +   NM 
Sbjct: 161 RFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANML 220

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSN 259
            VK +GE EF ++ IK+L+++GF I  + + CG G  G     +YW +PGA     +  +
Sbjct: 221 DVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----VGHS 276

Query: 260 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLF 319
           +G  +F G  S  + AAF+Y G E+  ++A E+ NPR+ +P+A ++    I   Y+  L 
Sbjct: 277 SG-TQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILT 335

Query: 320 FIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVY 377
            IG  VP NDP+L +  S V  +SSP +I I+N G + LP + NA+IL  ++S  NS VY
Sbjct: 336 LIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVY 395

Query: 378 VGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNI 437
             SR + +MA  G  PKFL +   +G P  ++L    FG LS++  S   A+ F WL  +
Sbjct: 396 ACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSAL 455

Query: 438 TGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGF 497
           +G++  F W+ I+ SH+RF QA+K +  S D+LP+ +      ++Y    + ++++   +
Sbjct: 456 SGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFW 515

Query: 498 TSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           TS  P      S   F   Y+S  + +V +   ++Y R   ++ KLED+D+DT R++++
Sbjct: 516 TSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  282 bits (722), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 165/507 (32%), Positives = 275/507 (54%), Gaps = 15/507 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           +H ++K+++K RH                     L + GP G+ + +L MG  V+ V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 122 LGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW--T 178
            GE+A  +  +   F+ +    + PALG A  ++Y L W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 179 FKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKT 237
             V    +++IF+VL+   N F  + Y E EF+  S KVL ++GF I  + I  GA G +
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 238 GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297
           G IG +YWR+PG++G       T    F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVL 356
           ++P A +K++ +I + ++GS+  IG  VP +  +L  S DS +  SP++I ++  G  V+
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P   NAVIL +++S GNS  Y  SR+L S+A+   APK        G P ++++    FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
           ++ ++  S    + F WLL I+G++  F W  I  SH+RF +AL  +G S D+L +KA  
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQT 500

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC 532
               +Y +   MV+ ++ Q + S  P          F   Y+++ +FL+F+  ++I+ + 
Sbjct: 501 GIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKD 560

Query: 533 -RIIWKLEDVDIDTDRREIESVVWEDD 558
            R+  + + +D+ + RR  ++ V + +
Sbjct: 561 WRLFIRADQIDLVSHRRIFDADVLKQE 587

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  279 bits (714), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 150/456 (32%), Positives = 258/456 (56%), Gaps = 10/456 (2%)

Query: 96  LANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMY 155
           LA  GP+   +AYLF G+++  V  SL EMA F P+   FS +  +++ PA G A G+ Y
Sbjct: 63  LARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNY 122

Query: 156 FLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASI 215
           FL +    +  L+  G +I +W   + +A W+++ +      N   V+++G+ E ++   
Sbjct: 123 FLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVA 182

Query: 216 KVLALMGFLIYSLCIVCGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLIN 274
           K+  L+   I  L I CG G     IGFRYWR  G + P ++  NTG  +FLGW + +I 
Sbjct: 183 KLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESGFL-PYLVKGNTG--KFLGWWACVIQ 239

Query: 275 AAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT- 333
           + F + G+E++GI  GE ANPRK +P+A R V+IRI +FYI  +F +GL V  ++ KL  
Sbjct: 240 SIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVH 299

Query: 334 --STDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGL 391
             STD+  ++SPF+I I  +G +VLP   NA +L  I S+  +++Y+ SR L+ +AK+G 
Sbjct: 300 AHSTDA--NASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGA 357

Query: 392 APKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISC 451
           APK   +     +P +  +  S  G L+YM      A  F ++ +   V G   W  I  
Sbjct: 358 APKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILV 417

Query: 452 SHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVA 511
           +++ + + +K  G+  D++P++  + P+ AY A+FF+ VI    G+++F   F+ + F+ 
Sbjct: 418 AYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFIT 477

Query: 512 AYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
           +YI +   ++    +++Y++ + + K E++  +  +
Sbjct: 478 SYIGIFANVLLVLGYKLYYKTKWV-KPEEITFEKKQ 512

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 166/565 (29%), Positives = 283/565 (50%), Gaps = 24/565 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL 61
           E  PS L+  S     D+  D  DS   +  +G   +       +S + ED         
Sbjct: 19  ETQPSRLR--SARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVED--------- 67

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           +     + L  RH                     L   GP   ++ ++ + T +F++  +
Sbjct: 68  QDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNA 127

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181
           LGE+++  PV   F+V+  RF+ P+ G A    Y   W     LEL      I++W   +
Sbjct: 128 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTI 187

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIG 241
              AW++IF+ ++   N+  VK +GE EF ++ +K+LA++GF I  + + CG G  G   
Sbjct: 188 NSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYI 247

Query: 242 F-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
             +YW NPGA        +T   RF G  S  + AAF+Y GTEL+ ++A E+ NPR  +P
Sbjct: 248 GGKYWSNPGAF-----VGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 302

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPH 358
           +A ++    I + YI  L  +G  V  +DP+L +  S V  ++SP +I I+N G + LP 
Sbjct: 303 KACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPS 362

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
           + NA+IL  ++S  NS VY  SR + SMA+ G  PK       +G P  +++A   FG L
Sbjct: 363 LMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLL 422

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           S++  S    + F WL  ++G++  F W  I+ SH+RF + +K RG + D+LP+ ++   
Sbjct: 423 SFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGV 482

Query: 479 WLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-R 533
           W +YY    + +++++  +TS  P      +   F   Y+S  + L  +   ++Y R  R
Sbjct: 483 WGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWR 542

Query: 534 IIWKLEDVDIDTDRREIESVVWEDD 558
           ++   +++D+D+ RR ++  + +D+
Sbjct: 543 LLTPTKEIDLDSGRRAVDLELMKDE 567

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/538 (33%), Positives = 285/538 (52%), Gaps = 17/538 (3%)

Query: 30  NSNTGELGRRKRKTSVSSTQYE-DLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXX 88
           NS+TG  G+     S S T+ E      K+++  H  + + L  RH              
Sbjct: 62  NSSTGAGGK---GDSHSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGL 118

Query: 89  XXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALG 148
                  L++ GP   ++ ++ + T +F+V  SLGE+A   PV   F+V+  RF+ P+ G
Sbjct: 119 FVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFG 178

Query: 149 AANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEF 208
            A    Y   W     LEL      I++W  K+   AW++IF+  +   NM  VK +GE 
Sbjct: 179 FAVNINYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGET 238

Query: 209 EFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLG 267
           EF ++ IK+LA++GF I  + + CG G  G     +YW +PGA         T   +F G
Sbjct: 239 EFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKG 293

Query: 268 WVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPY 327
             S  + AAF+Y G EL  ++A E+ NPR+ +P+A ++    I L Y+  L  IG  VPY
Sbjct: 294 LCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPY 353

Query: 328 NDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFS 385
           N+PKL +  S V  +SSP +I I+N G R LP + NA+IL  I+S  NS VY  SR + S
Sbjct: 354 NNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVS 413

Query: 386 MAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFA 445
           MA+    P+FL +   +G P  + L    FG LS++  S    + F WL  ++G++  FA
Sbjct: 414 MARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFA 473

Query: 446 WLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HF 504
           W+ I+ SH+RF QA+ H+GIS D+LPY ++     ++Y +  + ++++   +TS  P   
Sbjct: 474 WMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGG 533

Query: 505 SGRD---FVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRREIESVVWEDD 558
            G D   F   Y+S  + +V +   ++Y R  R++  + D+D+ +DR+ ++  V  ++
Sbjct: 534 KGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREE 591

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  283 bits (723), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/559 (30%), Positives = 291/559 (52%), Gaps = 22/559 (3%)

Query: 2   EIGPS-DLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           +I PS ++K+  + + ID+     D D+  +   E       + +S+T+    A   +E 
Sbjct: 68  KILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEK 127

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
            +H  +++++K RH                     L  AGP G ++ Y  MG+ ++ + Q
Sbjct: 128 DDH--LQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQ 185

Query: 121 SLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GEMA  +  +  +F+ +    +  A G +  ++Y L W     LEL      IQ+WT 
Sbjct: 186 ACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT 245

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTG 238
            V    ++ IF+VL+   N+F  K Y E EF+  S KVL + GF I ++ I   GAG  G
Sbjct: 246 TVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDG 305

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG +YW NPGA        +    RF   +S+   AAF +  +E + I A E +NPR+A
Sbjct: 306 YIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRA 360

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS-SSPFIITIQNAGTRVLP 357
           +P A + ++ RIL  ++ S+  +G  VPYN  +L  + S  + +SP++I + + G RV+P
Sbjct: 361 IPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVP 420

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           H  NAVIL +++S  NS  Y   RIL+S+++ G AP +      +G P  +++  + F  
Sbjct: 421 HFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSV 480

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           +++   S+     F WLL I+G++  F W+ I  SH+RF +A+K +G S D++ +K+   
Sbjct: 481 IAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVG 540

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533
            W + YA   M + ++ + + S AP    H   ++F   Y+++ + +V +  ++I   C+
Sbjct: 541 VWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CK 597

Query: 534 IIWKL----EDVDIDTDRR 548
             WKL    +D+D+ + R+
Sbjct: 598 RDWKLFIRAKDIDLVSHRK 616

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/528 (31%), Positives = 272/528 (51%), Gaps = 16/528 (3%)

Query: 42  KTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 101
           KT   +    DL    + +     +K+S+K RH                     L   GP
Sbjct: 67  KTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGP 126

Query: 102 VGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWC 160
              ++ Y+ +  V + + Q+ GEMA   P + ++F+ ++  F+S   G A  ++Y   W 
Sbjct: 127 AALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWL 186

Query: 161 FTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLAL 220
               LEL      IQ+W  K+    +I IF++ L   ++F VK YGE EF     K+L +
Sbjct: 187 TVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMI 246

Query: 221 MGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY 279
            GF+I S+ I CG AG  G IG  YW NPGA      + +T  ARF      L+   F++
Sbjct: 247 AGFIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSF 301

Query: 280 QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SY 338
            G EL  ++  E +NPRK+ P A ++ + RI++ Y+ ++  IG  VPYND +L     S 
Sbjct: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSA 361

Query: 339 VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAK 398
             +SP+++     G +++PHI NAVIL +++S  NS++Y G R++ S+++ G APKFL  
Sbjct: 362 THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDY 421

Query: 399 TTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQ 458
              +G P  +++    FG ++++  S+     F WL  I G++  F W  I  SH+RF Q
Sbjct: 422 VDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481

Query: 459 ALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAY 513
           A+K +G S D+L YKA    W + Y  FF +++ + Q + + AP       S   F  +Y
Sbjct: 482 AMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESY 541

Query: 514 ISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDD 558
           ++  ++L F+  + IY R   ++  L+ +D+D  RR  + E +  ED 
Sbjct: 542 LAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQ 589

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 183/573 (31%), Positives = 295/573 (51%), Gaps = 19/573 (3%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDL-ATEKDEL 60
           E G S+   +  I   D + DG+    +          KR  S +    +DL     + +
Sbjct: 18  ECGSSNSNLRESISSND-LSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEGASINSV 76

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
             +   K+S+K RH                     L   GP G L+ Y  +  V + + Q
Sbjct: 77  RSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQ 136

Query: 121 SLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GEMA   P +  +F+V++  F+S + G A  ++Y L W     LEL      I++W  
Sbjct: 137 AAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNS 196

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
            +   A+I+IF+ ++   + F    YGE EF  ++ KV  + GF+I S+ I CG   TG 
Sbjct: 197 SINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGG 256

Query: 240 IGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
                YWRNPGA   G   S  G  + + +V  L+ A F+Y G EL  +T  E ANPRKA
Sbjct: 257 YIGGEYWRNPGAFAGG---SPIGHFKGIAYV--LVTAYFSYGGMELFALTVNEQANPRKA 311

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL--TSTDSYVSSSPFIITIQNAGTRVL 356
           VP A +K + RIL+ Y+ ++  IG  VPYN  +L  +S  S   +SP++I + + G +V+
Sbjct: 312 VPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKVV 371

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHI NAVIL +++S GNS +Y   R+L S+A+ G APK  +     G P ++++  S FG
Sbjct: 372 PHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFG 431

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            LS++  S    + F WL  I G++  F W  I  SHVRF  A+K++G S  +L YK+  
Sbjct: 432 LLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKT 491

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVAAYISVGLFLVFWGFFQIYFR 531
             W + YAIFF +++ + Q + + AP  +G       F  +Y++  +++  +  ++IY +
Sbjct: 492 GYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSK 551

Query: 532 C-RIIWKLEDVDIDTDRREIESVV--WEDDAPK 561
             +++  L+++D+++ R   +  +   EDD  K
Sbjct: 552 EWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHK 584

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 183/569 (32%), Positives = 296/569 (52%), Gaps = 30/569 (5%)

Query: 5   PSDLKEKSVIQDID-------TIIDGNDSDSHNSNTGELGRRKRKT--SVSSTQYEDLAT 55
           P +LK   +  D +       TI     + S    +G   +  R +   V   + +   T
Sbjct: 12  PENLKHNGITIDSEYLTQEPITIPSNGSAVSTEKGSGSKWKDFRDSFKRVEPVEVDPNLT 71

Query: 56  EKDE---LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
           E ++   +     +K  LK RH                     L   GP   L+ +  MG
Sbjct: 72  EAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMG 131

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           T+++++  +LGE+A   P++  F+ +A RF+  + G A  + Y L W  T  LE+     
Sbjct: 132 TMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASI 191

Query: 173 IIQFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIV 231
            + +W T       ++++FW+++   NMF VK YGE EF  + IKV+ ++GF+I  + + 
Sbjct: 192 TVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILN 251

Query: 232 CGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290
           CG G + G IG +Y+ +PGA      + +T  A+F G  S  + AAF++ G+ELVG+ A 
Sbjct: 252 CGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAAS 306

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQ 349
           E+ +PRK+VP+A ++V  RI LFYI SL  IGL VPYND +L    S   ++SPF+I I 
Sbjct: 307 ESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIV 366

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
             G + LP + N VIL  ++S GNS ++  SR   ++A+ G  P+  A    +G P + +
Sbjct: 367 THGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGI 426

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
           +  SA G ++++  S      FNWLL ++G++  F W  I   H+RF +AL  +G S D+
Sbjct: 427 IITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDE 486

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFF 526
           L +K+    W +Y+ +F +V++ + Q + +  P     S   F  AY+S  L L  +   
Sbjct: 487 LSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGH 546

Query: 527 QIYFRCRIIWKL----EDVDIDTDRREIE 551
           +IY R    WKL     ++DID+ RRE++
Sbjct: 547 KIYKRN---WKLLIPAGEMDIDSGRREVD 572

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  280 bits (717), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 277/530 (52%), Gaps = 14/530 (2%)

Query: 31  SNTGELGRRKRKTSV-SSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXX 89
           S+ G  G  +    V SS  +      + E + + ++ + L  RH               
Sbjct: 50  SSKGSPGINQTTNDVTSSDHFRGSEGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLY 109

Query: 90  XXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA 149
                 L+  GP   ++ ++ + T +F+V  SLGE++   PV   F+V++ RF+ P+   
Sbjct: 110 VNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAF 169

Query: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           A    Y   W     LEL      I++W  K+   AW++IF+  +   NM  VK +GE E
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETE 229

Query: 210 FWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGW 268
           F ++ IK+L+++GF I  + + CG G  G     +YW +PGA     +  ++G  +F G 
Sbjct: 230 FVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF----VGHSSG-TQFKGL 284

Query: 269 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328
            S  + AAF+Y G E+  ++A E+ NPR+ +P+A ++    I   Y+  L  IG  VP N
Sbjct: 285 CSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSN 344

Query: 329 DPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386
           DP+L +  S V  +SSP +I I+N G + LP + NA+IL  ++S  NS VY  SR + +M
Sbjct: 345 DPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAM 404

Query: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
           A  G  PKFL +   +G P  ++L    FG LS++  S   A+ F WL  ++G++  F W
Sbjct: 405 AHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCW 464

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFS- 505
           + I+ SH+RF QA+K +  S D+LP+ +      ++Y    + ++++   +TS  P  S 
Sbjct: 465 MAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSS 524

Query: 506 ---GRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
                 F   Y+S  + +V +   +IY R   ++ KLED+D+DT R++++
Sbjct: 525 GANAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  280 bits (717), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 166/534 (31%), Positives = 287/534 (53%), Gaps = 24/534 (4%)

Query: 30  NSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXX 89
           +S T E G  K   ++ +T  E  +  K+++ E  ++ + L  RH               
Sbjct: 61  DSKTKEGGSEK---NIETTPSEQFSIAKEDINE--NLNKDLSIRHLITLAVGGSIGVGLF 115

Query: 90  XXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA 149
                 LA+ GP   ++ ++ + T +F+V  +LGE+A   PV   F+V+  RF+ P++  
Sbjct: 116 VNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAF 175

Query: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           A    Y   W     LEL      I++W   +   AW++IF+ ++   NM  VK +GE E
Sbjct: 176 AINLNYLAQWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETE 235

Query: 210 FWIASIKVLALMGFLIYSLCIVC-GAGKTGPIGFRYWRNPGAM---GPGIISSNTGEARF 265
           F ++ +K+LA++GF I  + + C G  + G +G  YW +PG+     PG         +F
Sbjct: 236 FVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPG--------TQF 287

Query: 266 LGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTV 325
            G  S  + AAF+Y G EL  ++A E+ +PRK +P+A ++    +   Y+  L  IG  V
Sbjct: 288 KGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLV 347

Query: 326 PYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRIL 383
           P++DP+L +  S V  ++SP +I+I+NAG + L  + NA+IL +I+S  NS VY  SR +
Sbjct: 348 PFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCM 407

Query: 384 FSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
            SMA  G  PK L++   +G P  ++L+   FG LS++  S   A+ F WL  ++G++  
Sbjct: 408 VSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTI 467

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
           F W+ I+ SH+RF  A+K +  + D+LPY +      ++Y +  + ++++   +TS  P 
Sbjct: 468 FCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPL 527

Query: 504 FSG----RDFVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRREIES 552
            SG      F   Y+S+ + +  +   ++Y R  +++ KLED+D++T R+ I++
Sbjct: 528 GSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDA 581

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  280 bits (715), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 163/514 (31%), Positives = 269/514 (52%), Gaps = 26/514 (5%)

Query: 58  DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           D     H++KR+LK RH                     LA+ GP+  ++ +   GT +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
               LGE+    PV  +F+ ++ RFL P++      +Y + W F   LE+      IQ+W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
              +    W++IF+ ++ + N+F  + +GE EF  +SIKV+ ++GF+I  + ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPD 256

Query: 238 GP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
              +G RYW +PG +  G          F G +S L+ A+++  GTE+V + +GE  NPR
Sbjct: 257 HDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPR 305

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVL 356
           + +P AI++   RIL F++ SL  IG  VPY +P L    S V++SPF+I I+    + L
Sbjct: 306 E-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKAL 363

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P I NAVIL +I+S GNS ++  SR L SMA  GL PKF       G P   +L  S FG
Sbjct: 364 PSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFG 423

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++  S+   + F+WL+ I G+A    WL I+ SH+RF  A+K +G S D+L + +  
Sbjct: 424 LLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAV 483

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAPHFSGRD-------FVAAYISVGLFLVFWGFFQIY 529
             W + Y+     +I++ Q + +  P    +D       F  +Y+   +    +   +++
Sbjct: 484 GMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVF 543

Query: 530 FRCRI-----IWKLEDVDIDTDRREIESVVWEDD 558
           +R +      I  L+ +D++TDR+ I+  V + +
Sbjct: 544 YRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQE 577

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  278 bits (711), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 162/520 (31%), Positives = 277/520 (53%), Gaps = 13/520 (2%)

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           LE    +R L  R                      + + GP   L+A+     V   ++Q
Sbjct: 40  LEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQ 99

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            +  M T++PVT SF  F +RF+  + G + G+ YF+        E++ V  +++FWT K
Sbjct: 100 CMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK 159

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240
           +P AA ISI   L  + N+F V  +GE EF+++  KV+  +G + +++ ++ G      +
Sbjct: 160 IPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKV 219

Query: 241 -GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
            GF+ W NPGA    I   + G  +F G++S LI A + + G + +G  A EA NPRK +
Sbjct: 220 LGFKNWSNPGAFAEYISKGSAG--KFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVI 277

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY----VSSSPFIITIQNAGTRV 355
           P + RKV  R+++FYIG    +G+ VP+ND  +    S       +SP++  ++  G  V
Sbjct: 278 PSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGV 337

Query: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415
           LPHI N +ILT+IISAGNS++Y  SR+L  +A  G APK L K T +GVP    +A+   
Sbjct: 338 LPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPK-LFKITKRGVPIYCCVAVLLV 396

Query: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475
             L+Y+ +S        W LN+   A    ++ I  S+++F +  K + I    LPY + 
Sbjct: 397 CGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSS 456

Query: 476 WMPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
           ++P+L ++++F++V+++ + G+  F    +  + F+ +Y  +  F+V +   ++Y + R 
Sbjct: 457 FLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRF 516

Query: 535 IWKLEDVDIDTDRREI--ESVVWEDDAPK-TLWDKFWDFV 571
           +  +E +D+ +   E+  E   WE++ PK  L DK + F+
Sbjct: 517 VKPVE-MDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFI 555

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/546 (31%), Positives = 282/546 (51%), Gaps = 23/546 (4%)

Query: 42  KTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 101
           K +  ST+  DL      L +   +K+++K RH                     L+  GP
Sbjct: 52  KRAQDSTE-NDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGP 110

Query: 102 VGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWC 160
              ++ Y+ +  V + + Q+ GEMA   P +  +F+ +   F+S   G A  +++F+ W 
Sbjct: 111 GSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWL 170

Query: 161 FTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLAL 220
             F LEL      I++W  K+    +I IF+V L   + F VK YGE EF   S KVL +
Sbjct: 171 TVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMI 230

Query: 221 MGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTY 279
            GF+I S+ I CG AGK G IG +YWR+PG+   G         +F G    L+ A F+Y
Sbjct: 231 AGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEG-----DSVEKFKGICYILVTAYFSY 285

Query: 280 QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSY 338
            G EL  ++  E  NPRK+ P+A ++ + RIL+ Y+ ++  IG  VP+N+ +L  S  S 
Sbjct: 286 GGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSA 345

Query: 339 VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAK 398
             +SP+++     G +V+PH  NAVIL ++IS  NS +Y   R++ S+A+ G APKFL  
Sbjct: 346 THASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDY 405

Query: 399 TTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQ 458
              +G P  +++  + FG + ++  S+   + F WL  I G++  F W  I  SHVRF Q
Sbjct: 406 VDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQ 465

Query: 459 ALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAY 513
            +K  G S +++ ++A+   W + Y I F +++ + Q + + AP           F  +Y
Sbjct: 466 CMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSY 525

Query: 514 ISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK------TLW 564
           ++  ++L F+  + +Y R    +  L+ +D++  RR  + E +  ED+  K      ++W
Sbjct: 526 LAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVW 585

Query: 565 DKFWDF 570
            + + F
Sbjct: 586 VRMFHF 591

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 176/542 (32%), Positives = 278/542 (51%), Gaps = 23/542 (4%)

Query: 26  SDSHNSNTGELGRR--KRKTSVSSTQYEDLATEK----DELLEHHDVKRSLKQRHXXXXX 79
           +D   ++ GE  R        V   +Y+++   +    D       + ++L  RH     
Sbjct: 63  NDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLA 122

Query: 80  XXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA 139
                           L   GP   L+A+  + T +F++  SLGE+A+  PV   F+V+ 
Sbjct: 123 VGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYI 182

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199
            RF+ P+ G A    Y   W     LEL+     I++W  K+   AW++IF+V +   NM
Sbjct: 183 TRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANM 242

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISS 258
             VK +GE EF ++ +K+LA+ GF I    ++CG G  G     +YW +PGA        
Sbjct: 243 LDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VG 297

Query: 259 NTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSL 318
           +T  A+F G  S  + AAF+Y GTELVG++A E+ NPR  +PRA ++    I   Y+  L
Sbjct: 298 DTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVL 357

Query: 319 FFIGLTVPYNDPKL----TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNS 374
              G  VP NDP+L    +S D  V++SP +I I+N G R +P + NA+IL  IIS  NS
Sbjct: 358 TIAGCLVPSNDPRLLNGMSSVD--VAASPLVIAIENGGIRGVPSLMNAIILIAIISVANS 415

Query: 375 NVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWL 434
           +VY  SR + SMA+ G  PK       +G P +++LA   FG LS++  S      F WL
Sbjct: 416 SVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWL 475

Query: 435 LNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILI 494
             ++G++  F W  I+ SH+RF +A+  +  S D+LPY +L     ++Y    ++ ++++
Sbjct: 476 SALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVL 535

Query: 495 QGFTS-FAPHFSG---RDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRRE 549
             +TS F P  SG     F   Y+S  +FL+ +   ++Y R  R+      +D+D+ RR 
Sbjct: 536 SFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRA 595

Query: 550 IE 551
           ++
Sbjct: 596 LD 597

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  279 bits (713), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/535 (31%), Positives = 275/535 (51%), Gaps = 20/535 (3%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
            DL +     +    +K+S+K RH                     L  +GP   ++AY  
Sbjct: 86  NDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGL 145

Query: 111 MGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           +  V + + Q+ GEMA   P +  +F+ +   F+S   G A  +++ L W     LEL  
Sbjct: 146 VSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELIT 205

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
               I++W  K+    ++ IF+V L   + F V+ YGE EF   S K+L + GF+I+S+ 
Sbjct: 206 SSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIV 265

Query: 230 IVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288
           + CG AG  G IG +YW +PGA      +S+T   RF G    L+ A F+Y GTEL  ++
Sbjct: 266 VNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLS 320

Query: 289 AGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPY-NDPKLTSTDSYVSSSPFIIT 347
             E  NPRK+ P+A ++ + RI++ Y+ ++  IG  VP+ ND  + S  S   +SP+++ 
Sbjct: 321 VNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLA 380

Query: 348 IQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYL 407
               G R++PH  NAVIL ++IS  NS++Y   R+L S+A+ G APKFL     QG P  
Sbjct: 381 ASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLT 440

Query: 408 SVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISR 467
           ++   S FG + +   S    + F WL  I G++  F W  I  SHVRF QA+K +G   
Sbjct: 441 ALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDL 500

Query: 468 DDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFS---GRDFVAAYISVGLFLVFWG 524
           ++L YKA+   W + Y +FF +++   Q + + AP  S      F  +Y++  +F  F+ 
Sbjct: 501 NELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYF 560

Query: 525 FFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK------TLWDKFWDF 570
            + ++ +    +  LE +D+D  RR  + E +  E +  K      ++W + + F
Sbjct: 561 GYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMYYF 615

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  276 bits (707), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 167/528 (31%), Positives = 279/528 (52%), Gaps = 16/528 (3%)

Query: 32  NTGELGRRKRKTSVSSTQYEDLATEKDELLE---HHD---VKRSLKQRHXXXXXXXXXXX 85
            +  L + K     +  Q E+  T  + + +   H+D   +K+ LK RH           
Sbjct: 6   KSSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFG 65

Query: 86  XXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSP 145
                     L   GPVG L+AY+ +G VV     ++ E+A+F+P T +    +++F+  
Sbjct: 66  TGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDE 125

Query: 146 ALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFY 205
           A+G   G++   ++      ELS    ++ +WT   P A +I+IF VL    N++ ++FY
Sbjct: 126 AVGFTFGWIS--TYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFY 182

Query: 206 GEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARF 265
           GE E++   +K+  +   +I  L I  G  K   +GF YWRNPG     ++  +TG  +F
Sbjct: 183 GEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDTG--KF 240

Query: 266 LGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTV 325
           +G+ ++L +  ++Y G + + I AGE  N R A+    + V +RI+L Y+ ++F + L V
Sbjct: 241 VGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIV 300

Query: 326 PYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFS 385
           PYND  + +      SSPF+I ++ AG +VLPHI NA+ILT+  SAGN  +  GSR LF 
Sbjct: 301 PYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFC 360

Query: 386 MAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFA 445
           +A    APK   KT+ +G+P++ VL IS+F  L+YM  S   A  F+W   +        
Sbjct: 361 LATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLR 420

Query: 446 WLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HF 504
           W+LIS +H+   +AL+ +G SR DLPY     P+ A+++     + +L  GF +F   +F
Sbjct: 421 WILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNF 480

Query: 505 SGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDT---DRRE 549
               F + Y  + L +  + F++++ + R + +  +VD+ +   D RE
Sbjct: 481 DIESFFSRYFIIPLAIALFTFWKLFKKTRYL-RPHEVDLQSIFEDIRE 527

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  278 bits (711), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 183/575 (31%), Positives = 292/575 (50%), Gaps = 24/575 (4%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRR----KRKTSVSSTQYEDLATEKDEL- 60
           S  K +SV      + D      H  + G   R     KR    S  Q  DL T   +  
Sbjct: 16  SSTKSESVTAS--ELYDSRPHAQHEEHEGAWCRFRDSFKRAQKRSVPQGGDLETASVQTD 73

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
           L    ++RS++ RH                     L   GP G ++ Y  +  V + + Q
Sbjct: 74  LTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQ 133

Query: 121 SLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GEMA   P +  +F+ ++  F+S   G A+ ++Y L W   F LEL      I++WT 
Sbjct: 134 AAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD 193

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTG 238
            V    +I+IF+V +   + F  + YGE EF     KVL + GF+I ++ I CG AG +G
Sbjct: 194 SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSG 253

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG RYW +PGA   G  +S     +F G+   L+   F+Y GTEL  +T  E ++PR+A
Sbjct: 254 YIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST--DSYVSSSPFIITIQNAGTRVL 356
           +  A ++ + RIL+ Y+ ++  IG  VP+   +L  +   S   +SP+++ +   G +V+
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVV 368

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           PHI NAVIL  ++S GNS +Y G R+L ++A+ G APKFLA     G P ++++A S  G
Sbjct: 369 PHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIG 428

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++  S      F WL  I G++  F W  I  SH+RF QA+K+ G S   L YK++ 
Sbjct: 429 LLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSIT 488

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP-HFSGR----DFVAAYISVGLFLVFWGFFQIYF- 530
             W + Y + F +++ + Q + + AP   +G+     F  +Y++  L+ VF+  + +Y  
Sbjct: 489 GLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSG 548

Query: 531 RCRIIWKLEDVDIDTDR--REIESVVWEDDAPKTL 563
              I+  L+D+DI+  R   + E +  E    KT+
Sbjct: 549 EWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTM 583

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  278 bits (711), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 167/533 (31%), Positives = 280/533 (52%), Gaps = 16/533 (3%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           +R  S    +  DL      +  ++ +K+S+K RH                     L+ A
Sbjct: 60  RRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA 119

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP   ++ Y+ +  V + + Q+ GEM    P +  +F+ +   F+S + G A  +++ + 
Sbjct: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      +++W   +    +I IF+V L   + F VK YGE EF   S K+L
Sbjct: 180 WLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 219 ALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            + GF+I S+ I CG AG  G IG +YWR+PG+   G     +G  RF G    L++A F
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYF 294

Query: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STD 336
           ++ G EL  ++  E +NPRK+ P A ++ + RIL+ Y+ ++  IG  VP+N+ +L  S  
Sbjct: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGG 354

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
           S   +SP+++       RV+PHI NAVIL ++IS  NS +Y   R++ S+A+ G APKFL
Sbjct: 355 SATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                +G P  +++  S  G + ++  S    +AF WL  I G++  F W  I  SH+RF
Sbjct: 415 NYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVA 511
            +A+K +G S D++ YKA    W +YY +FF +++ + Q + + +P  +G     + F  
Sbjct: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFE 534

Query: 512 AYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
           +Y++  L++  +  + +Y R    +  L+ +D+D  RR  + E +  ED+  K
Sbjct: 535 SYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  278 bits (710), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 168/533 (31%), Positives = 277/533 (51%), Gaps = 16/533 (3%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           KR  S       DL      +  ++ +K+S+K RH                     L  A
Sbjct: 60  KRAESQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP   ++ Y+ +  V + + Q+ GEM    P +  +F+ +   F+S + G A  +++ + 
Sbjct: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQ 179

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      I++W  K+    +I IF+V L   + F VK YGE EF  +S K+L
Sbjct: 180 WLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKIL 239

Query: 219 ALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            + GF+I S+ I CG AG  G IG +YWR+PG+   G      G  RF G    L+ A F
Sbjct: 240 MIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGICFILVTAYF 294

Query: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDS 337
           ++ G EL  ++  E +NPRK+ P A ++ + RIL+ Y+ ++  IG  VP+N+ +L  + S
Sbjct: 295 SFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGS 354

Query: 338 YVS-SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
             + +SP+++       RV+PHI NAVIL ++IS  NS +Y   R++ S+A+ G APKFL
Sbjct: 355 AATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                +G P  ++      G + ++  S    +AF WL  I G++  F W  I  SH+RF
Sbjct: 415 DYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRF 474

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVA 511
            +A+K +G S D++ YKA    W +YY +FF +++ + Q + + +P  +G     + F  
Sbjct: 475 RKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFE 534

Query: 512 AYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
           +Y++  L+L  +  + +Y R    +  L+ +D+D  RR  + E +  E++  K
Sbjct: 535 SYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENK 587

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  278 bits (710), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 281/528 (53%), Gaps = 19/528 (3%)

Query: 35  ELGRRKRKTSVSSTQYEDLATEKDELLE----HHDVKRSLKQRHXXXXXXXXXXXXXXXX 90
           ++  R  +  + S +  D + + ++L +    H + K+++K RH                
Sbjct: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117

Query: 91  XXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGA 149
                L+ AGP   ++AY  +  V + + Q+ GEMA   P +  SF+ +   F+S   G 
Sbjct: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177

Query: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           A  +++ + W     LEL      I++W   +    ++ IF+V L   + F V+ YGE E
Sbjct: 178 ATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETE 237

Query: 210 FWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGW 268
           F   + K+L + GF+I+++ + CG AGK G IG +YW +PGA      +S+ G +RF G 
Sbjct: 238 FIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGI 292

Query: 269 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328
             +L+NA F+Y G EL  ++  +  NPRK+ P A +  + RI++ Y+ ++  IG  VP+N
Sbjct: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352

Query: 329 DPKL--TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386
             +L   S  + + +SP+++     G +V+PHI NAVIL  +IS  NS++Y G R+L S+
Sbjct: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412

Query: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
           A+ G AP+FL+    +G P  ++L  +  G + +   S    + F WL  I+G++  F W
Sbjct: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG 506
             I  SH+RF +A+K +  S D L YKA    W +Y+ + F +++   Q + + +P  SG
Sbjct: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532

Query: 507 -----RDFVAAYISVGLFLVFW-GFFQIYFRCRIIWKLEDVDIDTDRR 548
                  F A+Y+++ ++LVF+ G+   Y    ++  L  VD+D  R+
Sbjct: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK 580

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  279 bits (714), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 161/510 (31%), Positives = 267/510 (52%), Gaps = 13/510 (2%)

Query: 46  SSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGAL 105
           ++ Q E+L   + +   + ++++++K RH                    PLA AGP   +
Sbjct: 139 TTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLV 198

Query: 106 VAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFA 164
           + Y  MGT ++ + Q+ GEMA  +  +T SF+ F    + P    A  ++Y + W     
Sbjct: 199 IGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCP 258

Query: 165 LELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFL 224
           LEL      IQ+WT KV    ++ IF+VL+   N F  K Y E EF   + KVL + GF 
Sbjct: 259 LELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFF 318

Query: 225 IYSLCIVCGA-GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTE 283
           I ++CI  GA G  G IG +YW +PGA         T   RF G + + + AAF +  TE
Sbjct: 319 ILAICIDTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATE 373

Query: 284 LVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSS 342
            + +TA E +NPRKA+P A +K++ R+L+ ++ ++  IG  VPY+ D  L S  S   +S
Sbjct: 374 FIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKAS 433

Query: 343 PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQ 402
           P+++ I   G RV  H  NAVIL ++IS GNS  Y  SR+L S+A+ G APK       +
Sbjct: 434 PYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDRE 493

Query: 403 GVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKH 462
           G P +++   +    +++   S    + F WL+ I G++  F W  I  SH+RF +A+K 
Sbjct: 494 GRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKV 553

Query: 463 RGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFS----GRDFVAAYISVGL 518
           +G S  ++ Y +      + YA   M++ ++ Q + +  P  +       F + Y+++ +
Sbjct: 554 QGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPI 613

Query: 519 FLVFWGFFQIYFRC-RIIWKLEDVDIDTDR 547
            +VF+  ++I+ R  R+  + +D+D+ + R
Sbjct: 614 LIVFYFGYKIWKRDWRLFIRAKDIDLISHR 643

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  278 bits (710), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 181/581 (31%), Positives = 304/581 (52%), Gaps = 45/581 (7%)

Query: 6   SDLKE----KSVIQDIDT------IIDGNDSDSHNSNTGELGRRKRKTSV-----SSTQY 50
           SD+K+     S I D++T       I  + +D + S++      K+K+++     S  + 
Sbjct: 22  SDVKKPDGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKKKSNLRRFVDSFKRA 81

Query: 51  EDLATEKDELLE-------------HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLA 97
           E +    D++ E               ++K+++K RH                     L 
Sbjct: 82  EHMIPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALV 141

Query: 98  NAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPA--LGAANGYM 154
            AGP G +  Y  MGT V+ + QS GEMA  +  +   F+ +    + P   +    G +
Sbjct: 142 KAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVL 201

Query: 155 YFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIAS 214
           + +  C +F +         ++WT +V    ++ IF+VL+   N+F  + Y E EF+   
Sbjct: 202 FTMVDCLSFGIGYCF--DDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNC 259

Query: 215 IKVLALMGFLIYSLCI-VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLI 273
            KVL + GF I  + I V GAG  G +G  YWRNPGA        + G   F G V++L+
Sbjct: 260 CKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLV 314

Query: 274 NAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT 333
            AAF + GTE + +TA E +NPRKA+P A +KVL RI+L Y+ S+  IG  VP+  P+L 
Sbjct: 315 TAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELL 374

Query: 334 STDSYVSS-SPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLA 392
            + S  ++ SP++I + + G RV+PH  NAVIL +++S GNS  Y  SR+L S++K G A
Sbjct: 375 GSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYA 434

Query: 393 PKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCS 452
           PK+      +G P  +++  + FG +++   S    + F WLL I+G++  F W+ I  S
Sbjct: 435 PKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLS 494

Query: 453 HVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRD 508
           H+RF  A+K +G S  ++ +KA    W +YY+IF M++ ++ Q + + AP      S R+
Sbjct: 495 HIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARN 554

Query: 509 FVAAYISVGLFLVFWGFFQIYFRCRIIW-KLEDVDIDTDRR 548
           F   Y+++ + + F+  ++I+ +   ++ K ED+D+ + R+
Sbjct: 555 FFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQ 595

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  277 bits (708), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 177/496 (35%), Positives = 271/496 (54%), Gaps = 18/496 (3%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +KR LK RH                     L  AGP G L+ +   GT+++ +  ++GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLA 184
           A   PV+  F+ +A RF+  + G AN + Y L W     LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFR- 243
            ++++F+V++ + NMF VK YGE EF  + IKV+ ++GF+I  + +VCG G  G      
Sbjct: 197 GFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGA 256

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
            W NPGA        NT   RF G  S  + AAF++ G+ELVG+ + E ANPRK++PRA 
Sbjct: 257 NWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAA 311

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNA 362
           ++V  RI LFYI SL  IGL VPYND +L    S   ++SPF++ I+N G + LP + N 
Sbjct: 312 KQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVNV 371

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL  ++S GNS V+  SR L ++A+ G  PK       +G P + +   S FG LS++ 
Sbjct: 372 VILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIA 431

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S    + F+WLL ++G++  F W+ I   H+RF +AL  +G S D+L + +    W + 
Sbjct: 432 ASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWGSI 491

Query: 483 YAIFFMVVIILIQGFTSFAPHFS---GRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL- 538
           Y    +++I+  Q + +  P  S    +DF  +Y+S+ + LV +   + Y R    WKL 
Sbjct: 492 YGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRN---WKLF 548

Query: 539 ---EDVDIDTDRREIE 551
              E++DIDT RRE++
Sbjct: 549 IRAENIDIDTGRREVD 564

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/521 (32%), Positives = 268/521 (51%), Gaps = 16/521 (3%)

Query: 52  DLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFM 111
           DL            +K+S+K RH                     L   GP   ++ Y+ +
Sbjct: 77  DLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLV 136

Query: 112 GTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
             + + + Q+ GEMA   P + ++F+ ++  F+S   G A  ++Y   W     LEL   
Sbjct: 137 SFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITA 196

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
              IQFW  K+    +I IF+V L   + F VK YGE EF     K+L + GF++ S+ I
Sbjct: 197 SMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVI 256

Query: 231 VCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
            CG AG  G IG  YW  PGA      + +T  ARF      L+ A F++ G EL  ++ 
Sbjct: 257 NCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSV 311

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITI 348
            E  NPRK+ P A ++ + RI++ Y+ ++  IG  VPYND +L     S   +SP+++  
Sbjct: 312 QEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAA 371

Query: 349 QNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLS 408
              G R++PHI NAVIL +++S  NS++Y G R++ S+A+ G APKFL     +G P  +
Sbjct: 372 SIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRA 431

Query: 409 VLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRD 468
           ++     G ++++  S+     F WL  I G++  F W  I  SH+RF QA+K +G S +
Sbjct: 432 LIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLN 491

Query: 469 DLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVAAYISVGLFLVFW 523
           +L YKA    W + Y  FF +++ + Q + + AP  +G       F  +Y++  ++L+F+
Sbjct: 492 ELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFY 551

Query: 524 GFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
             + IY R   ++  L+ +D+D  RR  + E +  ED+  K
Sbjct: 552 IGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 181/564 (32%), Positives = 294/564 (52%), Gaps = 23/564 (4%)

Query: 3   IGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLA-----TEK 57
           +G SDL ++++   I   I    + S  S T     R +K   S  + ED+      TE 
Sbjct: 35  VGSSDLTQENIQSSITHTIS---NPSFTSTTQPSTTRWQKFKDSFKKAEDVELDPNLTEA 91

Query: 58  DELLE---HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
           + + +      ++ +LK R                      L   GP G ++ +    T+
Sbjct: 92  ERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTM 151

Query: 115 VFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           ++S+  +LGE+A   PV   F+ +A RF+  + G AN + Y L W     LE+      +
Sbjct: 152 IYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITV 211

Query: 175 QFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG 233
            +W T       ++++FW+++   NMF VK +GE EF  + IKV  ++GF+I  + +VCG
Sbjct: 212 NYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCG 271

Query: 234 AGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292
            G  G     +YW +PGA     +   +G A+F G  S  + AAF++ G+EL+GITA EA
Sbjct: 272 GGPKGGFVGAKYWHDPGAF----VGHGSG-AQFKGVCSVFVTAAFSFAGSELIGITAAEA 326

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNA 351
           ANPRK++P A ++V+ RI+LFY+G+L  IGL VPYND +L    S   ++SPF+I I   
Sbjct: 327 ANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTH 386

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLA 411
           G + LP + N VIL  ++S GNS ++  SR + +++  G  PK        G P + +  
Sbjct: 387 GIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAI 446

Query: 412 ISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLP 471
            S FG L+++  S    + FNWLL ++G++  F W  I   H+RF  ALK +G   ++L 
Sbjct: 447 TSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELT 506

Query: 472 YKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRD---FVAAYISVGLFLVFWGFFQI 528
           + +      +Y+ +F +V++ + Q + +  P     D   F  +Y+S  + +  +   +I
Sbjct: 507 FVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKI 566

Query: 529 YFRC-RIIWKLEDVDIDTDRREIE 551
           Y R  ++   LED+DIDT RRE +
Sbjct: 567 YKRNWKLFIPLEDMDIDTGRRETD 590

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 266/496 (53%), Gaps = 12/496 (2%)

Query: 63  HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
           H  +K  LK RH                     L  AGP G L+ +   GT+++ +  ++
Sbjct: 78  HAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAM 137

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKV 181
           GE++   P++  F+ +A RF+  + G AN + Y L W     LE+      + +W T   
Sbjct: 138 GELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPK 197

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIG 241
               ++++FWV++   N+F VK YGE EF  + IKVL ++GF+I  + + CG G  G   
Sbjct: 198 YRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYI 257

Query: 242 F-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
             +Y+ +PGA        +T  ARF G  S  + AAF++ G+EL+GI A E+A PRK+VP
Sbjct: 258 GGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVP 312

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHI 359
           +A ++V  RI LFY+ SL  +GL VPY D +L    S   ++SPF+I I + G R LP +
Sbjct: 313 KAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSV 372

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            N VIL  ++S GNS VY  SR L ++A+    PK        G P   +   SAFG ++
Sbjct: 373 VNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVA 432

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S    + F WLL ++G++  F W  I   H+RF  AL  +G S D+LP+KA    +
Sbjct: 433 FVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIY 492

Query: 480 LAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RII 535
            + + +F +V++ + Q + +  P     S   F  +Y+S  + L F+   ++Y R  +++
Sbjct: 493 GSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLL 552

Query: 536 WKLEDVDIDTDRREIE 551
             L  +DIDT RRE++
Sbjct: 553 IPLSKLDIDTGRREMD 568

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  276 bits (706), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 166/564 (29%), Positives = 289/564 (51%), Gaps = 32/564 (5%)

Query: 17  IDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH---------HDVK 67
           +D+    +      +   ++       S SS Q  +L  EKDE  +            +K
Sbjct: 60  LDSFKRADQDQEQEAEVAQMNDLTSAISPSSRQAHEL--EKDETTDKIAPHTGHKSDSLK 117

Query: 68  RSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA- 126
           ++++ RH                     L +AGP G L+ Y  MG++++ + Q+ GEMA 
Sbjct: 118 KTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMAL 177

Query: 127 TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAW 186
            +  +T  ++ +    +    G A  ++Y L W     LEL      I++WT  V    +
Sbjct: 178 VYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVF 237

Query: 187 ISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIGFRYW 245
           + IF+VL+   N+F  + Y E EF+    K+L + GF I  + I V GAG  G IG +YW
Sbjct: 238 VIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYW 297

Query: 246 RNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRK 305
             PGA   G+ + +    RF G V++L+ AAF + G+E + IT  E +NPRKA+P A ++
Sbjct: 298 HEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQ 352

Query: 306 VLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVI 364
           ++ RIL  ++ ++  +G  VPYN D  L S+     +SP++I I + G RV PH  NAVI
Sbjct: 353 MIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVI 412

Query: 365 LTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELS 424
           L +++S  NS+ Y  +R+  ++++ G APK  +     G P +++   + F  +++   S
Sbjct: 413 LLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAAS 472

Query: 425 TGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYA 484
               + F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +K+    W + Y+
Sbjct: 473 PKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYS 532

Query: 485 IFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIWKL-- 538
              M++I++ Q + + AP   G+     F   Y+++ + +V +  ++++ +    WKL  
Sbjct: 533 CIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNK---DWKLFI 589

Query: 539 --EDVDIDTDRR--EIESVVWEDD 558
             + +D+ + R+  + E +  EDD
Sbjct: 590 RADKIDLTSHRQIFDEELIKQEDD 613

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  276 bits (705), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 166/523 (31%), Positives = 276/523 (52%), Gaps = 22/523 (4%)

Query: 65  DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGE 124
            +KR +K RH                     LA  GP G  + Y  MG+ ++S+ Q+ GE
Sbjct: 101 SLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGE 160

Query: 125 MATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPL 183
           +A   P +T +F+ +    + PA+  A   +Y + W   F LE+      I++W   +  
Sbjct: 161 LAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINP 220

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGF 242
             W  IF+V++   NM     Y E +F+  + K+L   GF I  + I CG AG +  IG 
Sbjct: 221 NVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGG 280

Query: 243 RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 302
           +YW +PGA      + +TG +RF   VS+L+ AAF +  +E V +TA E ANPRKA+P A
Sbjct: 281 KYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSA 335

Query: 303 IRKVLIRILLFYIGSLFFIGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFN 361
            ++VL RI+  Y+ S+  +G  VPYN P+L  S  S V SSP++I + + G +V+P   N
Sbjct: 336 AKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFIN 395

Query: 362 AVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYM 421
           AVIL +++S GN + Y  SRIL  +++ G APKF      QG P  +++  +  G + ++
Sbjct: 396 AVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFV 455

Query: 422 ELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLA 481
             S+     F WL+ ++G++  F W  I  SHVRF +A++ +  S  +L +++    W +
Sbjct: 456 SASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGS 515

Query: 482 YYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RII 535
           YY IF M+++ + Q + +  P          +F A Y+++ +FL  +  F+I+ +  R+ 
Sbjct: 516 YYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLY 575

Query: 536 WKLEDVDIDTDRR--EIESVVWEDDAPK------TLWDKFWDF 570
               ++D+ + R+  + E +  ED+  K      ++W K  +F
Sbjct: 576 IPASEIDLISHRKIFDEEILKQEDEEYKIKMKHASIWVKLSNF 618

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  276 bits (706), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 179/575 (31%), Positives = 297/575 (51%), Gaps = 31/575 (5%)

Query: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKD---------ELLEHHDVKRSLK 71
           IDG    +++++  E    +  T VS     D     D         +  E H +K+S+K
Sbjct: 72  IDGFRRQTNHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEH-LKKSIK 130

Query: 72  QRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIP 130
            RH                     L +AGP G  + Y  MG+ ++ + Q+ GEMA T+  
Sbjct: 131 PRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSN 190

Query: 131 VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIF 190
           +   F+ +    +SP LG A  ++Y+L W     LEL      I++WT KV    ++ IF
Sbjct: 191 LVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIF 250

Query: 191 WVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPG 249
           + L+   N+F  + Y E EF+    KVL + GF I  + I CG AG  G IG +YW +PG
Sbjct: 251 YFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPG 310

Query: 250 AMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIR 309
           A        +    RF G  ++L+ AAF + G+E + +TA E +NPRKA+P A +K+L R
Sbjct: 311 AF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYR 365

Query: 310 ILLFYIGSLFFIGLTVPYNDPKLTSTDS-YVSSSPFIITIQNAGTRVLPHIFNAVILTTI 368
           I++ ++GS+  +G  VP+N  +L  +DS    +SP++I I + G RV+PH  NAVIL ++
Sbjct: 366 IIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSV 425

Query: 369 ISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGA 428
           +S GNS  Y  SRIL S+++ G APKF      +G P  +++  + F  +++   S+   
Sbjct: 426 LSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEE 485

Query: 429 KAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFM 488
             F WLL I+G++  F W  I  SH+RF +A+  +G S  ++ +K+    W +YYA   M
Sbjct: 486 DVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMM 545

Query: 489 VVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW-KLEDVDI 543
            ++++ Q +   AP        + F  +Y+++ + + F+  +  + +   ++ + +D+D+
Sbjct: 546 FLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDL 605

Query: 544 DTDRREIESVV--WEDDAPKT------LWDKFWDF 570
           D  R+  +  V   ED+  K       LW +  +F
Sbjct: 606 DHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILNF 640

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  274 bits (700), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 173/507 (34%), Positives = 271/507 (53%), Gaps = 29/507 (5%)

Query: 61  LEHHD-----VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
           LE HD     + RSL  RH                     L   GP    + Y  MG VV
Sbjct: 47  LEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVV 106

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
           +     LGEM+TF+P++ SF  +A++F   +   A    Y+ +   + A +L+ +  ++ 
Sbjct: 107 YLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLD 166

Query: 176 FW---TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           +W       P  A   +FWV L   N+  V+ YGE E+W+A +KV+A++ F I ++ +  
Sbjct: 167 YWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNV 226

Query: 233 GAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGE 291
           G       IGF+YW    A  P +         F G+V+  +++AF+Y GTE + +TAGE
Sbjct: 227 GHNPDHEYIGFKYWSYKEA--PFV-------NGFKGFVTIFVSSAFSYGGTESITLTAGE 277

Query: 292 AANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNA 351
           A NP +  PR ++ V  RIL+FY+ ++FFI + +PY+ P L++    V +SPF I  Q A
Sbjct: 278 ARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTIIFQMA 335

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLA-PKFLAKTTLQGVPYLSVL 410
           GT+      NAVILT+I+SAGN  ++ GSR+L++M   G   PK + KT     PY++V+
Sbjct: 336 GTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVI 395

Query: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470
              A G L +     G    + WL NI GV+   AWL I+ + +RF + L  +G ++ +L
Sbjct: 396 LTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-EL 454

Query: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYF 530
            +K    P+  Y+ + F+ +IIL+QG+++F P +S  DF + Y+ + +F   W  + I+ 
Sbjct: 455 QFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFK 513

Query: 531 RCRIIWKLEDVDIDTDR-----REIES 552
           R R + K ED+D  TDR     +EIE 
Sbjct: 514 RDRFV-KPEDMDFITDRYIQSPQEIEE 539

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  273 bits (699), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 179/548 (32%), Positives = 281/548 (51%), Gaps = 21/548 (3%)

Query: 38  RRKRKTSVSSTQYEDLATEKDEL---LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXX 94
           R K KT  S     D  ++   L    +   + R LK RH                    
Sbjct: 20  RMKEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGG 79

Query: 95  PLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA--QRFLSPALGAANG 152
            L+  GP   L+AY  M   V+SV   + EM T IP+    ++++  + +++  L    G
Sbjct: 80  ALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCG 139

Query: 153 YMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWI 212
           +  F +       E++    ++Q+WT   P A +ISIF VL  A  M PVK +GE EFW+
Sbjct: 140 WNLFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWV 198

Query: 213 ASIKVLALMGFLIYSLCIVCGAG--KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVS 270
           +SIK+L ++G +I  + I  G G  +   +GF YW+ PGA  P ++   TG  +FL + +
Sbjct: 199 SSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLVEGGTG--KFLAFWT 256

Query: 271 SLINAAFTYQGT-ELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYND 329
           ++I + F++    E+V   A EA  PR+ +PRA ++ + R+ LFY+  +  +G+ V Y++
Sbjct: 257 AIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDN 316

Query: 330 PKLTSTDSYVSSS----PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFS 385
            +L +  +   SS    PF+I I+ AG RVLPHI NA ILT+  S G   +Y  SR L S
Sbjct: 317 DRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHS 376

Query: 386 MAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFA 445
           MA  G AP+ L      GVPY      S F  L+Y+  S   +  FNWL NI  ++GF +
Sbjct: 377 MACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVS 436

Query: 446 WLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HF 504
           W+L+S +++RF   +    ++ D +P++  +   LAY A+ F  ++ L  GF  F   ++
Sbjct: 437 WVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNW 495

Query: 505 SGRDFVAAYISVGLFLVFWGFFQIYF---RCRIIWKLE-DVDIDTDRREIESVVWEDDAP 560
              +F AAYI++G  LV +    IY+   RCR I ++E D+       E E   ++   P
Sbjct: 496 DTSNFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYEYDIPVP 555

Query: 561 KTLWDKFW 568
           +   +K W
Sbjct: 556 RNWLEKIW 563

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  275 bits (703), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 164/568 (28%), Positives = 291/568 (51%), Gaps = 36/568 (6%)

Query: 4   GPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH 63
           GP D  E + + D+ + I  +   +      EL + +   ++ +    +   + D L   
Sbjct: 69  GPQDEVEATQMNDLTSAISPSSRQAQ-----ELEKNESSDNIGA----NTGHKSDSL--- 116

Query: 64  HDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLG 123
              K++++ RH                     L +AGP G L+ Y  MG++++ + Q+ G
Sbjct: 117 ---KKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACG 173

Query: 124 EMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           EMA  +  +T  ++ +    +    G A  ++Y L W     LEL      I++WT  V 
Sbjct: 174 EMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVN 233

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIG 241
              ++ IF+VL+   N+F  + Y E EF+    K+L + GF I  + I V GAG  G IG
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIG 293

Query: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301
            +YW +PGA      +      RF G  ++L+ AAF + G+E + IT  E +NPRKA+P 
Sbjct: 294 GKYWHDPGAF-----NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 302 AIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360
           A ++++ RIL  ++ ++  +G  VPYN D  L ST     +SP++I + + G RV+PH  
Sbjct: 349 AAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFI 408

Query: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420
           NAVIL +++S  NS+ Y  +R+  ++++ G APK  +     G P +++   + F  +++
Sbjct: 409 NAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAF 468

Query: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480
              S    + F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +K+    W 
Sbjct: 469 CAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWG 528

Query: 481 AYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIW 536
           + YA   M++I++ Q + + AP   G+     F   Y+++ + +  +  ++++ +    W
Sbjct: 529 SAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHK---DW 585

Query: 537 KL----EDVDIDTDRR--EIESVVWEDD 558
           KL    + +D+D+ R+  + E +  ED+
Sbjct: 586 KLFIRADKIDLDSHRQIFDEELIKQEDE 613

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  274 bits (701), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/533 (31%), Positives = 275/533 (51%), Gaps = 16/533 (3%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           +R  S       DL      +  ++ +K+S+K RH                     L  A
Sbjct: 60  RRAESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP   ++ Y+ +  V + + Q+ GEM    P +  +F+ +   F+S + G A  +++ + 
Sbjct: 120 GPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQ 179

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      I++W   +    +I+IF+V L   + F VK YGE EF   S K+L
Sbjct: 180 WLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 219 ALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            + GF+I S+ I CG AG  G IG  YWRNPG+   G     +   RF G    L+ A F
Sbjct: 240 MIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFILVTAYF 294

Query: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPY-NDPKLTSTD 336
           ++ G EL  ++  E ANPRK+ P A ++ + RIL+ Y+ ++  IG  VP+ ND  + S  
Sbjct: 295 SFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGS 354

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
           S   +SP+++     G +V+PHI NAVIL ++IS  NS +Y   R++ S+A+ G APKFL
Sbjct: 355 SATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                +G P  +++  S  G + ++  S+   +AF WL  I G++  F W  I  SH+RF
Sbjct: 415 NYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRF 474

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVA 511
            +A+K +G S D++ YK+    W +YY + F +++ + Q + + +P  S        F  
Sbjct: 475 RKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQ 534

Query: 512 AYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
           +Y++  L++  +  + IY +   ++  L+ +D+D  RR  + E +  ED+  K
Sbjct: 535 SYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/563 (29%), Positives = 290/563 (51%), Gaps = 32/563 (5%)

Query: 18  DTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH---------HDVKR 68
           D+    + S      T ++       S SS Q ++L  EK+E  ++           +K+
Sbjct: 61  DSFKKADQSAEERVETAQMNDLASAISPSSRQRQEL--EKNESSDNIGARTGNKSDSLKK 118

Query: 69  SLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-T 127
           +++ RH                     L +AGP G L+ Y  MG++++ + Q+ GEMA  
Sbjct: 119 TIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALV 178

Query: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187
           +  +T  ++ +    +    G A  ++Y L W     LEL      I++WT  V    ++
Sbjct: 179 YSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFV 238

Query: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIGFRYWR 246
            IF+VL+   N+F  + Y E EF+    K+L + GF I  + I V GAG  G IG +YW 
Sbjct: 239 IIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWH 298

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           +PGA      +      RF G V++L+ AAF + G+E + IT  E ANPRKAVP A +++
Sbjct: 299 DPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQM 353

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAGTRVLPHIFNAVIL 365
           + RIL  ++ ++  +G  VPYN  +L  S+     +SP++I + + G RV+PH  NAVIL
Sbjct: 354 IYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVIL 413

Query: 366 TTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELST 425
            +++S  NS+ Y  +RIL ++++ G AP+        G P +++   + FG +++   S 
Sbjct: 414 LSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASP 473

Query: 426 GGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAI 485
              + F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +++    W + YA 
Sbjct: 474 KEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYAC 533

Query: 486 FFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIWKL--- 538
             M++I++ Q + + AP   G+     F   Y+++ + +  +  ++I+   +  WKL   
Sbjct: 534 IMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIW---KKDWKLFIR 590

Query: 539 -EDVDIDTDRR--EIESVVWEDD 558
            + +D+ + R+  + E +  ED+
Sbjct: 591 ADKIDLISHRQIFDEELIKQEDE 613

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 162/537 (30%), Positives = 279/537 (51%), Gaps = 27/537 (5%)

Query: 42  KTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGP 101
           K ++     +   +  D   +  ++KR+LK RH                     +A  GP
Sbjct: 54  KRNIFQRCVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGP 113

Query: 102 VGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCF 161
           +G ++ +   G+ +      LGE+    PV  +F+ +  RFL P++      +Y L W F
Sbjct: 114 LGVVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFF 173

Query: 162 TFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALM 221
              LE+      +Q+W   +    W++IF+ ++ + N+F V+ +GE EF  ++IK + + 
Sbjct: 174 VLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVC 233

Query: 222 GFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQ 280
           GF+I  + ++CG G     IG +YW +PG +  G          F G +S L+ A+++  
Sbjct: 234 GFIILCVVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLG 283

Query: 281 GTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS 340
           G E+  + +GE  +P K +P AI++V  RIL F++ SL  +G  VPY +  L    S V 
Sbjct: 284 GIEMTCLASGET-DP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VD 340

Query: 341 SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTT 400
           +SPF+I I+    + LP I NAVIL +++S GNS ++  SR L SMA  GL P +     
Sbjct: 341 NSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYID 400

Query: 401 LQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQAL 460
             G P + ++A S FG L+++  S   ++ FNWL+ I G+A    WL I+ SH+RF  A+
Sbjct: 401 RAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAM 460

Query: 461 KHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRD----FVAAY 513
           K +G S D+L + +    W + Y+     +I++ Q + S  P     SG++    F   Y
Sbjct: 461 KAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNY 520

Query: 514 ISVGLFLVFWGFFQIYFRCRI-----IWKLEDVDIDTDRREIE-SVVWEDDAPKTLW 564
           +   + L  +   +IY++C+      +  L+D+D++TDR++I+  +V ++ A K ++
Sbjct: 521 LCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMY 577

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  273 bits (697), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 271/518 (52%), Gaps = 27/518 (5%)

Query: 58  DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           D   +  ++KR+LK RH                     +A  GP+G ++ +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
               LGE+    PV  +F+ +  RFL P++      +Y L W F   LE+      +Q+W
Sbjct: 130 TVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
              +    W++IF+ ++ + N+F  + +GE EF  +++K + + GF+I  + ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPD 249

Query: 238 GP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
              IG +YW +PG +  G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVL 356
           K +P AI++V  RI+ F++ SL  +G  VPY +  L    S V +SPF+I I+    +VL
Sbjct: 298 KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P I NAVIL +++S GNS ++  SR L SMA  GL P +       G P + ++A S FG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++  S   ++ FNWL+ I G+A    WL I+ SHVRF  A+K +G S D+L + +  
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAV 476

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIY 529
             W + Y+     +I++ Q + S  P           + F   Y+   + +  +   +IY
Sbjct: 477 GIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIY 536

Query: 530 FRCRI-----IWKLEDVDIDTDRREIE-SVVWEDDAPK 561
           +RC++     + +L+D+D++TDR++I+  +V ++ A K
Sbjct: 537 YRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEK 574

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  272 bits (696), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/541 (29%), Positives = 273/541 (50%), Gaps = 36/541 (6%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           +D D  +SN     R            +      D   +  ++KR+LK RH         
Sbjct: 47  DDDDGEHSNRNIFQR----------CVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGS 96

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                       +A  GP+G ++ +   G+ +      LGE+    PV  +F+ +  RFL
Sbjct: 97  IGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFL 156

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVK 203
            P++      +Y L W F   LE+      +Q+W   +    W++IF+ ++   N+F  +
Sbjct: 157 DPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGAR 216

Query: 204 FYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGE 262
            +GE EF  +++K + + GF+I S+ ++CG G     IG +YW +PG +  G        
Sbjct: 217 GFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLANG-------- 268

Query: 263 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIG 322
             F G ++ L+ A+++  G E+  + +GE  +P K +P AI++V  RIL F++ SL  +G
Sbjct: 269 --FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLPGAIKQVFWRILFFFLASLTLVG 324

Query: 323 LTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRI 382
             VPY +  L    S V +SPF+I ++    +VLP I NAVIL +++S GNS ++  SR 
Sbjct: 325 FLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRT 383

Query: 383 LFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAG 442
           L SMA  GL P +       G P + ++A S FG L+++  S   A  FNWL+ I G+A 
Sbjct: 384 LCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLAT 443

Query: 443 FFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP 502
              WL I+ SH+RF  A+K +G S D+L + +    W + Y+     +I++ Q + S  P
Sbjct: 444 CIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWP 503

Query: 503 ---HFSGRD----FVAAYISVGLFLVFWGFFQIYFRCRI-----IWKLEDVDIDTDRREI 550
                SG++    F   Y+   + L  +   +IY++C+      +  L+D+D++TDR++I
Sbjct: 504 IGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDI 563

Query: 551 E 551
           +
Sbjct: 564 D 564

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  273 bits (697), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 185/593 (31%), Positives = 296/593 (49%), Gaps = 46/593 (7%)

Query: 10  EKSVIQDIDTIIDGNDS-----DSHNSNTGELGRR------KRKTS-----VSSTQYEDL 53
           E+S I  +  I D +DS      S  S +G +G+       + + +      S  + E  
Sbjct: 2   ERSEIHSMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEKH 61

Query: 54  ATEKDELLEH---HDV------KRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 104
           +T  +  LEH   H V      KRS+K RH                     L   GP G 
Sbjct: 62  STPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGL 121

Query: 105 LVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTF 163
           ++ Y  +  V + + Q+ GEMA   P +  +F+ ++ + +S   G A  ++Y + W    
Sbjct: 122 IIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVL 181

Query: 164 ALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGF 223
            LEL      I++W   +    +I+IF+V +   + F  + YGE EF     KVL ++GF
Sbjct: 182 PLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGF 241

Query: 224 LIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGT 282
           +I S+ I CG AG    IG +YW +PGA   G     +G  +F G    L+   F+Y GT
Sbjct: 242 VILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGT 296

Query: 283 ELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL--TSTDSYVS 340
           EL  +T  E +NPR+A+    ++ + RILL Y+ ++  IG  VP+   +L  +S  S   
Sbjct: 297 ELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATH 356

Query: 341 SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTT 400
           +SP+++ +   G +++PHI NAVIL  +IS GNS +Y G RIL ++A+ G AP+FLA   
Sbjct: 357 ASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVD 416

Query: 401 LQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQAL 460
             G P ++++A S FG L+++  S      F WL  I G++  F W  I  SHVRF QA+
Sbjct: 417 RAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAM 476

Query: 461 KHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRD-------FVAAY 513
           ++      +L YKA      +   + F +++ + Q + S AP   G+D       F  +Y
Sbjct: 477 RYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPF--GKDGKLDVLSFFQSY 534

Query: 514 ISVGLFLV-FWGFFQIYFRCRIIWKLEDVDIDTDRR--EIESVVWEDDAPKTL 563
           ++  L++V F+G+  ++    II  L+D+D+D  R   + + +  ED   K L
Sbjct: 535 LAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKIL 587

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  272 bits (695), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 166/570 (29%), Positives = 281/570 (49%), Gaps = 32/570 (5%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGND------SDSHNSNTGELGRRKRKTSVSSTQYEDLAT 55
           E+ PS   +K +   ++T + G +      S+  ++ +  +  R  K ++     +    
Sbjct: 3   EVPPSRFHDKDIESYVETCVTGQEIKIGDGSEKTSTPSTVVNHRGTKRNIIQRMVDSFKP 62

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
             D      ++K+SLK RH                     LA  GP+  ++ +   GT +
Sbjct: 63  PLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQM 122

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
                 LGE+    PV  +F+ +  RFL P++      +Y L WCF   LE+      ++
Sbjct: 123 VGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVE 182

Query: 176 FWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG 235
           +W   VP  AW++IF+  +   N+  V+ +GE EF  + IKVL ++GF+I  + ++CG G
Sbjct: 183 YWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGG 242

Query: 236 -KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
            K   +G +YW +PG +  G          F G  +  + A+++  GTE+  + +GE  +
Sbjct: 243 PKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGET-D 291

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           P K +P AI++V  RI+ F++ SL  +G  VPY +  L    S V +SPF+I I+  G +
Sbjct: 292 P-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIK 349

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
            LP + NAVIL +++S GNS ++  SR L SMA  GL P+        G P + +L   A
Sbjct: 350 ALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLA 409

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
           FG L+++  S+     F WL+ I G+A    WL I+ SH+RF  A+K +G+S D+L + +
Sbjct: 410 FGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVS 469

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSF-------APHFSGRDFVAAYISVGLFLVFWGFFQ 527
               + + Y+    V+I++ Q + S        +P     +F   Y+   + L+ +   +
Sbjct: 470 AVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFAGHK 529

Query: 528 IYFRCRI-----IWKLEDVDIDTDRREIES 552
           IY+R           L D+D+ TD R  ++
Sbjct: 530 IYYRISTGKWWGFKALRDIDLLTDMRVTDT 559

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  272 bits (696), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 162/528 (30%), Positives = 276/528 (52%), Gaps = 15/528 (2%)

Query: 32  NTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXX 91
            T   G  K     S+    ++ +++D  ++  ++ + L  RH                 
Sbjct: 57  QTTSSGATKNINGTSNPNDSNMLSKED--IDGSNLNKDLNIRHLLTLAVGGAIGTGLFVN 114

Query: 92  XXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAAN 151
               L   GP   ++ ++ + T +F+V  SLGE+A   PV   FSV+  RF+ P++  + 
Sbjct: 115 SGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSI 174

Query: 152 GYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFW 211
              Y + W     LEL      I++W  K+   AW+SIF+ ++   NM  VK +GE EF 
Sbjct: 175 NLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFV 234

Query: 212 IASIKVLALMGFLIYSLCIVC-GAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVS 270
           ++ IK+LA++GF I  + + C G    G IG +YW +PGA        +T  ++F G  S
Sbjct: 235 LSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCS 289

Query: 271 SLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDP 330
             + AAF+Y G E++ ++A E+ +PRK +P A ++    I   Y+  L  IG  VPY+DP
Sbjct: 290 VFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDP 349

Query: 331 KLTSTDSY--VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAK 388
           +L +  S   V+SSP +I I+N G + LP + NA+IL  ++S  NS VY  SR + SMA 
Sbjct: 350 RLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAI 409

Query: 389 NGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLL 448
            G  PK L +   +G P  + L    FG +S++  S   A+ F WL  ++G++  F W+ 
Sbjct: 410 IGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMG 469

Query: 449 ISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR- 507
           I+ SH+RF +A+  +G S +++PY +    + ++Y    + ++++   +TS  P  S + 
Sbjct: 470 INISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQA 529

Query: 508 ---DFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
               F   Y+S+ + L  +   + YF+  R+     ++D+D+ +R+I+
Sbjct: 530 NATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDID 577

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  271 bits (693), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 172/558 (30%), Positives = 279/558 (50%), Gaps = 25/558 (4%)

Query: 3   IGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLE 62
           +G   L EK+V+ DI      +D    + ++G            S    ++A E  E   
Sbjct: 21  VGYDGLVEKAVV-DIPDPGSSHDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGE--- 76

Query: 63  HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
             ++ + L  RH                     L   GP   ++ ++ + + +F+V  +L
Sbjct: 77  --NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINAL 134

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           GE+A   P+   F+V+  RF+ P+   A    Y + W  +  LEL      I++W  ++ 
Sbjct: 135 GELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREIN 194

Query: 183 LAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIG 241
             AW++IF+V +   NM  VKF+ E EF ++ IK+LA++GF I  + + V G    G IG
Sbjct: 195 SDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIG 254

Query: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301
            +YW +PGA        ++  +RF G  S  + AAF+Y G E+  ++A E+ NPRK +P+
Sbjct: 255 GKYWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPK 309

Query: 302 AIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHI 359
           A ++    I   YI  L  IG+ VPYND +L S  S V  S+SP +I I+NAG + LP +
Sbjct: 310 ATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSL 369

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            NA+IL  ++S  NS VYV SR++ SMA     PK  +K   +G P  S+ A    G LS
Sbjct: 370 MNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLS 429

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S    + F WL  I G++  F W+ I+ +H+RF  ALK +  S D+L Y +    W
Sbjct: 430 FIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIW 489

Query: 480 LAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRII 535
            ++Y +  +V++++   + S  P          F   Y+S  + +  +   ++Y +    
Sbjct: 490 GSWYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKN--- 546

Query: 536 WK----LEDVDIDTDRRE 549
           WK    LE++DID  ++ 
Sbjct: 547 WKWVIPLEEIDIDLGKKN 564

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  270 bits (691), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 164/541 (30%), Positives = 280/541 (51%), Gaps = 21/541 (3%)

Query: 42  KTSVSSTQYEDLATEKDELLE----------HHD---VKRSLKQRHXXXXXXXXXXXXXX 88
           +  V    YE+   E+ +++           H+D   +K+ LK+RH              
Sbjct: 12  QEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGL 71

Query: 89  XXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALG 148
                  L   GPVG L+AYLF+G VV     ++ E+A+F+P T +    A++F+  ++G
Sbjct: 72  FLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG 131

Query: 149 AANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEF 208
              G++   ++      ELS    I+++WT   P A +I++F +L    N++ ++FYGE 
Sbjct: 132 FTFGWIS--TYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGEL 188

Query: 209 EFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLG 267
           E+    +K++ +   +I  L I  G  K    +GF YWR PG     ++  + G  +F+G
Sbjct: 189 EYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYLVGGHIG--KFVG 246

Query: 268 WVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPY 327
           + +++ +  ++Y G + + I AGE  N R A+    + V +RI++ Y+ ++F + L VPY
Sbjct: 247 FWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPY 306

Query: 328 NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMA 387
           ND  + +      SSPF+I +  AG +VLPHI NA+ILT+  SAGN  +  GSR LF +A
Sbjct: 307 NDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLA 366

Query: 388 KNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWL 447
               APK   +T+ +G+PY+ V+ IS+F  L+YM  S   A  F W   +        W+
Sbjct: 367 TKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWI 426

Query: 448 LISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSG 506
           LIS +H+   +ALK +G SR DLPY     P+ A+++     + +L  GF +F   HF  
Sbjct: 427 LISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDI 486

Query: 507 RDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDK 566
             F   Y  + L +  + F++++ + + + +  +VD+++   +I+         K  W +
Sbjct: 487 ESFFTRYFIIPLAIGLFTFWKLFKKTKYL-RPHEVDLESIFDDIKENPEHIVKTKNAWAR 545

Query: 567 F 567
           F
Sbjct: 546 F 546

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 160/490 (32%), Positives = 260/490 (53%), Gaps = 12/490 (2%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K+++K RH                     L   GP   ++ Y  +  V + + Q+ GEM
Sbjct: 91  LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEM 150

Query: 126 ATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA 184
           A   P +  +F+ +A  F+S   G A  +++ + W     LEL     II++WT KV   
Sbjct: 151 AVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKVNAD 210

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFR 243
            ++ IF+V L   +   VK YGE EF     K+L + GF+I+S+ + CG AG  G IG +
Sbjct: 211 VFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGK 270

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
           YW +PGA       +N  E RF G    L++  F+Y GTEL  ++  E  NPRK+ P A 
Sbjct: 271 YWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAA 325

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHIFNA 362
           ++ + RIL+ Y+ ++  IG TVP+ND +L     S   +SP+++     G RV+PHI NA
Sbjct: 326 KQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHIINA 385

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL  +IS  NS++Y   R+L S+A+ G APKF+     +G P  ++LA + FG +++  
Sbjct: 386 VILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSA 445

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S    + F WL  I G++  F W  I  SHVRF QA+K +G   +++ Y A    W + 
Sbjct: 446 CSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSV 505

Query: 483 YAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFR-CRIIWKL 538
           Y + F +++ + Q + + AP     + + F  +Y++  +++ F+  + I+ +    +  L
Sbjct: 506 YGVVFNILVFIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPL 565

Query: 539 EDVDIDTDRR 548
           + +D+D  RR
Sbjct: 566 DKIDLDHHRR 575

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 176/567 (31%), Positives = 288/567 (50%), Gaps = 29/567 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGR-----RKRKTSVSSTQYEDLATEKDEL 60
           +   EK+V+Q   +      S +   +TG   R     R+  TS S     DL   +   
Sbjct: 7   NKFNEKTVVQTAYS-----PSYASPESTGPFRRFVDSFRREDTSRSG----DLEDGEINS 57

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
            +   +++ ++ RH                     L   GP G L+ YL +  V + +  
Sbjct: 58  TDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMH 117

Query: 121 SLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179
           + GEMA   P +  +F+ ++  F+S   G A  +++ L W   F LEL     +I++W  
Sbjct: 118 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKV 177

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKTG 238
            V    ++ IF++ +   + F  + YGE EF     KVL ++GF+I  + I  GA G TG
Sbjct: 178 SVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTG 237

Query: 239 PIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298
            IG RYWRNPG+       S T   +  G    L+ A F++ G EL  ++  E  NP+ A
Sbjct: 238 YIGDRYWRNPGSF-----VSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTA 292

Query: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLP 357
           +P A +K + RILL Y+ ++  IG  VP++  +L  + S  V  SP+++ I+  G +VLP
Sbjct: 293 IPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLP 352

Query: 358 HIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGS 417
           HI NAVIL ++IS GNS +Y   R+L ++A+ G APK L     +G P +S++  + FG 
Sbjct: 353 HIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGL 412

Query: 418 LSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWM 477
           +++   S    K F WL  I G++  F W  I  SH RF QA+K +G S + L Y+A+  
Sbjct: 413 IAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITG 472

Query: 478 PWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRC- 532
            W + YA+FF +++ + Q + +  P    +     F   Y++  L+L+ +  + +Y R  
Sbjct: 473 QWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSRNW 532

Query: 533 RIIWKLEDVDIDTDRR--EIESVVWED 557
            ++  L+ +D+DT RR  ++E +  E+
Sbjct: 533 TLLNPLDKMDLDTHRRVYDVEVLKQEE 559

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/517 (31%), Positives = 267/517 (51%), Gaps = 22/517 (4%)

Query: 43  TSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPV 102
           TS SS   ED+         +  + + L  RH                     LA+ GP 
Sbjct: 64  TSQSSVTKEDI---------NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPA 114

Query: 103 GALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFT 162
             ++ ++ + T +F+V  SLGE+A   PV   F+V+  RF+ P+   A    Y   W   
Sbjct: 115 SLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVL 174

Query: 163 FALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMG 222
             LEL      I++W   +   AW++IF+ ++T  NM  VK +GE EF ++ +K+LA++G
Sbjct: 175 LPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIG 234

Query: 223 FLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQG 281
           F I  + + CG G  G     +YW NPGA        +T   +F G  S  + AAF+Y G
Sbjct: 235 FTILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSG 289

Query: 282 TELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV-- 339
            E+  ++A E+ +PRK +P+A ++    I   Y+  L  +G  VPY+DP+L S  S V  
Sbjct: 290 IEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDA 349

Query: 340 SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT 399
           ++SP +I I+N G + L  + NA+IL +IIS  NS VY  SR + SMA  G  PK L K 
Sbjct: 350 AASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKV 409

Query: 400 TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQA 459
             +G P  + L    FG LS++  S    + F WL  ++G++  F W+ I+ SH+RF QA
Sbjct: 410 DKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQA 469

Query: 460 LKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYIS 515
           +  +  S D++PY +    W + Y +  + ++++   +TS  P        + F   Y+S
Sbjct: 470 MIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLS 529

Query: 516 VGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           + + +V +   ++YF+    +  LE++D+DT R+ ++
Sbjct: 530 LPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  269 bits (688), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 173/542 (31%), Positives = 283/542 (52%), Gaps = 20/542 (3%)

Query: 40  KRKTSVSSTQYE------DLATEKDELLE---HHD---VKRSLKQRHXXXXXXXXXXXXX 87
           + K  V +T YE      D+ +  + L +   H+D   +K+ LK+RH             
Sbjct: 6   QDKEKVKATAYEADVEDCDIRSTDETLKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTG 65

Query: 88  XXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPAL 147
                   L   GPVG L+AYLF+G VV     ++ E+A+F+P T +    A++F+  ++
Sbjct: 66  LFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESV 125

Query: 148 GAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGE 207
           G   G++   ++      ELS    I+++WT   P A +I+IF VL    N++ ++FYGE
Sbjct: 126 GFTFGWIS--TYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGE 182

Query: 208 FEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFL 266
            E+    +K++ +   +I  L I  G  K    +GF YWR+PG     I+  + G  +F+
Sbjct: 183 VEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYIVGGSIG--KFV 240

Query: 267 GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVP 326
           G+ S+L +  ++Y G + + I AGE  N R A+    + V +RI++ Y+ ++F + L VP
Sbjct: 241 GFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVP 300

Query: 327 YNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386
           YND  + S      SSPF+I +  AG +VLPHI NA++LT+  SAGN  +  GSR LF +
Sbjct: 301 YNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCL 360

Query: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
           A    APK   KT+ +G+PY+ V+ IS F  L+YM  S   +  F W   +        W
Sbjct: 361 ATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRW 420

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFS 505
           +LIS +H+   +ALK +G SR DLPY     P+ A+++     + +L  GF +F   HF 
Sbjct: 421 ILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFD 480

Query: 506 GRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWD 565
              F   Y  + L +  + F++++ + R + + E+VD+ +   +I       +  K +W 
Sbjct: 481 IESFFTRYFIIPLAIGLFTFWKLFKKTRYL-RPEEVDLASIFDDIRENPEHIEKSKPIWA 539

Query: 566 KF 567
           + 
Sbjct: 540 RL 541

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/515 (32%), Positives = 265/515 (51%), Gaps = 18/515 (3%)

Query: 56  EKDELLEHHD--VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGT 113
           E  E+   H   +K+++K RH                     L   GP G L+ Y F+  
Sbjct: 59  EDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSI 118

Query: 114 VVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           + + + Q+ GEMA   P +  +F+ ++  F+S   G A  +++ + W     LEL     
Sbjct: 119 ISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSI 178

Query: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           ++++WT K+    ++ IF++ +   +    + YGE EF   S KVL + GF+I  + I C
Sbjct: 179 VVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINC 238

Query: 233 GA-GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGE 291
           GA G  G IG +YW  PGA   G     +G  RF G    L+ A F+Y G EL  ++  E
Sbjct: 239 GAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYALSVNE 293

Query: 292 AANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQN 350
             NPRKA+P A  K + RIL+ Y+ ++  IG  VP++  KL  S  S V  SP+++ +  
Sbjct: 294 LPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSL 353

Query: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410
            G +++PHI NAVIL ++IS GNS +Y G R+L S+A+ G APK L     QG P ++++
Sbjct: 354 HGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALI 413

Query: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470
             S FG ++++  S      F WL  I+G++  F W  I  SH RF +A+K +G S + L
Sbjct: 414 ICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETL 473

Query: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDF-VAAYISVGLFLVFW-----G 524
            Y++    W + YA+ F V +++ Q + +  P  +G  F V +     L L  W     G
Sbjct: 474 GYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVG 533

Query: 525 FFQIYFRCRIIWKLEDVDIDTDRR--EIESVVWED 557
           +  +     I+  L  + +D+ RR  ++E +  ED
Sbjct: 534 YMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQED 568

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  270 bits (690), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/564 (29%), Positives = 280/564 (49%), Gaps = 30/564 (5%)

Query: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           +E   S+L   S +Q +   +    S    S   E  R  ++  V     +      D  
Sbjct: 7   VEKAASELSNTSAVQRV---LKKRSSVLEESRLLEESRTNKRGLVRRC-IDSFKPPVDGS 62

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
            +  ++KR+LK RH                     LA  GP+  L+ +   GT +     
Sbjct: 63  FDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIH 122

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            LGE+    PV  +F+ ++ RFL P++      +Y L W F   LE+      ++FWT  
Sbjct: 123 GLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTS 182

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP- 239
           V    W+++F+ L+ + N+F V+++G+ +F  + IK++ + GF+I  L ++ G G T   
Sbjct: 183 VDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEF 242

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IG RYW +PGA+  G          F G  + ++ A+++  G+E+  + +GE  +P K +
Sbjct: 243 IGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEI 290

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           P AI+++  RI+ F++ SL  +G  VPY + +L    S V++SPF+I I+    RVLPHI
Sbjct: 291 PHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLPHI 349

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            N VIL +I+S GNS ++  SR L SMA  GL P+        G P   +L  S FG L+
Sbjct: 350 INGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLA 409

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S+     F WL+ + G+A    WL I+ SH+RF  A+K +G S D+L + +    W
Sbjct: 410 FLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMW 469

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRD-------FVAAYISVGLFLVFWGFFQIYFRC 532
            + Y+    VV+++ Q + S  P    +D       F   Y+   + L  +   +IY+R 
Sbjct: 470 GSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRS 529

Query: 533 RI-----IWKLEDVDIDTDRREIE 551
                  I  L ++D+++ R+ I+
Sbjct: 530 TTGQWWKILPLAEIDLESGRKNID 553

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/563 (29%), Positives = 281/563 (49%), Gaps = 30/563 (5%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL 61
           E  P D+K+ S +         +  D +  N    G  +   ++     +      D   
Sbjct: 25  EKKPVDIKKTSSV----VATTKHAHDEYEDNFPGNGFYQPPRNIFQRCIDSFKPPLDGSF 80

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           + +++KRSLK RH                     +A  GP+  ++ +   G+ +      
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181
           LGE+    PV  +F+ ++ RFL P+L      +Y + W F   LE+      +Q+W   +
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-I 240
               W++IF+  + + N+F  + +GE EF  +S+KVL + GF+I  + ++CG G     +
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           G +YW +PG +  G          F G +S L+ A+++  GTE+V + +GE  +P K +P
Sbjct: 261 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP-KELP 308

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360
            AI++   RIL F++ SL  IG  VPY +  L    S V++SPF+I I+    +VLP I 
Sbjct: 309 SAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLPSIV 367

Query: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420
           NAVIL +I+S GNS ++  SR L SMA  GL P+F       G P   ++  S FG L++
Sbjct: 368 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAF 427

Query: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480
           +  S+  ++ F+WL+ I G+A    WL I+ SH+RF  A+K +G S D+L + +    W 
Sbjct: 428 LVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWG 487

Query: 481 AYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533
           + Y+     +I++ Q + +  P           + F  +Y+   + +V +   +I++R +
Sbjct: 488 SAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYK 547

Query: 534 I-----IWKLEDVDIDTDRREIE 551
                 +  L  +D++TDR+ I+
Sbjct: 548 TGKWWSMLPLNKIDLETDRKNID 570

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  270 bits (690), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/534 (31%), Positives = 275/534 (51%), Gaps = 18/534 (3%)

Query: 39  RKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLAN 98
           R+ +   + +  ED +       +H  +K+++K RH                     LA 
Sbjct: 53  RRAEDKHADSDLEDGSKSITSDDDH--MKKAMKSRHVIMMTLGTGIGTGLLVANGKGLAL 110

Query: 99  AGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFL 157
           AGP   ++ Y  +  V + + Q+ GEMA   P + +SF+ +A  F+S   G A  +++ +
Sbjct: 111 AGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCI 170

Query: 158 SWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
            W     LEL      I++W   +    +I IF+V L   + F VK YGE EF   S K+
Sbjct: 171 QWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKI 230

Query: 218 LALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
           L + GF+I S+ I CG AG+ G IG +YW NPGA      +S +  ARF G    L+   
Sbjct: 231 LMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGY 285

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
           F+Y GTEL  ++  E  NPRK+ P A ++ + RIL+ Y+ ++  IG  VP++  +L    
Sbjct: 286 FSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAG 345

Query: 337 -SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKF 395
            S   +SP+++     G +V+PH  NAVIL +++S  NS +Y   R++ S+A+ G APK+
Sbjct: 346 GSATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKW 405

Query: 396 LAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVR 455
                 +G P  ++     FG + ++  S    +AF WL  I G++  F W  I  SH+R
Sbjct: 406 FNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIR 465

Query: 456 FMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFV 510
           F  A+K +G S ++L Y+A    W + Y++FF +++ + Q + + +P      +    F 
Sbjct: 466 FRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFF 525

Query: 511 AAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            +Y++  L+LVF+  + IY R    +  L+ +D+D  RR  + E +  ED   K
Sbjct: 526 ESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETK 579

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  271 bits (693), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/543 (29%), Positives = 279/543 (51%), Gaps = 21/543 (3%)

Query: 17  IDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXX 76
           +   +D       +  T E    +  +++S ++ + L  +K+   + H +++S++ RH  
Sbjct: 71  VRKFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHGQKNGDDDAH-LQKSIRPRHVL 129

Query: 77  XXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSF 135
                              L+ AGP   ++ Y  MG+ ++ + Q+ GEMA  +  +  +F
Sbjct: 130 MMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNF 189

Query: 136 SVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLT 195
           + +    +   +     ++Y L W     LEL      I +WT KV    ++ IF+VL+T
Sbjct: 190 NAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLIT 249

Query: 196 AFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIGFRYWRNPGAMGPG 254
             N F  K Y E EF+  S KVL + GF I ++ I   GAG  G IG +YW NPGA    
Sbjct: 250 LINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF--- 306

Query: 255 IISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFY 314
               +    RF   +S+   AAF +  +E + I A E +NPR+A+P A + ++ RIL  +
Sbjct: 307 --RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIF 364

Query: 315 IGSLFFIGLTVPYNDPKL--TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAG 372
           + S+  +G  VPY+  +L  +   +   +SP++I + + G RV+PH  NAVIL +++S  
Sbjct: 365 LTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVA 424

Query: 373 NSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFN 432
           NS  Y   RIL+S+A+ G APK+      +G P  ++L  + FG +++   S      F 
Sbjct: 425 NSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFA 484

Query: 433 WLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVII 492
           WLL+I G++  F W  I  SH+RF +A+K +G S D++ +K+    W + YA   M++ +
Sbjct: 485 WLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILAL 544

Query: 493 LIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----EDVDID 544
           + + + S AP    H   ++F   Y+++ + +V +  ++IY   +  WKL    +D+D+ 
Sbjct: 545 IAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIY---KKDWKLFIRAKDIDLI 601

Query: 545 TDR 547
           + R
Sbjct: 602 SHR 604

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/548 (29%), Positives = 281/548 (51%), Gaps = 22/548 (4%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           KR    ++   E    +         +K ++K RH                     L   
Sbjct: 42  KRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFG 101

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP G ++ Y+   T+++ V Q+  E+   +  +  +++ +    +    G A   +Y L 
Sbjct: 102 GPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQ 161

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      +++WT  V    +++IF+V L   + F  + Y E EF   S+KVL
Sbjct: 162 WATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221

Query: 219 ALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFT 278
            + GF+I ++ +  GA + G IG +YW +PGA G      +    RF G  S  + AAF 
Sbjct: 222 LMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFA 276

Query: 279 YQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-- 336
           Y G+E + +TA E ANPR++VP+A ++ L R+++ ++  +  IG  VP+N  +L S +  
Sbjct: 277 YGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGG 336

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
           S   +SPF+I     G RV+PHI N +ILT++IS GNS +Y   RIL S+A++G+ PK  
Sbjct: 337 SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                QG P ++++ +S FG ++++  S      F WL  I G++  F W  I+ SHVRF
Sbjct: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVA 511
            +A++ +G S  +L Y+A      +YYAIFF V++++ Q + + AP           F  
Sbjct: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516

Query: 512 AYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRREI-ESVVWEDDAPK-------T 562
            Y++  + +VF+  ++++ R  R++    +VD+ + R+   E V+ +++A +       T
Sbjct: 517 NYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNST 576

Query: 563 LWDKFWDF 570
           L+ +  DF
Sbjct: 577 LFKRLLDF 584

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  270 bits (691), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 277/513 (53%), Gaps = 13/513 (2%)

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           E+ D+K+++K+RH                     L +AGP G ++ Y  MG+ ++ + Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 122 LGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            GE+A  +  + S+F+++    +  A G A  ++Y L W     LEL      I++WT  
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGP 239
           V    ++SIF+VL+   N F  + Y E EF+  S KVL + GF I  + I CG AG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IG +YW +PGA      + N     F G +++   AAF +  +E + +TA E +NPRKA+
Sbjct: 293 IGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS-SSPFIITIQNAGTRVLPH 358
           P+A + ++ RIL  ++ S+  IG  VPYN P L  + S  + +SP+++ + + G RV+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
             NAVIL +++S GNS  Y  SR+L S+A+ G APK       +G P ++++  + F ++
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           ++   S    + F WLL I+G++  F W+ I  SH+RF +ALK +G S  ++ +K+    
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 479 WLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
           + + YA   +++ ++ Q + + AP        R+F   Y+++ + LV +  ++I  R   
Sbjct: 528 YGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKRDWK 587

Query: 535 IW-KLEDVDIDTDRREIESVVWEDDAPKTLWDK 566
            W     +D+ + R+  +  + + +  +   +K
Sbjct: 588 FWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEK 620

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  268 bits (686), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 174/524 (33%), Positives = 278/524 (53%), Gaps = 30/524 (5%)

Query: 36  LGRRKRKTSVSSTQYEDLATEKD---ELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXX 92
           L    +K  V       L TE+D   E     D++R+LK RH                  
Sbjct: 21  LNTPPKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLST 80

Query: 93  XXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANG 152
              L   GP    + Y  MG VV+     LGEM+T++P++ SF  +A++F S +   A  
Sbjct: 81  AKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALM 140

Query: 153 YMYFLSWCFTFALELSVVGQIIQFWTFKV---PLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           + Y+ +   + A +++ +  ++ +W  +    P  A   +FW L+   N+  V+FYGE E
Sbjct: 141 WNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAE 200

Query: 210 FWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFL-- 266
           +W+A +KV+A++ F I S+ +  G       IGF+ W             N GEA F+  
Sbjct: 201 YWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNW-------------NHGEAPFVDG 247

Query: 267 --GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLT 324
             G+ S  ++A+F Y GTE + +T GEAANP +  P+ ++ V  RIL+FY+GS FFI + 
Sbjct: 248 FKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMN 307

Query: 325 VPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
           +PY+ P L +    V +SPF +  Q AGT+      NAVI+T++ISA N  ++ GSR+++
Sbjct: 308 IPYDYPGLDTKS--VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMY 365

Query: 385 SMAKNGLAP-KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGF 443
           +M   G  P K +++T    VPY+SVL  S+ G L +     G    + WL NI GV+  
Sbjct: 366 NMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQ 425

Query: 444 FAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH 503
            AWL I  + +RF + L+ +G +  +L YK    P+  Y+ + F+  IIL+QG+++F P 
Sbjct: 426 IAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP- 483

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
           +   +F + Y+ + +F   +  + +Y R R + KLED+D  TDR
Sbjct: 484 WDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV-KLEDMDFVTDR 526

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  269 bits (687), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 173/554 (31%), Positives = 282/554 (50%), Gaps = 34/554 (6%)

Query: 38  RRKRKTSVSSTQYEDLATEKDELL----EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXX 93
           + K      S Q +DL     ++L      H ++R LK RH                   
Sbjct: 27  KVKENFVTESIQEDDLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFIGTG 86

Query: 94  XPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA--QRFLSPALGAAN 151
             L+  GP   L++Y+ M   V+++   L EM    P+    S++A  + +L+  L    
Sbjct: 87  GALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMC 146

Query: 152 GYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFW 211
           G+  F +       E++    +IQ+WT     A ++SIF V+  A    PVK +GE EFW
Sbjct: 147 GWNLFYAQAMIAPSEITASTLLIQYWT-DANSAIFVSIFIVITIAVTALPVKVFGESEFW 205

Query: 212 IASIKVLALMGFLIYSLCIVCGAG--KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWV 269
           ++ IK++ + G +I  + I  G G  +   +GF YW++PGA  P I + NTG  +FL   
Sbjct: 206 VSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHISTGNTG--KFLAVW 263

Query: 270 SSLINAAFTY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328
           +++I + F +    E +   + EA  PR+ +PRA  + + R++LFYIG    +G+TV Y+
Sbjct: 264 TAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYD 323

Query: 329 DPKLTST----DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
           +  L S      S  ++SPF+I I+  G +VLPHI NA ILT   SAG + +Y  SR+L 
Sbjct: 324 NQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLH 383

Query: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444
           SMA  G APK  A+    GVPY S++  S F  L+Y+  S   ++ F WL NI+ ++GF 
Sbjct: 384 SMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFI 443

Query: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-H 503
           +W+ +S ++VRF + + +  ++ D + ++  +    AY++  F V++ L  G+  F   +
Sbjct: 444 SWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGN 502

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVD---------ID-TDRREIESV 553
           +S  DF A YI++G  +V +     Y++    W+  D++         ID  D  E   +
Sbjct: 503 WSVSDFFANYITIGFVVVLFIMGTAYYKE---WRFRDMEEIRSELIPKIDMADEEESNEI 559

Query: 554 VWEDDAPKTLWDKF 567
           V E   P T + K 
Sbjct: 560 VIE---PTTWYGKL 570

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  270 bits (690), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 156/506 (30%), Positives = 271/506 (53%), Gaps = 21/506 (4%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           +K++++ RH                     L +AGP G L+ Y  MG++++ + Q+ GE+
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEL 175

Query: 126 A-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA 184
           A  +  +T  ++ +    +    G A  ++Y L W     LEL      I++WT  V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPIGFR 243
            ++ IF+VL+   N+F  + Y E EF+    K+L + GF I S+ I V GAG  G IG +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGK 295

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
           YW +PGA      +      RF G V++L+ AAF + G+E + IT  E +NPRKA+P A 
Sbjct: 296 YWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNA 362
           ++++ RIL  ++ ++  +G  VPYN D  L S      +SP++I I + G RV+PH  NA
Sbjct: 351 KQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNA 410

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL +++S  NS+ Y  +R+  ++++ G APKF +     G P +++   + F  +++  
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCA 470

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S    + F WLL I+G++  F W  I  SH+RF +A+K +G S  +L +K+    W + 
Sbjct: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSM 530

Query: 483 YAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGFFQIYFRCRIIWKL 538
           YA   M++I++ Q + + AP   G+     F   Y+++ + +  +  ++I+ +    WKL
Sbjct: 531 YACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTK---DWKL 587

Query: 539 ----EDVDIDTDRR--EIESVVWEDD 558
               + +D+++ R+  + E +  ED+
Sbjct: 588 FIRADKIDLESHRQIFDEELIKQEDE 613

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  270 bits (690), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/514 (32%), Positives = 266/514 (51%), Gaps = 15/514 (2%)

Query: 54  ATEKDE-LLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
           A +KDE  L   D+ + L  RH                     L   GP   ++ ++ + 
Sbjct: 128 ARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVS 187

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           T +F+V  SLGE+A   PV   FSV+  +F+ P+   A    Y L W     LEL     
Sbjct: 188 TALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASI 247

Query: 173 IIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
            I++W   +   AW+SIF+V +   NM  VK +GE EF ++ +K+LA++GF I  + + C
Sbjct: 248 TIRYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDC 307

Query: 233 GAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGE 291
           G G +   IG +YW +PGA         T  ++F G  S  + AAF++ G E+  ++A E
Sbjct: 308 GGGPSHEYIGGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAE 362

Query: 292 AANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQ 349
           + NPR+ +P+A ++    I   Y+  L  +G  VPYNDP+L +  S V  +SSP +I I+
Sbjct: 363 SRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIE 422

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           N     LP + NA+IL  I+S  NS+VY  SR + SM+K    PK  AK   +G P  ++
Sbjct: 423 NGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAI 482

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
             +  FG LS++  S   A+ F WL  ++G++  F W+ I+  H+RF Q +  + IS D+
Sbjct: 483 CFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDE 542

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLVFWGF 525
           LP+ +    W + Y I  + ++++   +TS  P  S +     F   Y+S  + L  +  
Sbjct: 543 LPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIA 602

Query: 526 FQIYFRC-RIIWKLEDVDIDTDRREIE-SVVWED 557
            ++YF+  R       +D+ + R++++  VV E+
Sbjct: 603 HKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREE 636

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/570 (29%), Positives = 284/570 (49%), Gaps = 18/570 (3%)

Query: 3   IGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLE 62
           I  S LK  +V +  +   D   +  H ++        ++  V+     DL    + +  
Sbjct: 16  ITSSTLKTPNVTEKFEPYPD-TTAVKHRTHFNRFVDSFKRAEVNHNGI-DLEDGTNSIQS 73

Query: 63  HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
             ++K+++K RH                     L  AGP   ++ Y  +  + + V Q+ 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 123 GEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181
           GEMA   P +   F+ +A  F+S   G A  +++ + W     LEL      I++W  K+
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPI 240
               ++ I +V L   + F V+ YGE EF   S K+L + GF+I S+ + CG AG  G I
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           G +YWR+PGA      +S+   +RF G    L+ A F+Y G EL  ++  E  NPR++ P
Sbjct: 254 GGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHI 359
            A ++ + RIL+ Y+ ++  IG  VP+N  +L     S   +SP+++ +   G +V+PHI
Sbjct: 309 AAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHI 368

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            NAVIL ++ S  NS +Y   R+L S+A+ G APK+      +G P  +++  S FG ++
Sbjct: 369 INAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIA 428

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           +   S      F WL  I G++  F W  I  SHVRF  A+K +G S ++L Y ++   W
Sbjct: 429 FCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGIW 488

Query: 480 LAYYAIFFMVVIILIQGFTSFAPH-----FSGRDFVAAYISVGLFLVFWGFFQIYFR-CR 533
            + Y  FF V++ + Q + + +P      +S   F  +Y++  ++L F+  + +Y R   
Sbjct: 489 GSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFT 548

Query: 534 IIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            +  L+ +D+D  RR  + E +  ED+  K
Sbjct: 549 FLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/491 (33%), Positives = 260/491 (52%), Gaps = 17/491 (3%)

Query: 48  TQYEDLATEKDEL-LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALV 106
           T+ E +A    +  L+HH     LK RH                     L   GP   L+
Sbjct: 72  TEAEKVAIVTAQTPLKHH-----LKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLI 126

Query: 107 AYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALE 166
            +   GT+++++  +LGE+A   P++  F+ +A RF+  + G AN + Y L W     LE
Sbjct: 127 GWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLE 186

Query: 167 LSVVGQIIQFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLI 225
           +      + FW T       ++++FWV++   NMF VK YGE EF  + IKV+ ++GF+I
Sbjct: 187 IVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFII 246

Query: 226 YSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTEL 284
             + + CG G  G     +YW +PGA      + +T  A+F G  S  + +AF++ G+EL
Sbjct: 247 LGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSEL 301

Query: 285 VGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSP 343
           VG+ A E+  PRK+VP+A ++V  RI LFYI SL  IGL VPYND  L    S   ++SP
Sbjct: 302 VGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASP 361

Query: 344 FIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQG 403
           F+I I+  G + LP + N VIL  ++S GNS +Y  SR + ++A+    P+  A    +G
Sbjct: 362 FVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKG 421

Query: 404 VPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHR 463
            P + +   SAFG ++++  S      FNWLL ++G++  F W  I   H+RF +AL  +
Sbjct: 422 RPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQ 481

Query: 464 GISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFL 520
           G   D+L +K+    W +Y+ +F +V++ + Q + +  P     S   F  AY+S  L +
Sbjct: 482 GRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVM 541

Query: 521 VFWGFFQIYFR 531
             +   +IY R
Sbjct: 542 AMYIGHKIYKR 552

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 172/574 (29%), Positives = 295/574 (51%), Gaps = 25/574 (4%)

Query: 3   IGPSDLKEKSVIQDIDTI-IDGNDSDSHNSNTGELGRRKRKTSVSSTQYE-----DLATE 56
           IG  DLK  +  + I+ + +  +D   H+     L R +R T+      E     D+  E
Sbjct: 11  IGLQDLKSNTGSESIEKVSLPASDYQYHDGQV--LSRFQRLTNSFKRAGEHGRGGDVDAE 68

Query: 57  KDELLEHH-DVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
              +      +K+++  RH                     L N GP G  + Y  MG+ +
Sbjct: 69  GQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCI 128

Query: 116 FSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQII 174
           + + Q+ GEMA ++  ++ +F+ +    + PALG +  ++Y L W     LEL      I
Sbjct: 129 YCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITI 188

Query: 175 QFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG- 233
           ++WT  V    ++ IF+VL    N+F  + Y E EF+  + KVL + GF I  + + CG 
Sbjct: 189 KYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGG 248

Query: 234 AGKTGPIGFRYWRNPGAM-GPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292
           AG  G +G +YW +PGA+ G   I        F G +++++ AAF +  TE + +TA E 
Sbjct: 249 AGNDGYLGGKYWHDPGALYGTKPIH------HFKGIIATMVTAAFAFGATEFIALTAAEQ 302

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNA 351
           ANPR+A+P A +K++ R+LL ++  +  +G  VPYN D  + S  S   +SP++I I + 
Sbjct: 303 ANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASH 362

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLA 411
           G +V+PH  NAVIL +++S GNS  Y  SR+L S+++   AP +L     +G P  ++L 
Sbjct: 363 GVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLV 422

Query: 412 ISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLP 471
              FG ++++  S      F WLL I+G++  F W+ I  SH+RF +AL  +G S  +L 
Sbjct: 423 SCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELG 482

Query: 472 YKALWMPWLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQ 527
           YK+      +YYA   M  ++  Q + + AP         +F   Y+++ + +  +  ++
Sbjct: 483 YKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYR 542

Query: 528 IYFRC-RIIWKLEDVDIDTDRREI-ESVVWEDDA 559
           ++ R  ++   LE +D+ + R+   E ++ ++DA
Sbjct: 543 VWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDA 576

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  270 bits (689), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 172/581 (29%), Positives = 295/581 (50%), Gaps = 47/581 (8%)

Query: 26  SDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD-----------VKRSLKQRH 74
           ++ H +N    G        +   Y +  T K  L  HHD           +K+++K RH
Sbjct: 108 AEQHPTNVNNNGANSESDLENMILYNEDGTPK-PLPHHHDAQINDNSKSDELKKTIKPRH 166

Query: 75  XXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTS 133
                                L  AGP G ++ +  MG+ ++ + Q++GE+A  +  +  
Sbjct: 167 VLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVG 226

Query: 134 SFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVL 193
            F+ +    +  A   A  ++Y + W     LEL      I++WT KV    ++ IF++L
Sbjct: 227 GFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVIIFYIL 286

Query: 194 LTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAM 251
           +   N+      Y E EF   S K++ ++GF I  + ++CG AG  G IG +YW +PGA+
Sbjct: 287 IIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGAL 346

Query: 252 GPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRIL 311
                  +T   RF G +++L+NAAF +  +E +G+TA E +NPRKA+P A +K++ RIL
Sbjct: 347 -----RGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRIL 401

Query: 312 LFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIIS 370
             ++ S+  +G  VPYN D  L ST S V +SP+++ I   G RV+PH  NAVIL +++S
Sbjct: 402 CMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILISVLS 461

Query: 371 AGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKA 430
             NS  Y  SR+L S+A+ G APK  +    +G P + +   + FG +++   S    + 
Sbjct: 462 VANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEV 521

Query: 431 FNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVV 490
           F WLL I+G++  F W+ I  SH+RF +A+  +G S  +L +++    + + YA   M +
Sbjct: 522 FVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFM 581

Query: 491 IILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL----E 539
           I++ Q + +  P           ++F   Y+++ + L F+  ++I+   +  WKL    +
Sbjct: 582 ILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIW---KKDWKLFIRAK 638

Query: 540 DVDIDTDRR--EIESVVWEDD--------APKTLWDKFWDF 570
           ++D+ + R   + E +  E+D         PK  W + +DF
Sbjct: 639 NIDLISHRNIFDEELIKQEEDEYRERLRTGPK--WRRVYDF 677

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  266 bits (680), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/571 (28%), Positives = 286/571 (50%), Gaps = 26/571 (4%)

Query: 1   MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGR--RKRKTSVSSTQYEDLATEKD 58
           M    S  +E+S    I T      S  ++  +G++ R     +    S   ++L  E +
Sbjct: 5   MSTANSKKEEESTYAIIQT--SSPCSKKYSYISGQVNRFINSFRRKGESEDVKELKGENE 62

Query: 59  ELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSV 118
           E      +K+S+K RH                     LA AGP G ++ Y     +++ +
Sbjct: 63  ECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCI 122

Query: 119 TQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
            Q+ GE+   +  +  +++ ++   + PALG +  ++Y + W     L+L      +++W
Sbjct: 123 IQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYW 182

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGK 236
           T   P   ++++F+V++   NMF  K Y E EF     KVL + GF+I  + I CG AG 
Sbjct: 183 TNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGT 241

Query: 237 TGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
           +G IG +YW +PG+   G          F G       AAF+Y G E++ +TA E  NPR
Sbjct: 242 SGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPR 291

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL--TSTDSYVSSSPFIITIQNAGTR 354
           K++P A +KV+ RIL+ Y+ +   +   VPYN  +L  +S +S   +SP +I + + G +
Sbjct: 292 KSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVK 351

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
           ++PHI NAVIL ++IS GNS++Y   R+L S+++ G APKFL     QG P +       
Sbjct: 352 IVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLL 411

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474
              ++++  S      F WLL I+G++  F W  I  SHVRF  A+  +G+S   + YK+
Sbjct: 412 VALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKS 471

Query: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIY 529
               W +++AI   V++++ Q + + AP       +   F   Y++  + L  +  +++Y
Sbjct: 472 QTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVY 531

Query: 530 FRC-RIIWKLEDVDIDTDRR-EIESVVWEDD 558
            +  R+     +VD+ + R    E ++ ++D
Sbjct: 532 HKDWRLCIPASEVDLSSHRNISDEEILRQED 562

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  266 bits (681), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 159/521 (30%), Positives = 267/521 (51%), Gaps = 27/521 (5%)

Query: 58  DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           D   +  ++KR+LK RH                     +A  GP+G ++ +   G+ +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
               LGE+    PV  +F+ +  RFL P++      +Y L W F   LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
              +    W++IF+V++ + N+F V+ +GE EF  ++IK + + GF+I  + ++ G G  
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPD 249

Query: 238 GP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
              +G +YW +PG +  G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVL 356
           K +P AI++V  RIL F++ SL  +G  VPY +  L    S V +SPF+I I+    +VL
Sbjct: 298 KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P I N VIL +++S GNS ++  SR L SMA  GL P +       G P + ++A S FG
Sbjct: 357 PSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++  S      FNWL+ I G+A    WL I+ SH+RF  A+K +G   D+L + +  
Sbjct: 417 LLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAV 476

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIY 529
             W + Y+     +I+L Q + S  P           + F   Y+   + L  +   +IY
Sbjct: 477 GIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIY 536

Query: 530 FRCRI-----IWKLEDVDIDTDRREIE-SVVWEDDAPKTLW 564
           ++C+      I  L+D+D++TDR+ I+  +V ++ A K ++
Sbjct: 537 YKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMY 577

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  266 bits (679), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 270/523 (51%), Gaps = 27/523 (5%)

Query: 58  DELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
           D   +  ++KR+LK RH                     LA  GP+  ++ +   G+ +  
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 118 VTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW 177
               LGE+    PV  +F+ ++ RFL P++      +Y + W F   LE+      IQ+W
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 178 TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT 237
              +    W++IF+ ++ + N+F  + +GE EF  ++IK + + GF+I  + ++CG G  
Sbjct: 175 NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPD 234

Query: 238 GP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 296
              IG +YW +PGA+  G          F G +S L+ A+++  GTE+  + +GE  +P 
Sbjct: 235 HEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP- 282

Query: 297 KAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVL 356
           K +P AI++V  RIL F++ SL  +G  VPY +  L    S V +SPF+I I+    + L
Sbjct: 283 KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKAL 341

Query: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416
           P I NAVIL +I+S GNS ++  SR L SMA  GL P+F       G P   ++  S FG
Sbjct: 342 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFG 401

Query: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476
            L+++  S+  ++ F+WL+ I G+A    WL I+ SH+RF  A+K +  + D+L + +  
Sbjct: 402 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAV 461

Query: 477 MPWLAYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIY 529
             W + Y+    V+I++ Q + S  P           + F  +Y+   + L+ +   ++Y
Sbjct: 462 GIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVY 521

Query: 530 FRCRI-----IWKLEDVDIDTDRREIE-SVVWEDDAPKTLWDK 566
           +R        +  L+D+D++T R+ ++  V+  + A + ++ K
Sbjct: 522 YRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLK 564

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 160/508 (31%), Positives = 270/508 (53%), Gaps = 23/508 (4%)

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           + R LK RH                     LA AGP G L+ +    T++  +  SLGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFW----TFKV 181
           A   PV+  +  +A RF+  + G AN + Y +       LE+      + +W     +K+
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-I 240
              A++++FWV++ + N+F V+ +GE E   + IKV+ ++GF+I  + ++ G G     I
Sbjct: 203 ---AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVI 259

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           G +YW +PG         N    +F G  S  + AAF++ G+EL+G+ A E   PRK++P
Sbjct: 260 GGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIP 314

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHI 359
           +A ++V  RI LFYI SL  +GL VP N+  L +      + SPF+I +     RVLP I
Sbjct: 315 KAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSI 374

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            N VILT +IS GNS+VY  SR + ++A++G  PK       +G P  ++   S FG L 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  +    + F+WLL I+G++ FF WL I+ +H+RF  ALK +G + ++L + +     
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 480 LAYYAIFFMVVIILIQGFTS-FAPHFSGRD-------FVAAYISVGLFLVFWGFFQIYFR 531
            + YA+  + V+++ Q + + + P   G         F   Y+S  + +V +   +I+ R
Sbjct: 495 GSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSR 554

Query: 532 C-RIIWKLEDVDIDTDRREIESVVWEDD 558
             +   K +++DIDT RRE++  +++++
Sbjct: 555 NWKFFIKAKEMDIDTGRRELDLELFKEE 582

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 186/571 (32%), Positives = 303/571 (53%), Gaps = 30/571 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYED-LATEKDELLEHH 64
           SD +E+     I+    G D  S   +  +L     ++++  +++ + L + K   +E  
Sbjct: 10  SDAQEEKGQAVIENCYLGQDVISETLSYKDLSNTTPESTIDKSRWRNFLDSFKRIEVEEV 69

Query: 65  D-----------------VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVA 107
           D                 ++  LK RH                     L  AGP G L+ 
Sbjct: 70  DPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIG 129

Query: 108 YLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALEL 167
           +   GT++F++  +LGE+A   PV+  F  +A RF+  + G AN + Y   W     LE+
Sbjct: 130 WGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEI 189

Query: 168 SVVGQIIQFWTFKVPLA-AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIY 226
                 + +W   V     ++++FW+++   NMF V+ YGE EF  + IKV+A++GF+I 
Sbjct: 190 VAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIIL 249

Query: 227 SLCIVCGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELV 285
            + +VCG G  G     RYW +PGA      + ++   RF G+ S  + AAF++ G+ELV
Sbjct: 250 GIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELV 304

Query: 286 GITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPF 344
           GI + E+ NPRK+VP+A ++V  RILLFYI  L  +GL VPY DP+L  S+    S+SPF
Sbjct: 305 GIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPF 364

Query: 345 IITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGV 404
           +I I   G   LP + N VIL +++S GNS++Y  SR L ++++ G  PK +A    +G 
Sbjct: 365 VIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGR 424

Query: 405 PYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRG 464
           P + +   S FG ++++  S    + FNWLL I+G++ F  W  I   H+RF  ALK  G
Sbjct: 425 PLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNG 484

Query: 465 ISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFS---GRDFVAAYISVGLFLV 521
            S D+LP+K+      +Y+ +   V++++ Q + +  P  S     DF +AY++  + L 
Sbjct: 485 RSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLA 544

Query: 522 FWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           F+   +++ R  +++  L+D+DIDT RRE +
Sbjct: 545 FYIAHKLWKRNWKLLIPLKDIDIDTGRRETD 575

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  265 bits (678), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 162/564 (28%), Positives = 283/564 (50%), Gaps = 31/564 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNS-----NTGELGRRKRKTSVSSTQYEDLATEKDEL 60
           SD+K KS   +  TII+ ++ +  ++         + R+++K  +     +     +D  
Sbjct: 13  SDIKYKSSKNEFITIIESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDSFKPPEDGS 72

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
               ++K+SLK RH                     LA  GP+  ++ +   G+ +     
Sbjct: 73  FHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIH 132

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            LGE+    PV  +F+ +  RFL P++      +Y L W F   LE+      +Q+W   
Sbjct: 133 GLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDS 192

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP- 239
           +    +++IF+ ++ + N+F  + +GE EF  +++K++ + GF+I  + ++ G G     
Sbjct: 193 IDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEY 252

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IG +YW NPG++  G          F G +S L+ A+++  GTE+  + +GE  +P K +
Sbjct: 253 IGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGET-DP-KEL 300

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           P AI++V  RIL F++ SL  +G  VPY +P L    S V +SPF+I I+    +VLP I
Sbjct: 301 PSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSPFVIAIKIHNIKVLPSI 359

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            NAVIL +I+S GNS ++  SR L SMA   L P +       G P   ++  S FG L+
Sbjct: 360 VNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLA 419

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S+   + F+WL+ I G+A    WL I+  HVRF  A+K +  + D+L + +    W
Sbjct: 420 FLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIW 479

Query: 480 LAYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIYFRC 532
            + Y+     +I++ Q + +  P           + F   Y+   + +V +   +IY+R 
Sbjct: 480 GSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYYRV 539

Query: 533 RI--IWK---LEDVDIDTDRREIE 551
                W+   L+D+D+DTDR+ ++
Sbjct: 540 TTGHWWEYIALKDIDLDTDRKNVD 563

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  265 bits (678), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/546 (30%), Positives = 280/546 (51%), Gaps = 16/546 (2%)

Query: 21  IDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXX 80
           +D         N G+ G       VS   +E LA   D+  +H  +K+++K RH      
Sbjct: 45  VDSFKRPEEEYNGGD-GIHSTHERVSGEDFERLA--PDDSSKHKTLKQNIKPRHVLMISL 101

Query: 81  XXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT-FIPVTSSFSVFA 139
                          L N GP   L+ Y  + T+++ V QS  E+A  +  ++  F+ + 
Sbjct: 102 ATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYP 161

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199
              +  A   +  ++Y L W     LEL      I++W   +   A++ IF+V+L   N 
Sbjct: 162 ALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINF 221

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISS 258
                Y E EF+  + KVL L+GF I  + + CG AG  G +G  YW +PGA        
Sbjct: 222 IGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAF-----RG 276

Query: 259 NTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSL 318
           N G  RF G V+ L+NAAF Y G E   +TA E  NP+K++  A +K++ RI+  Y+ + 
Sbjct: 277 NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTA 336

Query: 319 FFIGLTVPYNDPKLTSTDSYVS-SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVY 377
             +G  VPYN P+L  + S  + +SPF+I I + G +V+PHI NAVIL +++S  NS +Y
Sbjct: 337 ALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALY 396

Query: 378 VGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNI 437
             SRIL S+++ G APK       +G P   +L    FG L ++  S      F WLL I
Sbjct: 397 SSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAI 456

Query: 438 TGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGF 497
           +G++  F W  IS SHVRF +++  +G S D+L Y++    W AYYA+  +++I++ Q +
Sbjct: 457 SGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFW 516

Query: 498 TSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIES 552
            + +P         +F   Y+++ + +  +  +++++R  R+I    +VD+ + R+  ++
Sbjct: 517 VAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA 576

Query: 553 VVWEDD 558
            + + +
Sbjct: 577 EIMQSE 582

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  261 bits (666), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 261/493 (52%), Gaps = 18/493 (3%)

Query: 31  SNTGE---LGRRKRKTSVSSTQYEDLATE------KDELL--EHHDVKRSLKQRHXXXXX 79
           S +GE   L + K K+ +  T  ++   E      K  +L  +   +K+ LK+RH     
Sbjct: 2   SESGEASGLSQEKVKSKICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIKMLT 61

Query: 80  XXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA 139
                           L   GPVG L+AYLF+G VV     ++ E+A+F+P T +    A
Sbjct: 62  LVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHA 121

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199
           ++F+  ++G   G++   ++      ELS    I+++WT   P A +I++F VL  A N+
Sbjct: 122 EQFIDESVGFTFGWIS--TYSSLMPGELSATAVIMKYWTDVSP-AVFITVFGVLFVATNI 178

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISS 258
           + ++FYGE E+    +K++ +   +I  L I  G  K    +GF YWR+PG     +++ 
Sbjct: 179 YTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYLVAG 238

Query: 259 NTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSL 318
           + G  +F+G+ +++ +  ++Y G + + I AGE  N R A+    + V +RI++ Y+ ++
Sbjct: 239 HIG--KFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTV 296

Query: 319 FFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYV 378
           F + L VPYND  + +      SSPF+I +  AG +VLPHI NA+ILT+  SAGN  +  
Sbjct: 297 FVLTLIVPYNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIE 356

Query: 379 GSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNIT 438
           GSR LF +A    AP+   KT+ +G+PY+ V+ IS+F  L+YM  S   A  F W   + 
Sbjct: 357 GSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELV 416

Query: 439 GVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFT 498
                  W+LIS +H+   +ALK +G SR DLP      P+ A+++    V+ +   GF 
Sbjct: 417 SSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFY 476

Query: 499 SFAP-HFSGRDFV 510
           +F   HF    F+
Sbjct: 477 NFMHGHFDIESFL 489

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  262 bits (669), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 163/529 (30%), Positives = 280/529 (52%), Gaps = 16/529 (3%)

Query: 33  TGELGRRKRKTSVSSTQYEDL-----ATEKDELLEHHD---VKRSLKQRHXXXXXXXXXX 84
           +GEL ++     V  T   D      A E +E + ++D   +K+ LK+RH          
Sbjct: 10  SGEL-KKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIKMLTLVGVF 68

Query: 85  XXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLS 144
                      L  AGP G  +AY+ +G VV     ++ E+A+F+P T +    A++F+ 
Sbjct: 69  GTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHAEQFID 128

Query: 145 PALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKF 204
            ++G   G++   ++      ELS    ++++WT   P A WI+IF +L    N++ ++F
Sbjct: 129 ESVGFTFGWIS--TYSSLMPGELSATAVVMRYWTDINP-AVWITIFGILFVLTNIYTIRF 185

Query: 205 YGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEAR 264
           YGE E++   +K++ ++  ++  L I  G  K   +GF YWR PG     I+    G  +
Sbjct: 186 YGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLGFHYWREPGPFAEYIVKGEIG--K 243

Query: 265 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLT 324
           F+G+ ++L +  ++Y G + + I AGE  N R A+    R V +RI++ Y+ ++  + L 
Sbjct: 244 FVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLIAVLVLTLI 303

Query: 325 VPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
           VPYND  + +      SSP++I IQ A  ++LPHI NA+ILT+  SAGN  +  GSR LF
Sbjct: 304 VPYNDKLIATGTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAGNLAIVEGSRNLF 363

Query: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444
           ++A    APK    T  +G+PY+ +  ISAF  LSYM +S+  A  F+W   +       
Sbjct: 364 ALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSWFQELVSSNTLL 423

Query: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-H 503
            W+LIS +H+   +ALK +G SR DLP+     P+ A+++    ++ +L  GF +F   H
Sbjct: 424 RWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLLTGGFYNFIHGH 483

Query: 504 FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552
           F    F   Y  + L ++ + F++++ + + + +  +VD+++   +I  
Sbjct: 484 FDIESFFTRYFIIPLAIILFTFWKLFKKTKYL-RPAEVDLESIFEDIRQ 531

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  264 bits (674), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 275/533 (51%), Gaps = 16/533 (3%)

Query: 40  KRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANA 99
           +R  S    +  DL      +  ++ +K+S+K RH                     L  A
Sbjct: 60  RRAESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 100 GPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLS 158
           GP   ++ Y+ +  + + + Q+ GEM   +  +  +F+ +   F+S + G A  +++ + 
Sbjct: 120 GPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 159 WCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL 218
           W     LEL      I++W   +    +I IF+V L   + F VK YGE EF   S K+L
Sbjct: 180 WLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 219 ALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAF 277
            + GF+I S+ I CG AG  G IG +YWR+PG+   G     +   RF G    L+ A F
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFILVTAYF 294

Query: 278 TYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDS 337
           ++ G EL  ++  E +N RK+ P A ++ + RIL+ Y+ ++  IG  VP+N+ +L  + S
Sbjct: 295 SFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGS 354

Query: 338 YVS-SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
             + +SP+++       RV+PHI NAVIL ++IS  NS +Y   R++ S+A+ G AP+FL
Sbjct: 355 AATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFL 414

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                +G P  ++   +  G + ++  S    +AF WL  I G++  F W  I  SH+RF
Sbjct: 415 NYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRF 474

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVA 511
            +A+K +G S  +L YKA    W +YY +FF +++ + Q + + +P  +G     + F  
Sbjct: 475 RKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFE 534

Query: 512 AYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            Y++  L++  +  + +Y +   ++  L+ +D+D  RR  + E +  ED+  K
Sbjct: 535 GYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  265 bits (678), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 166/546 (30%), Positives = 273/546 (50%), Gaps = 23/546 (4%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69
           E   +Q+ D     ND ++  SN   L  R  +   ++   +    E+ +  E+  +K++
Sbjct: 104 ENYSMQEFD-----NDLENKKSN---LHIRDDELDYATVNVDSQPVEQQD--ENAQLKQT 153

Query: 70  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TF 128
           +K RH                    PLA AGP   ++ Y  MGT ++ + Q+ GE+A  +
Sbjct: 154 IKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213

Query: 129 IPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWIS 188
             V  SF+ F    + P    A  ++Y + W     LEL      I++WT KV    ++ 
Sbjct: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVV 273

Query: 189 IFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKTGPIGFRYWRN 247
           IF+VL+   N F  K Y E EF+    KV+ ++GF I ++CI  GA G  G IG +YW +
Sbjct: 274 IFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWND 333

Query: 248 PGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVL 307
           PGA         T   RF G + + + AAF +  TE + +TA E +NPRKA+P A +KV 
Sbjct: 334 PGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVA 388

Query: 308 IRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
            RILL ++ S+  IG  VPYN D  + S+    S+SP+++     G  V+ H  NAVIL 
Sbjct: 389 YRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           +++S  NS  Y  SR+L  +A+ G APK+       G P  S+L  +    +++   S  
Sbjct: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPK 508

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
               F WLL I+G++  F W  I  SH+RF + ++ +G S  +L ++A      +YYA  
Sbjct: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568

Query: 487 FMVVIILIQGFTSFAPH----FSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDV 541
            + + ++ Q + +  P         +F   Y+++ + L  +  F+++ R  R+  + +++
Sbjct: 569 MLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNI 628

Query: 542 DIDTDR 547
           D+ + R
Sbjct: 629 DLISHR 634

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  263 bits (672), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 179/569 (31%), Positives = 283/569 (49%), Gaps = 39/569 (6%)

Query: 9   KEKSVIQDIDTIIDGNDSDSHNSNT---------GELGRRKR-KTSVSSTQYEDL----- 53
           +EK +   ID        + H  N+          E  R +R + S      +DL     
Sbjct: 3   QEKKLDYSIDQETQLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLT 62

Query: 54  -ATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMG 112
            A +   L  +  +KR+LK RH                     LA AGP G L+ +   G
Sbjct: 63  DAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTG 122

Query: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172
           T+++ +  ++GE+A   P+   F+ +A RF+  + G A   +Y L W     LE+     
Sbjct: 123 TMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASI 182

Query: 173 IIQFW-TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIV 231
            + +W T       ++++F+V++ A N F VK YGE EF  + IKV+ ++G++I  + +V
Sbjct: 183 TVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILV 242

Query: 232 CGAGKTGPIGF-RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290
           CG G  G     R W NPGA   G          F G  S  + AAF++ G+ELVG+ A 
Sbjct: 243 CGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAA 292

Query: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQ 349
           E ANPRK++P A ++V  RI LFYI +L  +GL VPY   +L    S   ++SPF+I+IQ
Sbjct: 293 ETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQ 352

Query: 350 NAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSV 409
           NAG + LP + N VIL  ++S GNS V+  SR + ++A  G  PK        G P + +
Sbjct: 353 NAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGI 412

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
           +    FG LS++  S    + F+WLL ++G++  F W  I   H+R  +AL  +  +  +
Sbjct: 413 IVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAE 472

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP---HFSGRDFVAAYISVGLFLVFWGFF 526
           L + A    W + Y    +++I++ Q + +  P     S   F  AY+S  + + F+   
Sbjct: 473 LSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGH 532

Query: 527 QIYFRCRIIWKL----EDVDIDTDRREIE 551
           +I+ +    WKL    +++DIDT RRE +
Sbjct: 533 KIWKKN---WKLFIRAKNIDIDTGRRETD 558

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 169/584 (28%), Positives = 285/584 (48%), Gaps = 38/584 (6%)

Query: 10  EKSVIQDIDTIIDGN-DSDSHNSNTGELGR--------RKRKTSVSSTQYEDLATEKDEL 60
           E+      +T  D   ++ SHN  T E G+         +RK +V     +      D  
Sbjct: 13  ERKGSSSTETCSDSKLNTKSHNEYTYESGKCSLLNGSTEERKRNVVQRVIDSFKPPVDGS 72

Query: 61  LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQ 120
            +  ++KR+LK RH                     LA  GP+  ++ +   GT +     
Sbjct: 73  FDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIH 132

Query: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            LGE+   +PV  +F+ ++ RFL P++      +Y + W F   LE+      ++FWT  
Sbjct: 133 GLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQS 192

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP- 239
           V    W+++F+ ++ + N+  V+ +GE EF  +S+KV+ + GF+I  + ++ G G T   
Sbjct: 193 VDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQY 252

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           +G RYW +PG +  G          F G  + ++ A+++  G+E+  + +GE  +P K +
Sbjct: 253 VGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEL 300

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           P AI+++  RIL F++ SL  +G  VPY +  L    S   +SPF++ +     +V+PHI
Sbjct: 301 PHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVVPHI 359

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            N VIL +I+S GNS ++  SR L SMA  GL P         G P + +LA S FG L+
Sbjct: 360 VNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLA 419

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++   +  +  F+WL+ I G+A    WL I+ SHVRF  A+K +  S D+L + +    W
Sbjct: 420 FLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVW 479

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRD-------FVAAYISVGLFLVFWGFFQIYFRC 532
            + YA     + ++ Q + +  P    +D       F   Y+   + +  +   + YFR 
Sbjct: 480 GSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRI 539

Query: 533 RI-----IWKLEDVDIDTDRREIE-SVVWED--DAPKTLWDKFW 568
                  I KL +VD+DT R  I+  ++ E+  +  K L +K W
Sbjct: 540 TTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/559 (29%), Positives = 281/559 (50%), Gaps = 23/559 (4%)

Query: 18  DTIIDGNDSDSHNSNTGELGR---RKRKTSVSSTQYEDLAT-------EKDELLEHHDVK 67
           +T + G  S+  +S   E  R   ++  TS S  ++    +       +  E +   ++ 
Sbjct: 28  ETPVGGTTSNPESSFLSEKNRYDFKEETTSFSDDRFNSQHSYNPGSPDDIKEDIHTSNMN 87

Query: 68  RSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT 127
           + L  RH                     L   GP   ++ +  + T +F+V  SLGE+A 
Sbjct: 88  QDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGELAA 147

Query: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187
             PV   F+V+  RF+ P+   +    Y + W     LEL      I++W   +   AW+
Sbjct: 148 AYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDTINSDAWV 207

Query: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWR 246
           +IF+ L+   N+  VK +GE EF ++ +K+LA++GF I  + + CG G  G     +YW 
Sbjct: 208 AIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGKYWH 267

Query: 247 NPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKV 306
           +PGA        ++   +F G  S  + AAF+Y G E++ ++A E+ NPRK +P A ++ 
Sbjct: 268 DPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRT 322

Query: 307 LIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYV--SSSPFIITIQNAGTRVLPHIFNAVI 364
              I   YI  L  +G  V YND +L +  S V  ++SP +I I+N G + LP + NA+I
Sbjct: 323 FWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAII 382

Query: 365 LTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELS 424
           L  I+S  NS VY  SR + SMA  G  PK L+    +G P  ++     FG LS++  S
Sbjct: 383 LIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAAS 442

Query: 425 TGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYA 484
               + F WL  ++G++  F W+ I+ +H+RF QA+  +  S D++PY +    + +YY 
Sbjct: 443 DKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYG 502

Query: 485 IFFMVVIILIQGFTSFAP-HFSGRD---FVAAYISVGLFLVFWGFFQIYFRC-RIIWKLE 539
              + ++++   +TS  P    G D   F   Y+S  + +  +   ++YF+  RI+  LE
Sbjct: 503 TAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLE 562

Query: 540 DVDIDTDRREIESVVWEDD 558
           ++D+ T R+E++  + +++
Sbjct: 563 EIDLLTGRKEVDIDILKEE 581

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 271/521 (52%), Gaps = 28/521 (5%)

Query: 37  GRRKRKTSVSSTQYEDLATEKD-ELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXP 95
           G+++     SS   ++L ++ D E     D+ R+L  RH                     
Sbjct: 16  GKQEIYEVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKS 75

Query: 96  LANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMY 155
           L N GP    + Y  +G VV+     LGEM+TF+P++ SF  +A++F S +   A  + Y
Sbjct: 76  LHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNY 135

Query: 156 FLSWCFTFALELSVVGQIIQFW---TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWI 212
           + +   + A +L+ +  ++ +W       P      IFW  +   N+  V+ YGE E+W+
Sbjct: 136 WFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWL 195

Query: 213 ASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFL----G 267
           A +KV+A++ F I S+ +  G       IGF+ W +             GEA F+    G
Sbjct: 196 AMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTH-------------GEAPFVNGFKG 242

Query: 268 WVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPY 327
           + S  ++A F Y GTE + +T GEA+NP +  P+ ++ V  RIL+FY+ S FFIG+ +PY
Sbjct: 243 FASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPY 302

Query: 328 NDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMA 387
           + P L++    V +SPF +  Q AGTR      NAVILT++ISA N  ++ GSRI+++MA
Sbjct: 303 DYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMA 360

Query: 388 KNGLAP-KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446
            +G  P K + +T     PY++VL   A G L       G    + WL NI GV+   AW
Sbjct: 361 LDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAW 420

Query: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG 506
           L I  + +RF + L+ +G   D L +K    P+  Y+ + F V IILIQG+ +F P +S 
Sbjct: 421 LCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSV 478

Query: 507 RDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
            DF + Y+ + +F   +  + ++ R   + K ED+D  TDR
Sbjct: 479 TDFFSVYLELFVFPFVYIIWWLWKRDWFV-KYEDMDFVTDR 518

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  261 bits (668), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 165/567 (29%), Positives = 282/567 (49%), Gaps = 33/567 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGE----LGRRKRKTSVSSTQYEDLATEKDELL 61
            DL  K+   +   +    D++S +S  G     +   KR      T  E+      E +
Sbjct: 5   EDLSAKNTKSNTIAVEIPIDTESVHSQHGFVRNFMDSFKRAEPQGQTIREEKLENGLETV 64

Query: 62  EHHD-------VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
             +D       +K+++K RH                     L   GP G ++ Y+   T+
Sbjct: 65  RTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTM 124

Query: 115 VFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQI 173
           ++ V Q+  E+  ++  +  +++ +    +      A  ++Y L W     LEL      
Sbjct: 125 LYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMT 184

Query: 174 IQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG 233
           I++W   +    +++IF+  +   + F  + Y E EF   S KVL ++GF+I  + + CG
Sbjct: 185 IKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCG 244

Query: 234 AGKTGPIGFRYWRNPGA-MGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEA 292
           A K+G IG +YW  PGA +G   I        F G  S  + +AF Y G+E + +TA E 
Sbjct: 245 ASKSGYIGGKYWHTPGAFVGEKAID------HFKGICSVWVQSAFAYGGSEFIALTAAEQ 298

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS--SPFIITIQN 350
            NPRK+VP+A ++ L R+L+ ++  +  +G  VPY+ P L  +    +S  SPF+I   +
Sbjct: 299 TNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAAS 358

Query: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410
            G +V+PHI NAVIL ++IS GNS  Y   RIL S+A+ G+ PK       +G P +++L
Sbjct: 359 HGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTML 418

Query: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470
            ++ FG +S++  S      F WL  I  ++  F W  IS SH+RF  A+K +G S  +L
Sbjct: 419 FVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGEL 478

Query: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVAAYISVGLFLVFWGF 525
            YKA    W ++YAI F ++++  Q + + AP  +G      +F   Y++  + + F+  
Sbjct: 479 GYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFG 538

Query: 526 FQIYFRCRIIWKL----EDVDIDTDRR 548
           +++++R    WKL    + VD+++ R+
Sbjct: 539 YKLWYRD---WKLFIPADKVDLESHRK 562

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  261 bits (667), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 174/539 (32%), Positives = 278/539 (51%), Gaps = 23/539 (4%)

Query: 26  SDSHNSNTGELGRRKRKTSVSSTQYEDL------ATEKDELLEHHDVKRSLKQRHXXXXX 79
           S S  S  G     + K S    +  DL      A +   L  +  +KR+LK RH     
Sbjct: 30  SQSDTSRVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIG 89

Query: 80  XXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFA 139
                           LA AGP G L+ +   GT+++ +  ++GE+A   PV   ++ +A
Sbjct: 90  IGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYA 149

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA-AWISIFWVLLTAFN 198
            RF+  + G A   +Y + W  T  LE+      + +W        A++++F+V++   N
Sbjct: 150 SRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGIN 209

Query: 199 MFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGF-RYWRNPGAMGPGIIS 257
           +F VK YGE EF  + IKV+A++GF+I  + +VCG G  G     R W NPGA   G   
Sbjct: 210 LFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--- 266

Query: 258 SNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGS 317
                  F G  S  + AAF++ G+ELVG+ A E ANPRK++P A ++V  RI LFYI +
Sbjct: 267 -------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILA 319

Query: 318 LFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNV 376
           L  +GL VPY   +L    S   ++SPF+I+IQNAG + LP + N VIL  ++S GN  V
Sbjct: 320 LLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAV 379

Query: 377 YVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLN 436
           +  SR + ++A  G  PK        G P + ++    FG LS++  S    + F+WLL 
Sbjct: 380 FGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLA 439

Query: 437 ITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQG 496
           ++G++  F W  I   H+R  +AL  +  +  +L + A    W + Y++  +++I++ Q 
Sbjct: 440 LSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQF 499

Query: 497 FTSFAP---HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRREIE 551
           + +  P     S   F  AY+S  +++VF+   +I+ +  ++  K  D+DID+ RRE +
Sbjct: 500 WIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETD 558

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  262 bits (670), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 170/571 (29%), Positives = 290/571 (50%), Gaps = 21/571 (3%)

Query: 6   SDLKEKSVIQDIDTIIDGND--SDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH 63
           S+ + K V + +D+     D  +   +   G  G  K K        +   ++ D ++ +
Sbjct: 53  SEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIITN 112

Query: 64  HDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLG 123
             +K+++K RH                     L   GP   ++ Y+ +  V + + Q+ G
Sbjct: 113 THLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAG 172

Query: 124 EMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVP 182
           EMA   P +  +F+ ++  F+S A G A  +++ + W     LEL      I++W  K+ 
Sbjct: 173 EMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKIN 232

Query: 183 LAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGPI 240
              +I IF+V L   ++F  V  YGE EF     K+L ++GF+I S+ I   GAG    I
Sbjct: 233 ADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYI 292

Query: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300
           G ++W +PGA      +  T  +RF G    L++  F+Y GTEL  ++  E +NPR++ P
Sbjct: 293 GGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTP 347

Query: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359
           +A +  L RIL+ Y+ ++  IG  VPY+ D  + S  S   +SP+++     G ++ PH 
Sbjct: 348 QASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAASLNGVKIAPHF 407

Query: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419
            NAVIL ++IS  NS++Y   R++ S+A+ G APKFL     QG P L+++A    G + 
Sbjct: 408 INAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIG 467

Query: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479
           ++  S    + F WL  I G++  F W  I  SHVRF  A+K +  S ++L YKA    +
Sbjct: 468 FVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIY 527

Query: 480 LAYYAIFFMVVIILIQGFTSFAPHFSG------RDFVAAYISVGLFLVFWGFFQIYFR-C 532
            + Y + F +++   Q +T+  P F G        F A Y+++ ++LVF+  + ++ R  
Sbjct: 528 GSIYGVCFNLLVFAAQFWTALFP-FGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDF 586

Query: 533 RIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
           +++  L+ +D+D  RR  + E +  ED+  K
Sbjct: 587 QLLKPLDKIDLDFHRRIYDPELMRQEDEESK 617

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  261 bits (666), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 172/561 (30%), Positives = 288/561 (51%), Gaps = 31/561 (5%)

Query: 10  EKSVIQDIDTIIDGNDSDSHNSNT--GELG--RRKRKTSVSSTQYEDLA-------TEKD 58
           +K   Q  ++I  GND + +   T  G +   +   K ++ S   ED+        TEK 
Sbjct: 2   KKQQEQYPESISMGNDKNMYKPETMFGTMNWPKLMSKDTLISDSSEDITNDSTTGKTEKG 61

Query: 59  EL-LEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFS 117
               E+  +K+S+K  H                     +++AG  G LV Y  +G+++  
Sbjct: 62  HTGSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVC 121

Query: 118 VTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQF 176
             QS+GE+    P +   F+ + +RF+ P+ G    +++ L W     LEL      I++
Sbjct: 122 CMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKY 181

Query: 177 WTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-G 235
           W   +  + +++IF+ L+   + F  + Y + EF     KVL + GF+I  + I  GA G
Sbjct: 182 WNNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAG 241

Query: 236 KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAA-- 293
            +G IG +Y + PGA      + NT    F    S+L+NA F+  G E + ++A E A  
Sbjct: 242 TSGYIGIKYLKTPGAFN----TRNT----FKSICSTLVNACFSCGGVEFLALSAAEQARG 293

Query: 294 NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLT-STDSYVSSSPFIITIQNAG 352
           N  K++ RA  +VL+R+ +FYI S+F IGL VPYN P+L  S+   + SSP++I + + G
Sbjct: 294 NISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHG 353

Query: 353 TRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAI 412
            +V+PH+ NAVIL  ++S  NS +Y  SR L ++A+ G AP + AK   +G P+  ++  
Sbjct: 354 VKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVS 413

Query: 413 SAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPY 472
             FG LS++         F WLL+I+G++  F W +I  +H+RF  A+K +  S ++L +
Sbjct: 414 GVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGH 473

Query: 473 KALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGR----DFVAAYISVGLFLVFWGFFQ 527
           +A    + +YY I    + +++Q + S  P    GR    +F   Y++V   L  +   +
Sbjct: 474 RAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHK 533

Query: 528 IYFRC-RIIWKLEDVDIDTDR 547
           IY R  + I   + +D+DT R
Sbjct: 534 IYTRSWQFIIPADKIDVDTSR 554

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  259 bits (663), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 268/496 (54%), Gaps = 31/496 (6%)

Query: 63  HHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSL 122
             D+ R+LK R                      L   GP    + Y  MG VV+    +L
Sbjct: 47  REDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLAL 106

Query: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWT---F 179
           GEM+T++P++ SF V+A++F S +   A  + Y+ +   + A +L+ +  ++ +W     
Sbjct: 107 GEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEH 166

Query: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239
             P  A   IFW ++   N+  V+FYGE E+W+A +K++A++  + + L IV   GK   
Sbjct: 167 GFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAII--IFFILSIVVNVGKNPQ 224

Query: 240 ---IGFRYWRNPGAMGPGIISSNTGEARFL----GWVSSLINAAFTYQGTELVGITAGEA 292
              IGF+ W               GEA F+    G+ S  ++A+F Y GTE + +T GEA
Sbjct: 225 HEYIGFKNWTR-------------GEAPFVDGIKGFASLFVSASFAYGGTESITLTNGEA 271

Query: 293 ANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAG 352
            NP +  P+ ++ V  RIL+FY+GS FFI + +PY+ P L S    + +SPF +  Q AG
Sbjct: 272 ENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IVTSPFTLVFQMAG 329

Query: 353 TRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP-KFLAKTTLQGVPYLSVLA 411
           T+      NAVI+T++ISA N  ++ GSRI+++M   G  P + +++T    VPY+SVL 
Sbjct: 330 TKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLI 389

Query: 412 ISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLP 471
            +A G+L +     G    + WL NI GV+   AWL I  + +RF + L+ +G +  +L 
Sbjct: 390 TAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELI 448

Query: 472 YKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFR 531
           YK    P+  Y+ I F+  IILIQG+++FAP ++  +F + Y+ + +F V +  + +  R
Sbjct: 449 YKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVFPVCFIIWWLVKR 507

Query: 532 CRIIWKLEDVDIDTDR 547
            R + K ED+D  TDR
Sbjct: 508 DRFV-KYEDMDFTTDR 522

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  259 bits (661), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 241/466 (51%), Gaps = 14/466 (3%)

Query: 38  RRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLA 97
           ++  K ++     +     ++   +   +KRSLK RH                     LA
Sbjct: 49  KKAYKRNLFHRCIDSFKPPENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALA 108

Query: 98  NAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFL 157
             GP+  ++ +L  GT +      LGE+    PV  +F+ +  RFL P+L      +Y L
Sbjct: 109 IGGPLAVIIGWLIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVL 168

Query: 158 SWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217
            W F   LE+      IQFW   +    W++IF+V + A N+F V+ +GE EF  +SIKV
Sbjct: 169 QWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKV 228

Query: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276
           + + GF+I  + ++ G G T   +G RYW +PGA+  G          F G  S  + A+
Sbjct: 229 ITISGFIILCIVLIVGGGPTHEYVGARYWHDPGALAHG----------FKGVASVFVTAS 278

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
           ++  G+E+  + +GE  +P K +P AI++V  RI+ F++ SL  +G  VPY +  L    
Sbjct: 279 YSLGGSEMACLASGET-DP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGS 336

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
           S V++SPF+I       +VLP I NAVIL +I+S GNS ++  SR L SMA  GL P+  
Sbjct: 337 S-VNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIF 395

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
                 G P + ++  S FG L+++  S+  ++ FNWL+ I G+A    WL I+ SH+RF
Sbjct: 396 GYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRF 455

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP 502
             A+K +  + D+L + +    W + Y+    V+I++ Q + S  P
Sbjct: 456 RMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILIAQFYISLWP 501

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 270/540 (50%), Gaps = 28/540 (5%)

Query: 49  QYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAY 108
            Y D+   K        + R LK RH                     L+  GP   L+AY
Sbjct: 42  SYSDIENFKPP----QKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAY 97

Query: 109 LFMGTVVFSVTQSLGEMATFIPVTSSFSVF--AQRFLSPALGAANGYMYFLSWCFTFALE 166
           + +   V+S+   + EM   IP+    S++  A+ +L+  +    G+  F +       E
Sbjct: 98  IIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAE 157

Query: 167 LSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIY 226
           ++    ++Q+WT     A +ISIF V+     M PVK +GE EFW++SIK+L ++G +I 
Sbjct: 158 ITACALLVQYWT-DANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIV 216

Query: 227 SLCIVCGAG--KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGT-E 283
            + I  G G  +   +GF YW+NPGA  P +   NTG  RFL   +++I + F++    E
Sbjct: 217 GIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTG--RFLAVWTAIIKSGFSFVLVPE 274

Query: 284 LVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL----TSTDSYV 339
            V   + E   PR+ +P+A ++ + R+ +FYI     +G+ V +N+ +L     S  S  
Sbjct: 275 TVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDA 334

Query: 340 SSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT 399
           ++SPF+I IQ AG ++LPHI NA ILT+  S G   +Y  SR L+SMA  G APK  AK 
Sbjct: 335 AASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKV 394

Query: 400 TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQA 459
              G PY S    S F  L+Y+  S   +  FNWL NI  ++GF +W+ +S +++RF + 
Sbjct: 395 NRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKV 454

Query: 460 LKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGRDFVAAYISVGL 518
           +    ++ D +P++  +   LAY    F  ++ L  G+  F   +++  DF A+Y+++G 
Sbjct: 455 INALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGF 513

Query: 519 FLVFWGFFQIYFRCRIIWKLEDVDID-------TDRREIESVVWEDDAPKTLWDKFWDFV 571
            +  +     Y++       ++++++        D  E   V+     P+   +K W F+
Sbjct: 514 VIFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERNDVI---PVPRNFMEKVWYFI 570

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  259 bits (661), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 183/533 (34%), Positives = 285/533 (53%), Gaps = 33/533 (6%)

Query: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXX 83
           N +DS + +  ++ R    TS S  QY+    E D + EH  + RSL  RH         
Sbjct: 4   NKNDSSSIHVLKVAR----TSSSDVQYDSEGQEADHVREH--LNRSLTPRHINMISIAGV 57

Query: 84  XXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143
                       LA  GP   ++ Y  +G VV+     LGEM+TF+P++ SF  +A++F 
Sbjct: 58  IGTGLYLGTGKALAKGGPASLVINYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAKKFG 117

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFW-TFKVPLAAWIS--IFWVLLTAFNMF 200
           S +L       Y+ +   + A +L+ +  I+ FW T       W +  IFW +L   N+ 
Sbjct: 118 SGSLAFTLMCNYWFNDAVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVV 177

Query: 201 PVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSN 259
            V+ YGE E+W+A +KV+A++ F I S+ +  G  +    IGF+ W             +
Sbjct: 178 HVRVYGEAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSYIGFKNW-------------S 224

Query: 260 TGEARFL----GWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI 315
            GEA F+    G+ S  ++++F Y GTE + +TAGEA NP +  P+ I+ V  RIL+FY+
Sbjct: 225 VGEAPFVNGFKGFASLFVSSSFAYGGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYV 284

Query: 316 GSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSN 375
            + FFIG+ VPYN PKL  ++  V +SPF I  Q  GT+      NAVILT++ISAGN  
Sbjct: 285 FTTFFIGMNVPYNYPKL--SEKSVMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHA 342

Query: 376 VYVGSRILFSMAKNG-LAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWL 434
           ++ GSR+LF++   G   P  + KT    +PY++VL   A G L +     G    + WL
Sbjct: 343 LFAGSRVLFNLGLEGYFFPSIITKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWL 402

Query: 435 LNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILI 494
            NI GV+   AWL IS   +RF + L  +G +  +L +     P+  Y+ + F+  IIL+
Sbjct: 403 QNIVGVSNQIAWLCISIVSIRFRRGLAKQGKTH-ELQFSNWTYPYGPYFLVLFVSFIILV 461

Query: 495 QGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
           QG++SFAP ++  DF + YI + +F+  + F+ ++ R   + + ED+D  TD+
Sbjct: 462 QGWSSFAP-WNVTDFFSYYIELIVFVALYVFWWLWKRDAFV-RSEDMDFVTDK 512

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 169/560 (30%), Positives = 281/560 (50%), Gaps = 21/560 (3%)

Query: 15  QDIDTIIDGNDSDSHNSNTGELGR-----RKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69
            DI      N S SH  NT          ++ +    + +  DL      +     +K+S
Sbjct: 34  DDISIASSQNRSLSHRKNTSYYRNFIDSFKRAEHGNLNEKSADLEDGTASIQSKSYMKKS 93

Query: 70  LKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFI 129
           LK RH                     LA  GP   ++ Y+ +  +V+ + Q+ GEMA   
Sbjct: 94  LKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTY 153

Query: 130 P-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWIS 188
           P +  +F+ +   F+S + G A  +++ + W     LEL      IQ+WT  +    ++ 
Sbjct: 154 PTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT-DLNGDIFVV 212

Query: 189 IFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRN 247
           IF+V L   +   VK YGE EF     K+L + GF+I+S+ + CG AG  G IG +YW  
Sbjct: 213 IFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHT 272

Query: 248 PGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVL 307
           PG+   G  +S     RF G    L+   F+Y GTEL  ++  E A PRKA P A +K +
Sbjct: 273 PGSFAEGGPTS-----RFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSI 327

Query: 308 IRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
            RIL+ Y+ ++  IG  VP+N  +L     S   +SP+++     G +V+PHI NAVIL 
Sbjct: 328 YRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILI 387

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           +++S  NS++Y   R+L S+A+ G APK L     +G P +++L  + FG ++++  S  
Sbjct: 388 SVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDK 447

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
             + F WL  I G++  F W  I  SHVRF  A+K +    D++ YKA    + +++   
Sbjct: 448 EEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSI 507

Query: 487 FMVVIILIQGFTSFAPHFSG-----RDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLED 540
           F V++++ Q + + +P  SG       F   Y+++ +++ F+  + +Y +   I+  L  
Sbjct: 508 FGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLSK 567

Query: 541 VDIDTDRREIE-SVVWEDDA 559
           +D+D  RR  +  ++ ++DA
Sbjct: 568 IDLDAHRRIYDPDLIRQEDA 587

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  258 bits (659), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 170/570 (29%), Positives = 283/570 (49%), Gaps = 41/570 (7%)

Query: 26  SDSHNSNTGELGRRKRKTSVSSTQYEDLA----TEKDELLEHHDVKRSLKQRHXXXXXXX 81
           S  H++N       ++K ++ +   +D+     ++ D +    +V R LK RH       
Sbjct: 27  SRDHSTN-------QKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALG 79

Query: 82  XXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVT--SSFSVFA 139
                         L++ GP   L++Y  M   V+++   + EM   IP++  SS +  A
Sbjct: 80  GAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLA 139

Query: 140 QRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNM 199
             +L+       G+  F +       E++    +I++WT     A +++IF +L T  ++
Sbjct: 140 GTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWT-DANAAIFVTIFMILATLLSL 198

Query: 200 FPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG--KTGPIGFRYWRNPGAMGPGIIS 257
            PVK +GE EF ++ IK+L ++G ++  + I  G G  +   +GF YW  PGA    ++ 
Sbjct: 199 LPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVK 258

Query: 258 SNTGEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIG 316
            +TG   FL    ++I + F +    E+    + EAA PRK +PRA ++ + R+ +FY+ 
Sbjct: 259 GSTGA--FLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVL 316

Query: 317 SLFFIGLTVPYNDPKL----TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAG 372
               IG+ V Y++  L    +S  +  ++SPF+I IQ AG R+LPHI NA ILT+  S  
Sbjct: 317 GCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCS 376

Query: 373 NSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFN 432
            S +Y  SR+L S+A  G APKF +K    GVPY SV A S FG L+Y+  S      FN
Sbjct: 377 TSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFN 436

Query: 433 WLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVII 492
           WL NI  ++GF  W+ +S +++RF +   +  I+ D +PY+      LAY +  F  ++ 
Sbjct: 437 WLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLA 495

Query: 493 LIQGFTSF-APHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDI-------- 543
           +  GF  F A +++  DF   Y+++G   V +    IY++    W   D+D+        
Sbjct: 496 ITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYK---EWTFRDMDVVGREIMPK 552

Query: 544 --DTDRREIESVVWEDDAPKTLWDKFWDFV 571
               D+ E E  +     PK   ++ W  V
Sbjct: 553 IDQADQEEKEEYL---PPPKNWVERVWRIV 579

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  259 bits (662), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 160/553 (28%), Positives = 278/553 (50%), Gaps = 28/553 (5%)

Query: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65
           ++ +++   Q +     GN S   N     L   KR+  +  +Q  +L ++     E ++
Sbjct: 37  TEKQDEESEQQVKPQKTGNKSKLQNECKKILSSFKRQ--LPPSQNSELESQ-----EKNN 89

Query: 66  VKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125
           + +S+K RH                     L  AGP G ++ Y     +++ + Q+ GE+
Sbjct: 90  LTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGEL 149

Query: 126 A-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLA 184
              +  +T +++ +    + P+LG A   +Y + W     L+L      +++WT  V   
Sbjct: 150 GLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSD 208

Query: 185 AWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFR 243
            ++++ ++ +   N+F  + Y E EF     K+L ++GF+I ++ I CG AG    IG  
Sbjct: 209 IFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTE 268

Query: 244 YWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 303
           YW NPG    G          F G  +    AAF+Y G E++ ++A E  NP K++P A 
Sbjct: 269 YWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNAC 318

Query: 304 RKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSS--SPFIITIQNAGTRVLPHIFN 361
           +KV+ RILL Y+ +   +   VPYN  +L  +D    S  SPF+I + + G +V+PH  N
Sbjct: 319 KKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFIN 378

Query: 362 AVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYM 421
           AVIL ++IS  NS++Y G R+L S+A+ G+ PK LA    +G P L  L   AFG + ++
Sbjct: 379 AVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFV 438

Query: 422 ELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLA 481
             S    + F WLL I+ ++  F W+ +S SH+RF  A+  +G S +++ YKA    W +
Sbjct: 439 ATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGS 498

Query: 482 YYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW 536
           + A+   V  ++ Q + + AP       + + F   Y+++ + LV +   +IYF+    W
Sbjct: 499 WLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFW 558

Query: 537 KLED-VDIDTDRR 548
              D +D+++ R 
Sbjct: 559 IPADKIDLNSHRN 571

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  258 bits (659), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 261/507 (51%), Gaps = 16/507 (3%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           E+ AT  ++      +K ++K RH                     L   GP G L+ YL 
Sbjct: 58  EEYATGLNK--TQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLT 115

Query: 111 MGTVVFSVTQSLGEMAT-FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
             T+++ V Q+  E+   +  +  +++ +    +    G A   +Y L W     LEL  
Sbjct: 116 TSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVT 175

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
               I++WT  V    +++IF++ +   + F  + Y E EF   ++KVL + GF+I  + 
Sbjct: 176 ASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGIS 235

Query: 230 IVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289
           + CGA K G IG +YW NPG    G  S N       G  S  + +AF Y G+E + +TA
Sbjct: 236 LNCGASKLGYIGAKYWSNPGTFA-GERSIN----HLKGICSVWVQSAFAYGGSEFIALTA 290

Query: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL--TSTDSYVSSSPFIIT 347
            E ANPR++VP A ++ L R+++ ++  +  I   VPY   +L  +S  S   +SPF+I 
Sbjct: 291 AEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIA 350

Query: 348 IQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYL 407
               G +++PHI NA+ILT++IS GNS +Y   RIL S+A+NGL PK        G P  
Sbjct: 351 AAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLA 410

Query: 408 SVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISR 467
           ++L +  FG LS++  S      F WL  I G++  F W  I+ SH+RF  A+K +G S 
Sbjct: 411 TLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSL 470

Query: 468 DDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVF 522
            +L Y +      +YYA+FF +V+++ Q + + AP           F   Y++  + ++F
Sbjct: 471 GELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLF 530

Query: 523 WGFFQIYFR-CRIIWKLEDVDIDTDRR 548
           +  ++I++R  +++  ++ +D++T R+
Sbjct: 531 YVGYKIWYREVQLLIPVDKIDLETHRQ 557

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/588 (29%), Positives = 288/588 (48%), Gaps = 46/588 (7%)

Query: 4   GPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEH 63
           G  ++K    I   +T ID +  +  N N         K  +  + + D           
Sbjct: 20  GDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSD----------- 68

Query: 64  HDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLG 123
            ++KR LK RH                     LA  GP+  ++ +   G+ +      LG
Sbjct: 69  -NLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLG 127

Query: 124 EMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPL 183
           E+    PV  +F+ ++ R L P++      +Y   W F   +EL      +QFWT KV  
Sbjct: 128 EITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDP 187

Query: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGF 242
             W++IF+V++ + N+F VK +GE EF  + +KV+ ++GF+I S+ ++CG G     IG 
Sbjct: 188 VVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGT 247

Query: 243 RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 302
            YW +PGA+  G          F G  S  + A+++  G+E+V + + E  +P K +P A
Sbjct: 248 EYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELPHA 295

Query: 303 IRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNA 362
           I++V  RI+ F++ SL  +G  VPY +  L    S V++SPF+I I+ +G RVLP I NA
Sbjct: 296 IKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLPSIINA 354

Query: 363 VILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYME 422
           VIL +I+S GNS ++  SR L SMA  GL P+        G P + ++  S FG L+++ 
Sbjct: 355 VILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLV 414

Query: 423 LSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAY 482
            S      F+WL+ I G+A    WL I+ SH+RF  A+K +  S D+L +K+    + + 
Sbjct: 415 KSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSI 474

Query: 483 YAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI- 534
           Y+    ++I++ Q + S  P             F   Y+   + +  +   +IYF+C   
Sbjct: 475 YSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTG 534

Query: 535 ----IWKLEDVDIDTDRREIESVVWEDD--------APKTLWDKFWDF 570
                  L ++D++TDR+ I+  + + +        A K  + +F++F
Sbjct: 535 KWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNF 582

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  257 bits (657), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 170/560 (30%), Positives = 289/560 (51%), Gaps = 33/560 (5%)

Query: 34  GELGRRKRKTSVSSTQYEDLATEKD---ELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXX 90
           G LGR      V S +  D+  + D   +++ +  +K++LK RH                
Sbjct: 69  GILGR-----VVDSYRRADIPGQDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLI 123

Query: 91  XXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGA 149
                L+NAGP   L+ Y  +    + + Q+ GE+A   P +  SF+ +  + +S   G 
Sbjct: 124 ANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGF 183

Query: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209
           A  +++F+ W   F +EL  +   ++FWT +V    ++ IF+V L   +   V+ YGE E
Sbjct: 184 ATTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETE 243

Query: 210 FWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGW 268
           F++   KVL ++GF+I+++C+  G AG +G IG +YW +PGA       S+T E RF G 
Sbjct: 244 FFLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWHDPGAF-----VSHTAEGRFKGV 298

Query: 269 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328
              L++A F+Y GTEL  ++  E  NPRK +P A +  + RI+  Y+ ++  +G TVP N
Sbjct: 299 CYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNN 358

Query: 329 DPKLTST----DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILF 384
            P+L  +    +   S SP+++       RVLPH  NAV++  ++S  NS +Y   R++ 
Sbjct: 359 HPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLIC 418

Query: 385 SMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFF 444
           S+A+ G  PK+      +G P  +++     G +++   S      F+WL  I G++  F
Sbjct: 419 SLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELF 478

Query: 445 AWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF-APH 503
            W  I  SHVRF  A+K +G   ++L YK+    W + Y +FF +++   Q + +  AP+
Sbjct: 479 TWSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPN 538

Query: 504 FSGR----DFVAAYISVGLFLVFWGFFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWE 556
             G+    DF  +Y+++ ++L F+  F ++ R    +  L  VD+D+ RR  + E +  E
Sbjct: 539 SGGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQE 598

Query: 557 DDAPK------TLWDKFWDF 570
           D+  K      ++W K   F
Sbjct: 599 DEEHKQAMKSASIWIKLHSF 618

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  258 bits (660), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/533 (30%), Positives = 279/533 (52%), Gaps = 14/533 (2%)

Query: 25  DSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXX 84
           + D+ +  + E+   +   S+S+   + +   +    +  ++K+++K RH          
Sbjct: 108 EKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISLGTGI 167

Query: 85  XXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFL 143
                      L  AGP G L+ +  MGT ++ + Q++GEMA  +  +   F+ +    +
Sbjct: 168 GTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPSFLV 227

Query: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFP-V 202
            PA G +  ++Y L W     LEL      I++WT KV    ++ IF+VL+ A N+    
Sbjct: 228 DPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINIVGGA 287

Query: 203 KFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KTGPIGFRYWRNPGAMGPGIISSNTG 261
             Y E EF   S K+L ++GF I  + I+CG     G IG +YW  PGA           
Sbjct: 288 AGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAF-----RGEHA 342

Query: 262 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFI 321
             RF G +++L+NAAF +  +E +G+TA E +NPRKA+P A +K+L RI+  ++ S+  +
Sbjct: 343 IDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLASITIV 402

Query: 322 GLTVPYN-DPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGS 380
           G  VPY+ D  L S+   V +SP+++ +   G +V+PH  NAVIL +++S  NS  Y  S
Sbjct: 403 GFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAFYSSS 462

Query: 381 RILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGV 440
           R+L S+A+ G APK       +G P + +   S FG +++   S    + F WLL I+G+
Sbjct: 463 RMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLAISGL 522

Query: 441 AGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF 500
           +  F W+ I  SHVRF +A+  +G S  +L +++    W + YA   MV I++ Q + + 
Sbjct: 523 SQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAI 582

Query: 501 AP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW-KLEDVDIDTDRR 548
           AP        ++F   Y+++ + L  +  ++IY +   I+ + +D+D+ + R 
Sbjct: 583 APIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRN 635

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  257 bits (657), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 163/558 (29%), Positives = 283/558 (50%), Gaps = 24/558 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELL 61
           E+G  +   K  I       +G +   H     EL       S +  +++   T K+E  
Sbjct: 68  ELGVKEPHLKRFIDSFKRAEEGTEETKHMET--ELTTTLSPLSAAIKEHDVAITSKEE-- 123

Query: 62  EHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQS 121
           + H +++S++ RH                     L  AGP G ++ Y  MGT ++ + Q+
Sbjct: 124 DAH-LRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 122 LGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180
            GEMA ++  +  +F+ +    +    G A  ++Y + W     LEL      I +WT K
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI-VCGAGKTGP 239
           V    ++ IF+VL+   N+F  K Y E +F+  + KVL + GF I ++ I   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299
           IG +YW +PGA        +    RF   +++   AAF +  +E + I A E +NPR+A+
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPH 358
           P A + ++ RIL  ++ S+  +G  VPY+  +L  + S    +SP+++ I + G RV+PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 359 IFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSL 418
             NAVIL  ++S  NS  Y   RILFS+++ G AP++      +G P  +++    FG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 419 SYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMP 478
           ++   S+   + F WLL I+G++  F W+ I  SH+RF +A+  +G S  +L +++    
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 479 WLAYYAIFFMVVIILIQGFTSFAP----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534
           W + YA   + + ++ + + S AP    H   + F   Y+++ + +VF+  ++IY R   
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNR--- 594

Query: 535 IWKL----EDVDIDTDRR 548
            WKL    +++D+ T R 
Sbjct: 595 DWKLFIRAKNIDLITHRN 612

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  255 bits (651), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 272/510 (53%), Gaps = 23/510 (4%)

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
           E  + +    + RSL  RH                     L   GP   L+ Y+ MG V+
Sbjct: 52  ESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVI 111

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
           +    SLGEM+TF+P++ S+  ++++F+S +   A     + S   + A +L+ +  ++ 
Sbjct: 112 YLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLD 171

Query: 176 FW---TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVC 232
           +W   T   P  A   +FW L+   N+  VK YGE E+W+A +KV+A++ F I ++   C
Sbjct: 172 YWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANC 231

Query: 233 GAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGE 291
           G  +    IGF+ W +  A  P +         F G+V+  + ++F+Y GTE V +T GE
Sbjct: 232 GHNQQHEYIGFKNWSHGDA--PFV-------QGFKGFVTIFVTSSFSYGGTETVTLTGGE 282

Query: 292 AANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNA 351
           A NP +  P+ I+ V  RIL+FY+ ++FF+G+ +PY+ P L +    V +SPF I  Q A
Sbjct: 283 AKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTIVFQMA 340

Query: 352 GTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP--KFLAKTTLQGVPYLSV 409
           GT+      NAVI+T+ ISA N  ++ GSRIL++M   G  P  +F  KT     PY++V
Sbjct: 341 GTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAV 400

Query: 410 LAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
           +   A G L +     G  + F+WL NI GV+   +WL I+   +RF + L+ +G    +
Sbjct: 401 ITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHE 459

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIY 529
           L ++    P+  ++ I F+ +IIL+QG+++F P +S   F + Y+ + +F   W F+ + 
Sbjct: 460 LKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWVI 518

Query: 530 FRCRIIWKLEDVDIDTDR---REIESVVWE 556
            R R   K +D+D  TD+    E ES++ E
Sbjct: 519 KRDRFK-KAKDMDFITDKYVQSEEESLLNE 547

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/517 (30%), Positives = 264/517 (51%), Gaps = 32/517 (6%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           +     +D   +  ++K++LK RH                     LA  GP+  ++ +  
Sbjct: 71  DSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAI 130

Query: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170
            G+ +      LGE+    PV  +F+ ++ RFL P++      +Y + W F   LE+   
Sbjct: 131 AGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISS 190

Query: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230
              +Q+W   +    W++IF+V + + N+F V+ +GE EF  ++IKV+ + GF++  LCI
Sbjct: 191 AMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFIL--LCI 248

Query: 231 VCGAGKTGP----IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVG 286
           +  AG  GP    +G RYW NPG +  G          F G +S ++ A+++  GTE+  
Sbjct: 249 ILIAGG-GPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTC 297

Query: 287 ITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFII 346
           + +GE  +P K +P AI++V  RIL F++ SL  +G  VPY +  L    S V +SPF+I
Sbjct: 298 LASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVI 354

Query: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406
            I+    +VLP I NAVIL +I+S GNS ++  SR L SMA   L P +       G P 
Sbjct: 355 AIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPL 414

Query: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466
           + ++  S FG L+++  S   ++ F+WL+ I G+A    WL I+ SH+RF  A+K +G S
Sbjct: 415 VGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRS 474

Query: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-------HFSGRDFVAAYISVGLF 519
            ++L + +    W + Y+     +I++ Q + S  P           + F  +Y+   + 
Sbjct: 475 LNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIM 534

Query: 520 LVFWGFFQIYF--RCRIIWK---LEDVDIDTDRREIE 551
           +  W   +IY+  +   IW    L ++D+D  R+ I+
Sbjct: 535 VCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNID 571

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  254 bits (649), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 172/580 (29%), Positives = 290/580 (50%), Gaps = 29/580 (5%)

Query: 5   PSDLKEKS-VIQDIDTIIDGNDSDSHNSNTGELG---------RRKRKTSVSSTQYEDLA 54
           P + K  S    +  +I+  N  +S   N+   G         +R   + + + + ED+ 
Sbjct: 6   PKETKSPSYASSEHSSIVSANSYNSSAGNSKTRGYFRNFIDSYKRADPSQLHNARSEDVE 65

Query: 55  TEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTV 114
                +      K+SL  RH                     L   GP   ++ Y+ +  V
Sbjct: 66  DGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFV 125

Query: 115 VFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQI 173
            + + Q+ GEMA   P +  +F+ +   F+S + G A  +++ + W     LEL      
Sbjct: 126 TYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLT 185

Query: 174 IQFWTFKVPLAAWISIFWVLLTAFNMFP-VKFYGEFEFWIASIKVLALMGFLIYSLCI-V 231
           I++W  K+    ++ IF+V L A ++   ++ YGE EF   S K+L ++GF+I S+ I  
Sbjct: 186 IKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINA 245

Query: 232 CGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGE 291
            GAG  G IG +YW  PG+   G  +S     RF G    L++  F+Y GTEL  ++  E
Sbjct: 246 GGAGNDGYIGGKYWHEPGSFAEGDATS-----RFKGICLVLVSGYFSYGGTELYVLSVNE 300

Query: 292 AANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD-SYVSSSPFIITIQN 350
            A PRKA P A +K + RIL+ Y+ ++  IG  VP+N+ +L     S   +SP+++    
Sbjct: 301 QAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAATI 360

Query: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410
            G +++PH  NAVIL ++IS  NS+++ G R+L S+A  G APK L+    +G P L  L
Sbjct: 361 HGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRP-LVAL 419

Query: 411 AIS-AFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDD 469
            IS   G ++++  ++   + F WL  I G++  F W  I  SHVRF  A+K +G   ++
Sbjct: 420 GISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINE 479

Query: 470 LPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG-----RDFVAAYISVGLFLVFWG 524
           L YKA    W + Y  FF V++++ Q + + AP  +G       F  +Y++  +++  + 
Sbjct: 480 LGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYF 539

Query: 525 FFQIYFR-CRIIWKLEDVDIDTDRR--EIESVVWEDDAPK 561
            + IY +   ++  L+ +D+D+ RR  + E +  ED+  K
Sbjct: 540 GYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENK 579

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  255 bits (651), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 157/548 (28%), Positives = 275/548 (50%), Gaps = 29/548 (5%)

Query: 19  TIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYED-----LATEKDELLE---HHDVKRSL 70
           TI +  + +     + +   RK K      ++ D     L ++++  LE    +++++S+
Sbjct: 35  TITEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLPSDQNSELESQEKNNLRKSI 94

Query: 71  KQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFI 129
           K RH                     L  AGP G ++ Y     +++ + Q+ GE+   + 
Sbjct: 95  KSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYA 154

Query: 130 PVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISI 189
            +T +++ ++   + P+LG A   +Y + W     L+L      +++WT  V    ++++
Sbjct: 155 GLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-NVNADIFVAV 213

Query: 190 FWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPIGFRYWRNP 248
            ++ +   N+F  + Y E EF     K+L + GF+I ++ I CG AG    IG  YW NP
Sbjct: 214 VFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRYIGTEYWHNP 273

Query: 249 GAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLI 308
           G    G          F G  +    AAF+Y G E++ ++A E  NP +++P A +KV+ 
Sbjct: 274 GPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESIPNACKKVVY 323

Query: 309 RILLFYIGSLFFIGLTVPYNDPKL--TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILT 366
           RILL Y+ +   IG  VPYN  +L  + + S   +SPF+I + + G +V+PH  NAVIL 
Sbjct: 324 RILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVPHFINAVILI 383

Query: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426
           ++IS  NS++Y G R+L S+A+ G+ PK LA     G P L  L   AFG + ++  S  
Sbjct: 384 SVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGCIGFVATSNA 443

Query: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486
             + F WLL I+ ++  F W+ +  SH+RF  A+  +G S D++ YKA    W ++ A+ 
Sbjct: 444 EEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVL 503

Query: 487 FMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIW-KLED 540
             V  ++ Q + + AP         + F   Y+++ + L+ +   ++YF+    W   E 
Sbjct: 504 IAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWIPAEK 563

Query: 541 VDIDTDRR 548
           +D+D+ R 
Sbjct: 564 IDLDSHRN 571

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 270/519 (52%), Gaps = 13/519 (2%)

Query: 48  TQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVA 107
           + Y       + +++  ++KR + QRH                     L +AGP G L+ 
Sbjct: 99  SNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIG 158

Query: 108 YLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALE 166
           Y  MGT V+ V Q+ GE+  T+  +   F+ +    ++P+   + G++Y L W     LE
Sbjct: 159 YALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLE 218

Query: 167 LSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIY 226
           L      I++WT KV    ++ IF++L+   N F  K Y E +F+   +K+  + GF I 
Sbjct: 219 LVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFIL 278

Query: 227 SLCIVCG-AGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELV 285
            + + CG AG  G +G +YW NPGA              F G  S  + +AF + G+E V
Sbjct: 279 GIVVACGGAGHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFV 333

Query: 286 GITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFI 345
            ++A E ANPRK++P A + +L RI+  Y+ S+  +G  VP++ P+L  +     +SP++
Sbjct: 334 ALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYV 393

Query: 346 ITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVP 405
           + I   G +V+PH+ NAVIL  ++S  NS  +  SR+L S+++ G APK+      +G P
Sbjct: 394 VAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRP 453

Query: 406 YLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGI 465
             ++L  + FG + +   S      F+WLL I+G++  F +  I  SH+R   A+K +G 
Sbjct: 454 VRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGR 513

Query: 466 SRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGR----DFVAAYISVGLFLV 521
           S  +L +++    + ++YA   +V+ ++ + + + AP   G+     F   Y++  + +V
Sbjct: 514 SLGELGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIV 573

Query: 522 FWGFFQIYFR-CRIIWKLEDVDIDTDRREI-ESVVWEDD 558
           F+  + I+ +  RI  + +D+D+D  R+   E ++ ++D
Sbjct: 574 FYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQED 612

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  252 bits (644), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 174/513 (33%), Positives = 272/513 (53%), Gaps = 29/513 (5%)

Query: 44  SVSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVG 103
           S+SS   +  A  +  + E  ++ RSL  RH                     LAN GP  
Sbjct: 19  SLSSDTQDAGALNRGHVRE--NLNRSLTPRHINMISIAGVIGTGLYLGTGKALANGGPAS 76

Query: 104 ALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTF 163
            L+ Y  +G VV+ +   LGEM+TF+P++ SF  +A++F S +L       Y+ +   + 
Sbjct: 77  LLINYGIIGLVVYLIMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSV 136

Query: 164 ALELSVVGQIIQFW---TFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLAL 220
           A +L+ +  I+ +W       P  A   IFW  L   N+  V+ YGE E+W+A +KV+A+
Sbjct: 137 ASDLTALQLILDYWKNPNSHFPYWAASLIFWFALLLLNVVHVRVYGEAEYWLALLKVIAI 196

Query: 221 MGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFL----GWVSSLINA 275
           + F I S+ +  G       IGF+ W               G+A F+    G+ S  +++
Sbjct: 197 IMFFIISIIVNAGHNSDHAYIGFKNW-------------GVGDAPFVNGFKGFASLFVSS 243

Query: 276 AFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTST 335
           +F + GTE + +TAGEA NP +  P+ I+ V  RIL+FY+ + FFIG+ VPYN P L  +
Sbjct: 244 SFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIFYVFTAFFIGMNVPYNYPNL--S 301

Query: 336 DSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNG-LAPK 394
           +  V +SPF I  Q  G+R      NAVILT++ISAGN  ++ GSR+LF++   G   P 
Sbjct: 302 EKSVMTSPFTIVFQMVGSRGAGSFMNAVILTSVISAGNHALFAGSRVLFNIGLEGYFFPS 361

Query: 395 FLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHV 454
           F+ KT    VPY++VL   A G L +     G    + WL NI GV+   AWL IS   +
Sbjct: 362 FITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWTWLQNIVGVSNQLAWLCISVISI 421

Query: 455 RFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYI 514
           RF + L  +G +  +L +     P+  Y+ + F+  II +QG++SFAP +S  DF + YI
Sbjct: 422 RFRRGLARQGKTH-ELQFVNWTYPYGPYFLVVFVTFIIFVQGWSSFAP-WSVSDFFSYYI 479

Query: 515 SVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
            + +F+  + F+ ++ R   + K +++D  TD+
Sbjct: 480 ELIVFVALYAFWWLWKRDSFV-KSDEMDFVTDK 511

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  253 bits (645), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 159/508 (31%), Positives = 260/508 (51%), Gaps = 21/508 (4%)

Query: 51  EDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLF 110
           E L++E  E      +++S+K RH                     +A AG  G L+ YL 
Sbjct: 13  EKLSSEGSE---PASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLI 69

Query: 111 MGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSV 169
           +G +V    QS+GE+    P +   F+ + ++F+ P+LG    +++ L W     LEL  
Sbjct: 70  IGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVT 129

Query: 170 VGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLC 229
               I++W   +  + ++S F++L+   N F    Y E EF    +KV+ L  F++  + 
Sbjct: 130 ASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIV 189

Query: 230 IVCGA-GKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGIT 288
           I+ G  G +GPIGF+Y + PGA        NT    F     +L+NAAF+  G E + ++
Sbjct: 190 IITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALS 242

Query: 289 AGEAA--NPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS-SSPFI 345
           A E    N  K++ RA R+V IR+ +FY+ S+  +GL VPY+ P L  + S  + +SP++
Sbjct: 243 AAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYV 302

Query: 346 ITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVP 405
             I   G R++PHI NAVIL  ++S  NS +Y  SR L S+A+   AP++ A     G P
Sbjct: 303 AAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQP 362

Query: 406 YLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGI 465
              ++  +  G +S++         F WLL+I+G++  F W  I  +H+RF  ALK +G 
Sbjct: 363 MRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQ 422

Query: 466 SRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAP-HFSGR----DFVAAYISVGLFL 520
           S D L Y++      +Y A    VV+I++Q + S  P   +G+     F   Y++V + +
Sbjct: 423 SLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAV 482

Query: 521 VFWGFFQIYFRCRIIW-KLEDVDIDTDR 547
           + +   ++Y      W +   VDI+TDR
Sbjct: 483 LLYLGHKLYTNDWTPWIRTHCVDINTDR 510

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  253 bits (645), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 166/511 (32%), Positives = 268/511 (52%), Gaps = 26/511 (5%)

Query: 45  VSSTQYEDLATEKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGA 104
           V S +  + A+   E     D+KR L  RH                     L   GP   
Sbjct: 47  VHSLESIESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASL 106

Query: 105 LVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFA 164
            + Y   G VV+     LGEM+T++P++ SF  +A++F S +   A  + Y+ +   + A
Sbjct: 107 FMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVA 166

Query: 165 LELSVVGQIIQFWTFK---VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALM 221
            +L+ +  ++ +W  K    P  A   +FWV +   N+  V+ YGE E+W+A +KV+A++
Sbjct: 167 SDLTALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAII 226

Query: 222 GFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFL----GWVSSLINAA 276
            F I S+ +  G       IGF  W             N G+A F+    G+ S  ++A+
Sbjct: 227 IFFILSIVVNVGHNPEHKYIGFHNW-------------NHGDAPFVNGFKGFASLFVSAS 273

Query: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336
           F Y GTE + +T GEA NP +  P+ I+ V  RIL+FY+ S FFI + VPY+ P L +  
Sbjct: 274 FAYGGTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS 333

Query: 337 SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFL 396
             V +SPF I  Q AG++      NAVI+T++ISA N  ++ GSR++++M+ +G  PK++
Sbjct: 334 --VMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWV 391

Query: 397 AKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRF 456
            KT     PY++V    A G L +     G    + WL NI GV+   AWL I+ + +RF
Sbjct: 392 TKTNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRF 451

Query: 457 MQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISV 516
            + L+ +G +  +L +K    PW  Y+ + F+  +ILIQG+++F P +S  +F + Y+ +
Sbjct: 452 RRGLELQGKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLEL 509

Query: 517 GLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547
            +F   +  + +Y R + I K ED+D  TD+
Sbjct: 510 FVFPACYLIWWLYKRDKFI-KYEDMDFVTDK 539

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  253 bits (645), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 267/540 (49%), Gaps = 31/540 (5%)

Query: 26  SDSHNSNTGELGRRKRKTSVSS------TQYEDLATEKDELLEHHDVKRSLKQRHXXXXX 79
           + S  SN G    + +   V+S       +  D +T  DE    +D+ ++++ RH     
Sbjct: 42  ASSSASNEGPATPQPQLGVVASFLDSFKRKEHDDSTAGDE----NDLNKAIRSRHLIMIS 97

Query: 80  XXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TFIPVTSSFSVF 138
                           L+ +GP+G ++ Y+    +VF + Q+ GE+   +  V  +F+ +
Sbjct: 98  LGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRY 157

Query: 139 AQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFN 198
               + PA G A  ++Y + W     L+L      IQFW   V L  ++   +V++   N
Sbjct: 158 PTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDVFVLASFVVVVLIN 217

Query: 199 MFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP---IGFRYWRNPGAMGPGI 255
           +   + Y E EF+    K++ L GF+I  + I  G    GP   IG +YWRNPG    G 
Sbjct: 218 LGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNPGLFANG- 276

Query: 256 ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI 315
                    F G  S    AAF+Y G E + ++A E  NP K++P A +KV+ RIL  Y+
Sbjct: 277 ---------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYL 327

Query: 316 GSLFFIGLTVPYNDPKL-TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNS 374
            SL  +   VPY  P L  S+ S   SSPF+I I + G  V+PH+ NAVIL +++S  NS
Sbjct: 328 LSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVPHLINAVILISVLSVANS 387

Query: 375 NVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWL 434
            +YV  R+L S+A+ G APKFL     +G P    L +  FG + ++  S      F WL
Sbjct: 388 ALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWL 447

Query: 435 LNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILI 494
           L+I+G+   F W+ I  SH+RF  A++ +G    ++ YKA    W +Y AI   + +++ 
Sbjct: 448 LSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVC 507

Query: 495 QGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDVDIDTDRR 548
           Q + + AP          +F   Y++  + L  +  F++Y++  +++   + +++D +R 
Sbjct: 508 QFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRN 567

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  248 bits (634), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 237/478 (49%), Gaps = 20/478 (4%)

Query: 2   EIGPSDLKEKSVIQDIDTIIDGND---SDSHNSNTGEL-GRRKRKTSVSSTQ--YEDLAT 55
           E  PS   +K +   ++    G +   SD     T E  G R+R T+ +  Q   +    
Sbjct: 3   EASPSKYYDKGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKP 62

Query: 56  EKDELLEHHDVKRSLKQRHXXXXXXXXXXXXXXXXXXXXPLANAGPVGALVAYLFMGTVV 115
            +D      ++K+SLK RH                     LA  GP+  ++ +   GT +
Sbjct: 63  PEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQM 122

Query: 116 FSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQ 175
                 LGE+    PV  +F+ +  RFL P++      +Y L WCF   LE+      ++
Sbjct: 123 VGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVE 182

Query: 176 FWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG 235
           +W   V    W++IF+ ++   N+  V+ +GE EF  + IKV+ ++GF+I  + ++CG G
Sbjct: 183 YWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGG 242

Query: 236 -KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 294
            K   +G +YW +PG +  G          F G    L+ A+++  GTE+  + +GE  +
Sbjct: 243 PKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-D 291

Query: 295 PRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTR 354
           P K +P AI++V  RI+ F++ SL  +G  VPY +  L    S V +SPF+I I+  G  
Sbjct: 292 P-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGIN 349

Query: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414
            LP I NAVIL +++S GNS ++  SR L SMA  GL P+        G P   +L    
Sbjct: 350 ALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLL 409

Query: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPY 472
           FG L+++  S      F WL+ I G+A    WL I+ SH+RF  A+K +G+  ++L +
Sbjct: 410 FGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,625,681
Number of extensions: 2289008
Number of successful extensions: 10790
Number of sequences better than 10.0: 410
Number of HSP's gapped: 9631
Number of HSP's successfully gapped: 428
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)