Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J05214g1.319ON71671637370.0
Smik_10.1791.319ON7137099081e-111
Suva_6.1371.319ON7187058921e-109
YJL061W (NUP82)1.319ON7136998771e-107
ZYRO0G20680g1.319ON6926958601e-104
NCAS0A092101.319ON7107008236e-99
TDEL0D018801.319ON6917028158e-98
Skud_10.1581.319ON7167148062e-96
NDAI0G057501.319ON7347307909e-94
TBLA0F013101.319ON7427217872e-93
KNAG0C058401.319ON7477217435e-87
KAFR0A017201.319ON7166747269e-85
SAKL0D06930g1.319ON6906836933e-80
Kpol_1035.241.319ON7177146393e-72
TPHA0O014601.319ON7217206297e-71
Kwal_14.25801.319ON6877166261e-70
KLTH0H10692g1.319ON6917116144e-69
Ecym_62901.319ON6716775564e-61
AEL168C1.319ON6737014677e-49
KLLA0F01661g1.319ON6876974211e-42
Kwal_27.115688.431ON65980910.026
TPHA0B015307.440ON105367810.50
ADL357C8.865ON1177108752.7
NCAS0A04510na 1ON237136714.0
Skud_14.3726.357ON60582707.5
SAKL0C11330g3.211ON2489927010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J05214g
         (716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...  1444   0.0  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   354   e-111
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   348   e-109
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   342   e-107
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   335   e-104
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   321   6e-99
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   318   8e-98
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   315   2e-96
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   308   9e-94
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   307   2e-93
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   290   5e-87
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   284   9e-85
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   271   3e-80
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   250   3e-72
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   246   7e-71
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   245   1e-70
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   241   4e-69
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   218   4e-61
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   184   7e-49
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   166   1e-42
Kwal_27.11568 s27 (852845..854824) [1980 bp, 659 aa] {ON} YDR221...    40   0.026
TPHA0B01530 Chr2 complement(340332..343493) [3162 bp, 1053 aa] {...    36   0.50 
ADL357C Chr4 complement(77471..81004) [3534 bp, 1177 aa] {ON} Sy...    33   2.7  
NCAS0A04510 Chr1 complement(907090..907803) [714 bp, 237 aa] {ON}      32   4.0  
Skud_14.372 Chr14 complement(665776..667593) [1818 bp, 605 aa] {...    32   7.5  
SAKL0C11330g Chr3 complement(1015136..1022605) [7470 bp, 2489 aa...    32   10.0 

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score = 1444 bits (3737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/716 (98%), Positives = 704/716 (98%)

Query: 1   MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFE 60
           MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFE
Sbjct: 1   MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFE 60

Query: 61  GKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVL 120
           GKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVL
Sbjct: 61  GKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVL 120

Query: 121 FHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQ 180
           FHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQ
Sbjct: 121 FHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQ 180

Query: 181 DGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNI 240
           DGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNI
Sbjct: 181 DGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNI 240

Query: 241 VKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXX 300
           VKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMA       
Sbjct: 241 VKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQ 300

Query: 301 XXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI 360
                SLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI
Sbjct: 301 ITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI 360

Query: 361 PGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK 420
           PGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK
Sbjct: 361 PGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK 420

Query: 421 SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLY 480
           SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLY
Sbjct: 421 SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLY 480

Query: 481 EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK 540
           EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK
Sbjct: 481 EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK 540

Query: 541 MISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQK 600
           MISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQK
Sbjct: 541 MISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQK 600

Query: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660
           LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF
Sbjct: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660

Query: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI 716
           IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI
Sbjct: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI 716

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  354 bits (908), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 231/709 (32%), Positives = 387/709 (54%), Gaps = 49/709 (6%)

Query: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRW-------CHSTSTTYKSLDFDLQFEGKVE 64
           + + + + R++F+S +GT+IV I D   +RW       C+ + +  + L  D  F     
Sbjct: 16  SLSASQSPRYIFTSQNGTRIVFIQD-NIIRWYNVLTDPCYHSLSLSRHLVLDDTFH---- 70

Query: 65  GAVSSTTADYVCIYNRDELHVLEVPWMYSGEEN-GLKHLCHIYSHKFDENHS-----IKQ 118
             +SST+ D +C +N  E+ V+EVPW YS  EN  ++    ++ +  DE        IK+
Sbjct: 71  -VISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129

Query: 119 VLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIF 178
           VLFHPKSY DS I+VL  +D+I M +   N+ +K +I LN  N++ GL  R+NDI  ++F
Sbjct: 130 VLFHPKSYHDSCIVVLKENDTIIMFDIL-NQQEKPII-LNKPNNSFGLDARLNDITDLVF 187

Query: 179 SQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKR 238
           S+DGL+L  L+  EG DIF  YP LP    ++ +++  +  KSL++Y +++  T    KR
Sbjct: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247

Query: 239 NIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXX 298
           NI+KQL F+ K+     +  N    + ++  Y   + QGPF++ P+PNELYD+ A     
Sbjct: 248 NIIKQLQFVSKLHENWDSKLNK---VDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIAT 304

Query: 299 XXXXXXXS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKF 357
                  + +  I+F +G+++L L DLE  MSWD+  +  ++SL L+E++K++  +    
Sbjct: 305 ISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQ-KEIESL 363

Query: 358 LSIPGTYGKFVVTDNVKSNFF--VNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQL 415
           +++P   GK  V      NF   VN+  W++ +++ I++SD+  L +LK +S IEN+  +
Sbjct: 364 ITLPEQMGKLYV---FSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420

Query: 416 -ATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPE 474
                 + IYW N   + N  ++  K  EL        T +   +DQ     E++ D+  
Sbjct: 421 EGMPNLAHIYWNN---TSNLALASNK--EL--------TFQTVSVDQKMQSTETETDIGT 467

Query: 475 LKNGL----YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLES 530
            ++GL    YE++F +PL+EI    + + +   +     IP   R  PLKN ++ENQLE 
Sbjct: 468 EESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEI 527

Query: 531 LTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTK 590
            T +S+ +++ I+ AQ+LG     R+ +   E +RQ+++T +I     +  +  E QN K
Sbjct: 528 FTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKK 587

Query: 591 IDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRK 650
            D    +Q KLMER S L + +    +       NIS AE EWF EI+  +++FN YV  
Sbjct: 588 WDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHS 647

Query: 651 ASTNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699
             +  Q+L ++K +  +I  +   +  ++  EWN+L+++L  D KII E
Sbjct: 648 QKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKE 696

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  348 bits (892), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 229/705 (32%), Positives = 380/705 (53%), Gaps = 36/705 (5%)

Query: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS-TSTTYKSLDFDLQFE-GKVEGAVSS 69
           + + N + R++FSS +GT++V I D   +RWC   T  +Y SL+F           A+SS
Sbjct: 16  SLSANQSPRYIFSSHNGTRLVVIQD-DIIRWCSLLTDPSYHSLNFSRHLVLDDTFHAISS 74

Query: 70  TTADYVCIYNRDELHVLEVPWMYSG-EENGLKHLCHIYSHKFDE-----NHSIKQVLFHP 123
            + D +C Y+  E+ V+E+PW Y    +  ++    ++ +  DE     N  IK+VLFHP
Sbjct: 75  ASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNSPIKKVLFHP 134

Query: 124 KSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGL 183
           KSY DS I+VL NDD+I M +   N+ +  +I LN +NS+ GL  R+NDI    FS+DGL
Sbjct: 135 KSYNDSCIVVLKNDDTITMFDIL-NQQEAPII-LNKRNSSFGLDARVNDITDFAFSKDGL 192

Query: 184 SLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQ 243
           +L  L+  EG DIF  YP LP    +S  ++  +  KSL++Y ++N  T  + KRNI KQ
Sbjct: 193 TLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDYKVKRNITKQ 252

Query: 244 LNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXX 303
           L F+ K+      + +    + ++D Y   + QGPF++ P+PNELYDF A          
Sbjct: 253 LQFVSKLHKN---WDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTASKITTIPIDN 309

Query: 304 XXS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPG 362
             + ++ ++F +G++++   DLE  MSWD+  +  +NSL L+E+IKL+  +     ++P 
Sbjct: 310 QQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKEMKSLTALPD 369

Query: 363 TYGKFVVTDNVKSNFFVNTC-DWSTILAQIIDDSDIKLLANLKVKSNIENL---QQLATT 418
             GK  VT  ++S+     C  W+++L++ ID+SD+  LA++K  S  E++    QL+  
Sbjct: 370 QLGKLYVT--LESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIATIHQLSNF 427

Query: 419 FKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNG 478
             + I W ++  S   +IS +K+        I + + HK     N+  E   ++   K+ 
Sbjct: 428 --AYINWNDK--SSLALISKEKL-------TIQNISNHKKEQSLNAPAELDTNVNSDKSD 476

Query: 479 L----YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKI 534
                YE+ F +P+ EI    + + K   +     IP   R  PLKN +NENQLE  T I
Sbjct: 477 TGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDI 536

Query: 535 SESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKV 594
           S+ +++ I  AQ+LG     R+ +   E +RQ+++T +I    +  ++  E Q  K +  
Sbjct: 537 SKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQ 596

Query: 595 KEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTN 654
             +Q +LM R   L + +    E       NIS  E EWF EI+  +++FN +V    + 
Sbjct: 597 SSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSI 656

Query: 655 HQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699
            Q+L ++K +  +I ++  +   ++  EW++L+++L  D KII E
Sbjct: 657 QQDLSYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKE 701

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  342 bits (877), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 229/699 (32%), Positives = 382/699 (54%), Gaps = 29/699 (4%)

Query: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS-TSTTYKSLDFDLQFE-GKVEGAVSS 69
           + + + + R++FSS +GT+IV I D   +RW +  T + Y SL+F            +SS
Sbjct: 16  SLSASQSPRYIFSSQNGTRIVFIQD-NIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISS 74

Query: 70  TTADYVCIYNRDELHVLEVPWMYSGEEN-GLKHLCHIYSHKFDENH-----SIKQVLFHP 123
           T+ D +C++N +E+ V+EVPW YS  E+  ++    I+ +  DE       SIK+VLFHP
Sbjct: 75  TSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHP 134

Query: 124 KSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGL 183
           KSY DS I+VL  DD+I M   D   S +  I LN  N++ GL  R+NDI  + FS+DGL
Sbjct: 135 KSYRDSCIVVLKEDDTITMF--DILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGL 192

Query: 184 SLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQ 243
           +L  L+  EG DIF  YP LP    ++  +++ +  KSL++Y +++  T    KRN++KQ
Sbjct: 193 TLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQ 252

Query: 244 LNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXX 303
           L F+ K+      + +    + ++  Y  A+ QGPF++ P+P ELYD+ A          
Sbjct: 253 LQFVSKLHEN---WNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDN 309

Query: 304 XXS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPG 362
             + ++ ++F +G+++L   DLE  MSWD+  +  +NSL L+E++KL+  +    +++P 
Sbjct: 310 GQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQ-REIKSLITLPE 368

Query: 363 TYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK- 420
             GK +V++DN+     VN   W++ L++ I++SD+  LA LK +S +E++  +      
Sbjct: 369 QLGKLYVISDNIIQQ--VNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNL 426

Query: 421 SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLY 480
           + I W ++  S   ++S+K +        ISS  K +      S    K D   + +G +
Sbjct: 427 AYINWNDQ--SNLALMSNKTL----TFQNISSDMKPQSTAAETSISTEKSD--TVGDG-F 477

Query: 481 EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK 540
           ++ F +P+ EI      + K   +     IP   R  PLKN ++ENQLE  T IS+ +++
Sbjct: 478 KMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQ 537

Query: 541 MISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQK 600
            I  AQTLG     R+ +   E +RQ+++T +I    D+  +  E QN K D    +Q +
Sbjct: 538 RIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSE 597

Query: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660
           LMER S L  K+    E        IS  E +WF EI+  +++FNS+V    +  Q+L +
Sbjct: 598 LMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSY 657

Query: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699
           +K +  +I  +   +  ++  EW++L+++L  D KII E
Sbjct: 658 LKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKE 696

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  335 bits (860), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 213/695 (30%), Positives = 355/695 (51%), Gaps = 39/695 (5%)

Query: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTAD 73
              +++RFL +S DG+K+V   D   +RWC++  + Y+ +  +   E  VE  V S T  
Sbjct: 12  ASGSSKRFLCTSQDGSKVVIYQD-SSIRWCNAFDSKYEFMLLEPTIED-VEHVVLSPTGT 69

Query: 74  YVCIYNRDELHVLEVPWMYSG-EENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTIL 132
            + +YN  E+ ++E+PW YS     G +     YS    ++  IK+VLFHP +Y +  I+
Sbjct: 70  LLLLYNSREVRIVEIPWGYSQVSYEGFQKF--RYSVDSRQDPLIKKVLFHPLAYREHCIV 127

Query: 133 VLTNDDSIFMINT--DDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSA 190
           +L  D++I +++     ++  K ++ LN  + A G+   + DI+ I FSQDGL+L  LS 
Sbjct: 128 ILKTDNTIHLLDRYYPYDKQPKLLV-LNQHDGAFGMEGLVTDIESITFSQDGLTLYALSV 186

Query: 191 EEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKI 250
            EGCDI+  YPCLP   +I  H++D L  KSL+ Y N++V T    KRN +KQ  F+ K+
Sbjct: 187 AEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQFISKL 246

Query: 251 RGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXSLLAI 310
           R       ND+  + +   +L  + QGPF++ P+P+  YD  A             LL +
Sbjct: 247 R---QGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPIGANNDLLLM 303

Query: 311 AFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVT 370
           +F +GT+++   DLE  M WD   +  +NSL L+E I+LE     + +   GT  +F V 
Sbjct: 304 SFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLE---RGELVLKQGTLSQFFVL 360

Query: 371 DNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENI 430
                 + V+T  WS IL+  ID+SD++ +A+L+ KS I  ++ ++    S   WK +  
Sbjct: 361 GGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQ-IDSYAMWKKDTE 419

Query: 431 SCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTE 490
             +  +S   +        + ST  +        + ++ +D+P      YEV   +P++E
Sbjct: 420 PKDVFVSKDTV-------FVKSTAVNDQPSTVKDEKKANVDIPR-----YEVALNQPMSE 467

Query: 491 IQHYEQIYYKNLQNQNFTKIPLEI------RSAPLKNSSNENQLESLTKISESYMKMISM 544
           I         N   Q   K PL        R   L N SNE QLE LT +S+ +++ I  
Sbjct: 468 ILSL------NASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVK 521

Query: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMER 604
           AQ LG+    R ++   E +RQ++ + +I    D      + Q+++ +   ++Q KL++R
Sbjct: 522 AQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQR 581

Query: 605 LSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQ 664
            +SL +K+    E       NI+  E  WF EI+  V+ FN YV        +L +++++
Sbjct: 582 FNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKE 641

Query: 665 QAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699
              I+ +  D+  ++  EW +L  +L +D KII E
Sbjct: 642 LENISLEDKDVGEKSKSEWTELLSILESDTKIIKE 676

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  321 bits (823), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 209/700 (29%), Positives = 363/700 (51%), Gaps = 26/700 (3%)

Query: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDL-QFEGKV-EGAVSSTT 71
           T +AA RFLF+S  GT++V +   G LRWC  T++++ S+  D  Q E    + A+ S +
Sbjct: 19  TQDAAPRFLFTSHHGTRMV-VLQGGLLRWCSVTASSFNSMTIDFFQPESTAPQKAILSNS 77

Query: 72  ADYVCIYNRDELHVLEVPWMYSGEENGL--KHLCHIYSHKFDENHS-IKQVLFHPKSYLD 128
            +++C+Y    + V+E+PW Y      +  K     Y++K D+ +S IKQVLFHP++Y D
Sbjct: 78  GEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQVLFHPEAYKD 137

Query: 129 STILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLIL 188
           S ++VL ++ +I ++   D       I LN + +  G+  +I DI+ I FS+DG +L  L
Sbjct: 138 SCLVVLYDNGTISLM---DVTQITKTITLNKRVATFGIDTQITDIESICFSKDGWTLYAL 194

Query: 189 SAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFME 248
           S  +G DI+  YPCLP++ ++   ++ +L  +S+LLY ++ ++T    KRN+++Q+ F+ 
Sbjct: 195 SISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRNVIRQVQFVN 254

Query: 249 KIRGQKTA-FRNDKKPLI-LEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXS 306
           K+ G  T   +N  +  I +E  Y   + QGPF++ PYP  LY   A             
Sbjct: 255 KLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFTIDPYPERLYSATALEISTLPINSNNE 314

Query: 307 LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGK 366
           L+ + F +G++ L   DL   MSWD+  +  +NS +L+E ++L+ TD  + +S P TYG+
Sbjct: 315 LMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTDVKRIVSYPDTYGQ 374

Query: 367 FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQL-ATTFKSIIYW 425
           F +  +  S F V+T  WS +LA+ ID+S++  L  +   S ++  +     T  S   W
Sbjct: 375 FFIFGD-SSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFETTNGITKCSPCKW 433

Query: 426 KNENISCNYIISDKKIEELDML-DGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKF 484
           +  ++       D  +  ++M   GI    K  L++             ELK+  Y+  F
Sbjct: 434 RGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNE-----------ELKHQEYKTSF 482

Query: 485 ARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISM 544
            +P+ E+    +++ +         I  E R   L N +NE QLE L+ +S+  +  I  
Sbjct: 483 KQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEVISKIGQ 542

Query: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMER 604
            Q L      R+++   E +RQ++  + I     +  +  E Q+ + D    +  +L++R
Sbjct: 543 GQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKR 602

Query: 605 LSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQ 664
           L  L  K+        +    I+  E EWF EI+  V++FNS+V       +EL  +K+ 
Sbjct: 603 LQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRDAQEELNHLKKD 662

Query: 665 QAQIANQKPDISSENG-KEWNDLQQLLRTDLKIISEFEKK 703
            A+I+ +   +  E   KEW++L+ +L+ D +II E  K+
Sbjct: 663 LARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKE 702

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  318 bits (815), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 205/702 (29%), Positives = 357/702 (50%), Gaps = 37/702 (5%)

Query: 16  NAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYV 75
           + + RF  ++SDG + V + D   +RWC+ +   Y S+  +  F+  V+  V S + +++
Sbjct: 17  SGSDRFFLTTSDGGRAVVVQDSC-IRWCNVSEPGYHSMTLERAFK-DVKHVVMSNSGEFL 74

Query: 76  CIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLT 135
           C+YN DEL ++EVPW Y+ E + + +   ++    DE   IKQVLFHP +Y   T+++L 
Sbjct: 75  CLYNDDELRIIEVPWAYT-EVSSMANAFQLFRFVSDEAR-IKQVLFHPLAYQQETVVILK 132

Query: 136 NDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCD 195
           +DDSI ++N  D    K  + LN  N    L   I D++ I FSQDGL+L +LS  EG D
Sbjct: 133 DDDSITIMNWQDFGDSKPDV-LNLSNGTYSLDSSITDVECITFSQDGLTLYVLSVSEGAD 191

Query: 196 IFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKT 255
           I+  YPCL  R       +D L  KSL+ Y+ +NV T  + KRN +KQL F+  +  Q+ 
Sbjct: 192 IYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIKQLKFVSGLHKQQ- 250

Query: 256 AFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXSLLAIAFSNG 315
              N ++ L + +A    + QGPF++ P+P ++Y                 LL ++  +G
Sbjct: 251 ---NSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLPINDQNELLIMSLDDG 307

Query: 316 TVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKS 375
            + + L DL+  M+WD +R+  +NS AL+E I L   +  + +     YG+F V    + 
Sbjct: 308 NIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVGDHKYGQFSVM-TPEG 366

Query: 376 NFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYI 435
            F ++T  WS ++A  + +SD++ LA  K++S +    +L  + KS+ +W N        
Sbjct: 367 VFSIDTSKWSGVMASCLTESDLRPLAETKLESEV-TFTELKDSPKSVAWW-NTTPQSVVK 424

Query: 436 ISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYE 495
           +S+++++   + +G+S        D + S+ E     PE     Y   +++P+ EI    
Sbjct: 425 VSNREVKSKQVSEGVSKQDD----DITGSRQE-----PE----KYNAHYSQPIAEIMQLN 471

Query: 496 QIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKR 555
           Q +           IP   R  PLKN ++E QL+ LT+ S+ ++  I++ QTLG     R
Sbjct: 472 QKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQTLGVTLHNR 531

Query: 556 MIDSIEEFSRQIETTYQINKFWDNFEQIREV------QNTKIDKVKEKQQKLMERLSSLY 609
           +      + +Q++ T+Q+    +  E+ + +      Q+++ D V  +   LM R +   
Sbjct: 532 I------YEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNKFK 585

Query: 610 DKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIA 669
           D +   +      +  IS  E EWF EI++ V+ FN  V        +L  +K++  +IA
Sbjct: 586 DNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNRIA 645

Query: 670 NQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGI 711
               D +S+   EW++L+ +L  D  I+ +   +  +A   +
Sbjct: 646 QVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  315 bits (806), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 219/714 (30%), Positives = 388/714 (54%), Gaps = 35/714 (4%)

Query: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS-TSTTYKSLDFDLQF-EGKVEGAVSS 69
           + + + +  ++FSS +GT++V I D   +RWC+S T ++Y+SLDF            +SS
Sbjct: 16  SLSASQSPSYIFSSHNGTRVVFIQD-NIIRWCNSLTESSYQSLDFSRHLILDDTFRVISS 74

Query: 70  TTADYVCIYNRDELHVLEVPWMYSG-EENGLKHLCHIYSHKFD--ENHS---IKQVLFHP 123
            + D +  +N  E+ V+EVPW Y+  EE  ++    ++ +     EN S   IK+VLFHP
Sbjct: 75  ASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVLFHP 134

Query: 124 KSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGL 183
           KSY DS I+VL  DD+I M +   N+  K ++ LN ++++ GL  R+NDI  + FS+DGL
Sbjct: 135 KSYHDSCIVVLKEDDTITMFDIL-NQQHKPIV-LNKRSNSFGLDARVNDITDLAFSRDGL 192

Query: 184 SLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQ 243
           +L  L+  EG D+F  YP LP    +   ++  +  KSL++Y +++  T    KRNI+KQ
Sbjct: 193 TLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQ 252

Query: 244 LNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXX 303
           L  + K+        +    + +++ Y   + QGPF++ P+P+ELY++ A          
Sbjct: 253 LQLVSKLHEN---LDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPIDN 309

Query: 304 XXS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPG 362
             + ++ + F +G++ L   DLE  MSWD+  +  +NSL L+E+IK++ TD     ++P 
Sbjct: 310 MQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLPE 369

Query: 363 TYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKS 421
             GK +V ++N  S   +++ +WS IL++ I++SD+  L ++K +S +EN+  +     S
Sbjct: 370 ELGKLYVFSEN--SVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENI--VTIEHPS 425

Query: 422 IIYWKNENISCNYIISDKKIEELDML--DGISSTTKHKLIDQSNSQVESKLDLPELKNGL 479
            + + + N + N +++ +       +  D    TTK    ++S+     ++D        
Sbjct: 426 NLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSD-----RID----AGKH 476

Query: 480 YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYM 539
           YE+ F +P+ EI    + + K   +     IP   R  PLKN ++ENQLE  T IS+ ++
Sbjct: 477 YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFL 536

Query: 540 KMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQ 599
           + I  AQ+LG+    R+ +   E +RQ++ T +I     + ++    QN K D    +Q 
Sbjct: 537 QKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQV 596

Query: 600 KLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELE 659
           KLMER   L + +    E   +   NI+  E +WF EI+  +++FN++VR   +  Q+L 
Sbjct: 597 KLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLS 656

Query: 660 FIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGINQ 713
           ++K++  +I  +      +   EW++L+++L  D KII    K+C+  +  ++Q
Sbjct: 657 YMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKII----KECNEELMHVSQ 706

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  308 bits (790), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 230/730 (31%), Positives = 368/730 (50%), Gaps = 77/730 (10%)

Query: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQF--EGKVEGAVSSTT 71
           T   +QRF F+S  GT++V +     L+WC+   TTY S+     F  + K+     S +
Sbjct: 20  TNEDSQRFFFTSHQGTRMV-LLQGCILKWCNVIDTTYHSMKVKSIFNNKRKIIDVKLSES 78

Query: 72  ADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFD---------ENHSIKQVLFH 122
            D++CIY    + +LE+PW Y    + L  L       +D             IKQVLFH
Sbjct: 79  GDFLCIYTTKTIDILEIPWGYEKIPDEL--LSKFQPFHYDISSSTSALSSPSDIKQVLFH 136

Query: 123 PKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQD- 181
           PKSY ++ +++L  D  I +I+T    +    I +N     LG+  R+ DI+ I F +  
Sbjct: 137 PKSYHETCLVILYEDSIIQLIDT---TASTETITINQPTGTLGVETRVIDIESICFDKTT 193

Query: 182 GLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIV 241
           GL L  LS  +G DI+ +YPCLP R D+S  EVD L  KS++LY+++  N +   KRN++
Sbjct: 194 GLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSNDVKRNVI 253

Query: 242 KQLNFMEKIRGQ--------------KTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNE 287
           KQL F  K++GQ              + A ++ K  L ++  Y     QGPF+++P+PNE
Sbjct: 254 KQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFTISPFPNE 313

Query: 288 LYDFMAXXXXXXXXXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQI 347
           LY   A             LL + F +G+V L   DLE  MSWDI+ +   NS AL+E I
Sbjct: 314 LYSATAKESQCMKINENNELLIMTFDDGSVALLFRDLELTMSWDIANYIHDNSFALVELI 373

Query: 348 KLEITDNAKFLSIPGTYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVK 406
           KL+ TD  + +     +GK F+++D+V     V+T  WS  LA+ IDDS++ +L+ +  +
Sbjct: 374 KLKPTDIGRLIIYQDNFGKFFLLSDDVI--MLVHTNSWSDKLAKAIDDSNLNILSEIGFE 431

Query: 407 SNIENLQQLA-----TTFK-----SIIYWKNENISCNYIISDKKIEELDMLDGISSTTKH 456
           S I     +      T  K     SII+  ++N+   ++ +  K   ++ + G S+    
Sbjct: 432 SEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNV---FVENLTKKHSMNNIKGSST---- 484

Query: 457 KLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRS 516
                SNS  E+           Y+V F +P+ E+    +++ K  +      I  E R 
Sbjct: 485 -----SNSNEET-------AESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQ 532

Query: 517 APLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKF 576
             L N SNE QLE LT +S+  +  I   QTLG+    R+ +   E +RQ++ T  +   
Sbjct: 533 IELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIV--- 589

Query: 577 WDNFEQIREVQNTKIDKVKE------KQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAE 630
              FE+   ++N   + +K       +  KL +RL +L +K+    +  ++++  I++ E
Sbjct: 590 ---FEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVE 646

Query: 631 SEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENG-KEWNDLQQL 689
            EWF EI+  V +FNS+V      ++EL F+K++  +I+N    +  E   KEW +L+ +
Sbjct: 647 LEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAI 706

Query: 690 LRTDLKIISE 699
           L  D KII E
Sbjct: 707 LEQDSKIIKE 716

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  307 bits (787), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 222/721 (30%), Positives = 373/721 (51%), Gaps = 50/721 (6%)

Query: 17  AAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSL-----DFDLQFEGKVEGAVSSTT 71
            + RF F+++   ++V + D G +RWC++ S  Y S      +FD      ++ ++ S +
Sbjct: 33  TSPRFFFTTNRDNRVVVVQD-GSIRWCYTFSQNYHSYTIASRNFD------IKDSLISNS 85

Query: 72  ADYVCIYNRDELHVLEVPWMYSGEENGLK-HLCHIYSHKFDE-NHSIKQVLFHPKSYLDS 129
             +VC Y+  ++ ++E+PW +S   N    H    Y + F + + ++KQVLFHP + L+S
Sbjct: 86  GSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVKQVLFHPLATLES 145

Query: 130 TILVLTNDDSIFMINTDDNRSDKNMIN----LNSKNSALGLYDRINDIQKIIFSQDGLSL 185
            ++VL +DD+I  I   D     ++++    LN K+ ++GL  +I+DIQ + FSQDGL+L
Sbjct: 146 CLVVLLSDDTIVFI---DFSKSFDLLSSDYILNKKSKSIGLSSQISDIQSLTFSQDGLTL 202

Query: 186 LILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLN 245
             LS+    D++  YPCLP     SL +++ L  KS++ Y  +  +     K NI+KQL 
Sbjct: 203 YALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELREDDPTALKINIIKQLK 262

Query: 246 FMEKI-RGQKTAFRND------KKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXX 298
           F   + +  K A   D      K  + LE  Y   +PQGPF+++P+P+ LY         
Sbjct: 263 FTSDLYKKGKRALEEDTDSKTWKYDVPLE--YRLIRPQGPFTISPFPDSLYYSSPTHIVS 320

Query: 299 XXXXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFL 358
                   LL ++FS+G+V+    DLE  MSWD   F  +NSL LLE IK +  +  K  
Sbjct: 321 VPIDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLELIKTKEQNIRKLT 380

Query: 359 SIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATT 418
           +    YG F +  +VK NF V T  WS+ LA  I  SDI+ L+NL +KS I+     A  
Sbjct: 381 TYAHQYGTFYILGSVK-NFEVLTSHWSSTLAICIKSSDIRDLSNLLIKSVIKPFDNAAYE 439

Query: 419 FKSIIYWKNENISCNYIISDKKIEELDMLDG--ISSTTKHKLIDQSNSQVESKLDLPELK 476
             S  +W +  IS    I+   + EL+      +S  T H L     S++  K  +P L+
Sbjct: 440 LTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLL----TSELAQKY-IPPLE 494

Query: 477 NGLYEVKFARP--LTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKI 534
           + +++++      ++++ +   ++ +    Q    IP + R+  L N +NENQLE+LTKI
Sbjct: 495 DKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNENQLETLTKI 554

Query: 535 SESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKV 594
           S+     ISM Q+LG+    +++D       Q+    Q  +  +  + +    N + DK+
Sbjct: 555 SKVIGIKISMGQSLGFGIYNKILDQQNIVELQLR---QTQRLLEKEKILNTKYNEQADKL 611

Query: 595 K---EKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKA 651
           +   E+Q+KLM RL  + +K++      ++ N +IS  E E+F EI++ V+ FN +V K 
Sbjct: 612 RAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFNEFVHKQ 671

Query: 652 STNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGI 711
              H  L FIK++  +I  +   +   + K+W+ L+ +L  D   I    + C  ++  I
Sbjct: 672 KDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTI----ETCTESIKNI 727

Query: 712 N 712
           N
Sbjct: 728 N 728

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  290 bits (743), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 204/721 (28%), Positives = 343/721 (47%), Gaps = 59/721 (8%)

Query: 6   ILKNSEAFTGNAAQRFLFSSSDGTKIVSI-ADRGHLRWCHSTSTTYKSLDFDLQ-FEGKV 63
           IL+ +     + + R++F++  GTK V +    G LRW   +   Y S+   +  F  K 
Sbjct: 25  ILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFADKS 84

Query: 64  EGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDE---NHSIKQVL 120
              + S + +++C+Y++D + V+EVPW Y   E     + +++   F E   +  IK+VL
Sbjct: 85  VNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPE----EMSYVFQTSFKEIRKDSFIKKVL 140

Query: 121 FHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQ 180
           FHP++   + +++L  DD+I++ + +DN    N I LN  +  +G+ DRI  I  I FSQ
Sbjct: 141 FHPRAIKKTCMVILFEDDTIYLFDVEDN----NKIALNVPSGNIGIEDRITSIADIEFSQ 196

Query: 181 DGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNI 240
           DGL+L +LSAE+  D++ IYPCLP    +S  E+ +L  +S+LLY+++   T    K+ +
Sbjct: 197 DGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGV 256

Query: 241 VKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXX 300
           +KQ+ F+ +++            L ++  Y  A+PQGPF++ P+P +LY   A       
Sbjct: 257 IKQVEFISQLQNISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKLYSATATEICPLN 316

Query: 301 XXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI 360
                 +L IA+ NGT L    DLE  M+WD+     +NSL L+E+  L+       L  
Sbjct: 317 IGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVSILKS 376

Query: 361 PGTYG--KFVVTDNVK----SNFF----------------VNTCDWSTILAQIIDDSDIK 398
               G   F V+D+V+    S  F                V+T  WS++++  ID  DI 
Sbjct: 377 FKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDCIDRHDIN 436

Query: 399 LLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKL 458
            L  +  KS         +   S   W +        I++K            S T  +L
Sbjct: 437 ALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNK------------SVTCKEL 484

Query: 459 IDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKI--PLEIRS 516
             Q + + E      + K    + +F+ P++E+     I Y++     F  I  PL+ R 
Sbjct: 485 KKQVSWKPEQSTSSEKKKQAFPKPEFSVPISELNAL-NINYQDTCRIGFHDIISPLD-RQ 542

Query: 517 APLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQI--- 573
            PL N SNE QL+ +T +S   +  +   Q LG     R+++   E ++Q++ + +I   
Sbjct: 543 KPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMK 602

Query: 574 -NKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESE 632
                   E+ + V N K+     KQ KL ER SSL  K+    +     +  I+  ES 
Sbjct: 603 QPAIAKKLEEQKSVWNEKL----AKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESV 658

Query: 633 WFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRT 692
           WF E+K+  + FN  V K  +   +L F+K + +   +    +      EW+ LQ++L+ 
Sbjct: 659 WFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKH 718

Query: 693 D 693
           D
Sbjct: 719 D 719

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  284 bits (726), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 189/674 (28%), Positives = 343/674 (50%), Gaps = 27/674 (4%)

Query: 33  SIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMY 92
           SI  +  LRW    S+ Y SL      +   E  + S +  ++C+Y++  L ++E+PW Y
Sbjct: 47  SIYKKNQLRWGSVASSQYHSLPLLFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGY 106

Query: 93  SGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDK 152
            G    +K          +++  IK++LFHPK+  D  +++L  +D I +   D  +S+K
Sbjct: 107 DGAVTSIKSSFQRVFRDVNKSSDIKKILFHPKAADDGCVVILFENDVICLF--DLRKSEK 164

Query: 153 NMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLH 212
             + LN   + LG+  R+ DI+ + FSQDGL+L +LS  +G DI+  YPCLP +  +   
Sbjct: 165 --LFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSLKKS 222

Query: 213 EVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLN 272
            ++ LF KS +LY++++   + + ++N++KQ+ F+  +R   +        L + + +  
Sbjct: 223 VLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSD-ETKNSCLEISNDFRQ 281

Query: 273 AQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDI 332
            + QGPF++ PYP +LY+  A             L AI F NGTV L L DLE  MSW+ 
Sbjct: 282 VKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNNELFAITFDNGTVTLLLKDLELSMSWNA 341

Query: 333 SRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQII 392
             +  +NS  L+E +++   ++ K L      G+  ++ N  S   ++T  WS  +++ I
Sbjct: 342 DNYVYNNSFVLIESVEMG-PESIKLLKSSSLTGQMFISQNHSSVRKIDTTAWSFKVSKCI 400

Query: 393 DDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISS 452
            +SD+  L ++  KS I +L               EN+ C  + S +   E  +L   +S
Sbjct: 401 TNSDLTSLIDVDFKSKISDLDI------------KENVDCYGVWSLRG--ERGILFVSNS 446

Query: 453 TTKHKLIDQSNSQVESKLD-LPELKN------GLYEVKFARPLTEIQHYEQIYYKNLQNQ 505
           +   + + +S+S    KLD +   KN        YEV F +P++EI +    + +  ++ 
Sbjct: 447 SVISRTLPESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHP 506

Query: 506 NFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSR 565
               I  E R   L N SNE QL +LT+IS   +  I   Q+LG + R R+ +   E ++
Sbjct: 507 FKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTK 566

Query: 566 QIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSN 625
           Q++ + Q+ +     +   + +  + +K  +KQ +L++R ++L   +    E   ++ + 
Sbjct: 567 QLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTP 626

Query: 626 ISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKEWND 685
           IS  E EWF E++  +++FN +V       +++ F+++  ++I ++    SS    EW +
Sbjct: 627 ISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSSHLTSEWAE 686

Query: 686 LQQLLRTDLKIISE 699
            +++L TD  II E
Sbjct: 687 FKKILETDTNIIKE 700

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  271 bits (693), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 192/683 (28%), Positives = 334/683 (48%), Gaps = 36/683 (5%)

Query: 22  LFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRD 81
           L ++ DG ++V I     +R C S ++ Y+ ++  +     V GA  + +   +C YN  
Sbjct: 23  LLTTQDGCRVVVIQG-DTIRLCSSGNSQYQIIECGI---NTVAGAALNNSGTLLCAYNET 78

Query: 82  ELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIF 141
           EL V+ +P  +     G+      +++       IKQV +HP+  LDS  +VL  DD+I 
Sbjct: 79  ELQVIVLPSPFVSSHGGI---LKPHTYNITVKSPIKQVQWHPRGKLDSVPVVLHKDDTIA 135

Query: 142 MINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYP 201
           M    +    +    LN+  + LG+   I DI+ + FS+DGL+L +L++ EG D++ +YP
Sbjct: 136 MYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSSEGGDVYALYP 195

Query: 202 CLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTA----- 256
            LP    I    ++  F KS + Y N++ + +P  KRN++KQL F+ ++  Q  +     
Sbjct: 196 FLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQFVSRLHKQYKSETVDK 255

Query: 257 FRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXSLLAIAFSNGT 316
            RN      ++++Y NA+ QGPF++ P+  +LY   A             L+ + F NGT
Sbjct: 256 ARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMPIDEFNELILVYFDNGT 315

Query: 317 VLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSN 376
           +L    DL+  M W+      +NSL +LE   L+I         P    KF V      +
Sbjct: 316 ILQCFQDLDLSMCWEEIDSSSNNSLVVLE--SLDILSGQIICLTP---HKFAVLG--PKS 368

Query: 377 FFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYII 436
           F V++ +W+  L++ I+ S++++L+ + +KS I  +      F     W++        +
Sbjct: 369 FVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVN---GAFTQAGLWESNGEKQLIFM 425

Query: 437 SDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQ 496
           SDK ++ + + +       +K  D  +  V+    + E+K   YE  F++P+ EI    +
Sbjct: 426 SDKSVKSITLPE------PNKTKDAVSKTVQP---VTEVK---YEPVFSQPIGEILLLNK 473

Query: 497 IYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRM 556
            +         T IP  +   PL+N SNE+QL  LT IS+     I   QTLG +   R+
Sbjct: 474 KFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRL 533

Query: 557 IDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQK 616
            +   E +RQ+E + +I       ++    QN++ + V +KQ+ +  R   L  ++    
Sbjct: 534 FEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEIS 593

Query: 617 EMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDIS 676
             G + +  IS  E EWF EIK  V  FN +V +     ++LEF++ +      ++  +S
Sbjct: 594 SSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLEFVQSELKTAGERR--VS 651

Query: 677 SENGKEWNDLQQLLRTDLKIISE 699
            E+  +W +LQ+LL  D +II E
Sbjct: 652 KEDVFDWAELQELLSVDSEIIKE 674

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  250 bits (639), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 198/714 (27%), Positives = 351/714 (49%), Gaps = 68/714 (9%)

Query: 18  AQRFLFSSSDGTKIVSIADRGHLRWCHSTSTT-YKSL---DFDLQFEGKVEGAVSSTTAD 73
            +RF FS+++GT+I+   D   +RW  S+    Y+S+   D D+     V GA+ S   D
Sbjct: 19  TKRFFFSANNGTRIILFQD-STIRWSFSSDNDHYQSMALRDSDMD----VTGAIISDPGD 73

Query: 74  YVCIYNRDELHVLEVPWMYSGEE---NGLKHLCHIYSHKFDENH-SIKQVLFHPKSYLDS 129
           Y+C+YN  ++ V+E+PW  +  +   N +        + F+E+  S+KQVLFHP S    
Sbjct: 74  YLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQVLFHPLSKSSP 133

Query: 130 TILVLTNDDSIFMINTDDNRSDKNM-----INLNSKNSALGLYDRINDIQKIIFSQDGLS 184
            ++VL +   I  ++  +     ++     +NL   N  +G+ +R+ +IQ ++F+ D LS
Sbjct: 134 FLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSN-VMGIDNRVENIQYVVFADDCLS 192

Query: 185 LLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQL 244
           L  L+     D++  YPCLP    +S + VD L  KS++LY N+ ++     ++N++KQL
Sbjct: 193 LYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDIVRKNVIKQL 249

Query: 245 NFMEKIRGQKTAFRNDKKPLI----LEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXX 300
                +R +   F N    +     ++  +   + QG FS++PYP  LY           
Sbjct: 250 QLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESLYTCTGKQISVLP 309

Query: 301 XXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSI 360
                 L  ++F NGTVL+   D E  MSWD++ +  +NS  L+E IK +  + +  + +
Sbjct: 310 IGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFKPEELSNMVVL 369

Query: 361 PGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFK 420
            G  GKFVV+   KS   V+T  WS+++++ I D+D++ L  L++KS I ++        
Sbjct: 370 QGELGKFVVSGE-KSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITHINSDMQINS 428

Query: 421 SIIYWKNE---------NISCNYIISDKKIE-ELDMLDGISSTTKHKLIDQSNSQVESKL 470
             I+   E         N+   Y +  K++E + +  + IS+  ++  +D        K 
Sbjct: 429 CGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELENFTLD--------KF 480

Query: 471 DLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLES 530
            +PE      E+K A    + Q    + Y  +       IP  I+  P  +++ E QL+ 
Sbjct: 481 TVPE-----NELKAAN--YKFQEAVSVPYSKV-------IPANIKQVPFGSNAMEEQLKI 526

Query: 531 LTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTK 590
           L  IS      I   Q+LG +   R+++  ++ S Q+  T +I       +     Q +K
Sbjct: 527 LNDISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSK 586

Query: 591 IDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRK 650
           +D+  +KQ+ L + L  +   +   +E   + +  +S  E + F E++  ++ FN++V K
Sbjct: 587 LDEKLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHK 646

Query: 651 ASTNHQELEFIKEQQAQIANQKPDIS-SENGK----EWNDLQQLLRTDLKIISE 699
                Q ++F+K++  +I     DIS SE+ K    EW +L+Q+L  D KII E
Sbjct: 647 QKDQKQNIQFLKKELQKII----DISRSESSKGMLNEWEELRQILADDAKIIKE 696

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  246 bits (629), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 198/720 (27%), Positives = 339/720 (47%), Gaps = 50/720 (6%)

Query: 17  AAQRFLFSSSDGTKIVSIADRGHLRW--CHSTSTTYKSLDFDLQFEGKVEGAVSSTTADY 74
           +++R   +  +G KI+ +     +R+   +     +KS+  + +  G V   ++    +Y
Sbjct: 19  SSKRSSITVDNGLKII-LYQNNTVRYGFVNDADGNFKSITLEKEMIGDV-SIIADQIGNY 76

Query: 75  VCIYNRDELHVLEVPW-MYSGEENG---LKHLCHIYSHKFDE-NHSIKQVLFHPKSYLDS 129
           +C++N  E+ V+E+PW ++  +E+    L ++  I S+       +I+++LFHP      
Sbjct: 77  LCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYP 136

Query: 130 TILVLTNDDSIFMINTDD----NRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSL 185
            ++VL  + +I  I+              I        +GL   I+DI  I FS D LSL
Sbjct: 137 CLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDISFSSDKLSL 196

Query: 186 LILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLN 245
             L+     DI+  YP L     ++ +E+D LF KS++L+ N+  +++   +RNI+KQL 
Sbjct: 197 YALTE---TDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQ 253

Query: 246 FMEKIRG----QKTAFRNDKKPLI----LEDAYLNAQPQGPFSMTPYPNELYDFMAXXXX 297
            +  + G    Q    +N  +  I    +   Y +   QG FS+ P+P ELY   A    
Sbjct: 254 LLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLS 313

Query: 298 XXXXXXXXSLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKF 357
                    L  I + +GTVL+   DLE  MSWD + +  +NS  LLE++K    +    
Sbjct: 314 VIQIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSI 373

Query: 358 LSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLAT 417
           L IP   G F +  +   N    +C WS IL+Q I D+DI+ LA L ++S+ + +  L  
Sbjct: 374 LDIPFKNGIFAIAGDQTVNLIDTSC-WSDILSQCIKDNDIRNLAGLSIESHKQTINTLEE 432

Query: 418 TFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKN 477
              S I W   N      I++ K+   D+L             +SN++   KL +P + N
Sbjct: 433 P-NSCILWNEHNKKELLFITETKLISSDIL-------------ESNNESAEKLPVPAI-N 477

Query: 478 GLYEVK------FARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESL 531
            + +++      +++P+ EI    Q Y  + +      IP  IR  P  N  NE+QL  +
Sbjct: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537

Query: 532 TKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKI 591
           T+IS+     I   QT+  +   R+ +  + F+ Q+  T +        +Q  ++Q+TKI
Sbjct: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597

Query: 592 DKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKA 651
             + E+  KL ER S L + +E  K+     N  I+ +ES+ F EIK+ V+ FN  V + 
Sbjct: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657

Query: 652 STNHQELEFIKEQQAQIANQKPD----ISSENGKEWNDLQQLLRTDLKIISEFEKKCDTA 707
               + ++F++ +   I  Q       I   +  EWN+L  LL  D KII +   +  +A
Sbjct: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  245 bits (626), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 191/716 (26%), Positives = 331/716 (46%), Gaps = 67/716 (9%)

Query: 14  TGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTAD 73
           +   ++RF+F+    +K   +     LRWC +    Y+ L+F+ + +      V + +  
Sbjct: 15  SSGKSRRFVFNIGIASK-YGVLQGNTLRWCSAGGHEYQYLEFEPRID--YTSVVINESGS 71

Query: 74  YVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILV 133
            +C+YN  ++ +L V W  S  +  L                IKQ L+HP+  L S + V
Sbjct: 72  LLCLYNSKQVQILAVSWDESKSDTIL----------ISPPAGIKQALWHPRGRLGSCLAV 121

Query: 134 LTNDDSIFM--INTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAE 191
           LT  D I +  + T+D      ++N  +K   LG+   + DI  + FS DGL+L +LS  
Sbjct: 122 LTTQDEICLYELLTEDYTEPTTILNTCTKE--LGMGSVVKDITSMSFSSDGLTLYLLSTS 179

Query: 192 EGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIR 251
           EG DI++IYPCLP   +IS   + ++F K+LL Y ++N N +P  +R + KQL F+ K++
Sbjct: 180 EGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRKVTKQLQFVSKLQ 239

Query: 252 GQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXS-LLAI 310
            +      +   + +  A+ + + QGPF++ P+P+ LY                + LL I
Sbjct: 240 KKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQGCAAELLLI 299

Query: 311 AFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVT 370
           +F +GT+L    D EP+MSW+   F  +NSL +L  + +        +++   Y  FVV 
Sbjct: 300 SFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNI-----GGEIALVNGY-TFVVL 353

Query: 371 DNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENI 430
            + K   FV+    + ++   ++D DI       +    E + +    F S I   +   
Sbjct: 354 SSAKVT-FVSLRKLAQVIESSLNDCDISYFDEADLS---EEVVEKNGRFCSAIICASSEK 409

Query: 431 SCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVK------- 483
           SC  ++S+             +TT H  ID     +   LD P+++  L   K       
Sbjct: 410 SCVALLSE-------------TTTSH--ID-----IPFSLDAPKMRTALGTAKTDVEQYR 449

Query: 484 -FARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMI 542
            + +PL E+    +     L+    T +   +R A L N SNE+QL  LT IS+  M  I
Sbjct: 450 PYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRI 509

Query: 543 SMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLM 602
           + AQTL      R+     E ++ +ET  ++ +      +  + Q+++ +  + K + + 
Sbjct: 510 ASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSIS 569

Query: 603 ERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKA-------STNH 655
            RL  +  K++     G   +  IS  E EWF EI+  VI FN  V +        S   
Sbjct: 570 SRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLK 629

Query: 656 QELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGI 711
            ELE++  +  +  +      +++   W++L+ LL  DL+II E    C  ++ G+
Sbjct: 630 CELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGE----CQDSLQGV 681

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  241 bits (614), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 188/711 (26%), Positives = 327/711 (45%), Gaps = 65/711 (9%)

Query: 18  AQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCI 77
           ++R    + D ++ + + +   L+WC   +  Y+ ++  L        AV + +   +C+
Sbjct: 19  SERLCLHTKDLSRTI-LLEGNSLKWCLMDAPNYEYME--LNAISNYTSAVLNDSGTLLCL 75

Query: 78  YNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTND 137
            N DE+ VL + W  +  E          S++      +KQVL+HP+  LDS + VL   
Sbjct: 76  NNVDEIQVLALSWDQTRPE----------SYRIKVPAGVKQVLWHPRGRLDSCLTVLNKR 125

Query: 138 DSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIF 197
           D I +              LN+  + LG+   + DI+ + FS DGL+L ++S  EG D+F
Sbjct: 126 DEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSEGADVF 185

Query: 198 TIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAF 257
           +IYPC+P    I+   +   F K+LL Y  ++   +P+ K    +QL+FM  +  Q    
Sbjct: 186 SIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYNQPHDA 245

Query: 258 RNDKKPLI----LEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXS-LLAIAF 312
            + +  L+    +  AY NA+ QGPF+++P+P +LY   A            + LL I F
Sbjct: 246 DDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIALEDETTELLLITF 305

Query: 313 SNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGT----YGKFV 368
            + T+L    DL P+MSW+ S     NSL  +  +KL           PG+    YG   
Sbjct: 306 DDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKL-----------PGSISLIYGSCF 354

Query: 369 VTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNE 428
           V  + +    VN    +  + + +DD D   L+   +    E + +   TF+S   W   
Sbjct: 355 VLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDL---TEEITEKKGTFQSAGLWPES 411

Query: 429 NISCNYIISDKKIEELD---MLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFA 485
            +    ++S+K+I  +D   M    SSTT+     ++N Q                  ++
Sbjct: 412 GMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQR----------------PYS 455

Query: 486 RPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMA 545
           +PL+E+Q   Q     L++   T IP  +R   L N+ NE+QL  LT IS+  +  +++A
Sbjct: 456 QPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLA 515

Query: 546 QTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERL 605
           QTLG     R++   +E ++ +    ++    +        Q  + + ++EK + +  R 
Sbjct: 516 QTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRF 575

Query: 606 SSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKA-------STNHQEL 658
            SL+  +    +   + +  I+ AE EWF E++  V+ FN  V +        S+    L
Sbjct: 576 ESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSL 635

Query: 659 EFIKEQQAQIANQ-KPDISSENGKEWNDLQQLLRTDLKIISEF--EKKCDT 706
           E+++   A+ A++ K    S  G  W++LQ +L  D +II E   E +C T
Sbjct: 636 EYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTT 686

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  218 bits (556), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 181/677 (26%), Positives = 321/677 (47%), Gaps = 54/677 (7%)

Query: 27  DGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVL 86
           + T+IV+  D+ +LR+   T  T+KS   D++     E ++ + +   +  Y  +++ + 
Sbjct: 27  NATQIVTCFDK-NLRYARVTEHTFKSKHLDIKHS---EHSILNNSGTLIAFYGSNDVELF 82

Query: 87  EVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTD 146
           ++     G+++ L+               IKQVL+HP +YLDS ++VLT +++I +    
Sbjct: 83  DM----DGKKSCLR-----------VELGIKQVLWHPLAYLDSCLVVLTKENTIELYELA 127

Query: 147 DNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRR 206
                   + LN K   LG+   +++I  + FS DGL+L +LS EEG D++ ++P LP R
Sbjct: 128 KANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEGGDVYALHPLLPSR 187

Query: 207 WDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIR---GQKTAFRNDKKP 263
             I     ++ + K+  LY +++ +T  ++K  +++  +F+ KI     + + F +   P
Sbjct: 188 LRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVSKIYKMIDKDSEFFDVNIP 247

Query: 264 LILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXS-LLAIAFSNGTVLLFLS 322
               +      P+GPFS+  +P ELY+  A            + +L ++F +GT+L    
Sbjct: 248 ----EHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDEGAYVLILSFDDGTILSLFP 303

Query: 323 DLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTC 382
           D+E +MSW  S    + S  L+E+ +       +  +I    G  ++  N   N  +   
Sbjct: 304 DIELLMSWSRS-LNNACSFVLIEKFR----AGGEIFAIES--GVAILEKN---NAHIVRF 353

Query: 383 DWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIE 442
            +   L + I + DI  + ++K+ S+I     LA ++ +++ W   +      I +  I 
Sbjct: 354 PYLKALGECIKEGDIAPMVDVKLTSDI---TPLAGSYHTVVTWNEPSTKGILFIGNSVIR 410

Query: 443 ELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNL 502
            +    G+SS      +D + SQ           NG Y V F   + E+    +     L
Sbjct: 411 SIPDDVGLSSFKPR--VDPAISQ-----------NGKYTVCFPSTMEELLKTNKALQHTL 457

Query: 503 QNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEE 562
           + Q    +PLE ++ PL +  NE+QL +LTKIS   M  I +AQ+LGY+   R      E
Sbjct: 458 R-QPLPLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQQFE 516

Query: 563 FSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMN 622
             RQ+ET  ++N      +Q  +    ++D V +K   L  RL  L   ++   E    N
Sbjct: 517 LCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESPKFN 576

Query: 623 NSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKE 682
              +S  E  WF E+K  V+ FN YV + S   +EL F+K++   I +   +I +E    
Sbjct: 577 ELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELIESNHGNIPNEELFN 636

Query: 683 WNDLQQLLRTDLKIISE 699
           +  LQ LL  D K+I +
Sbjct: 637 FEKLQDLLTLDSKMIGD 653

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  184 bits (467), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 177/701 (25%), Positives = 308/701 (43%), Gaps = 65/701 (9%)

Query: 9   NSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVS 68
           N++A  G + +    +  DGTKIV   ++ HLR    T  TYKS      +  +V+   S
Sbjct: 10  NADAL-GASHRLHAHTHGDGTKIVGYYNK-HLRLGRFTEQTYKS------WHAEVDAKAS 61

Query: 69  ST---TADYVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKS 125
           S    +   +  Y     H++EV      +  G K    +       N  IKQVL+HP +
Sbjct: 62  SILNGSGSLLAFYGD---HIIEVV-----DREGKKITLTV-------NGGIKQVLWHPLA 106

Query: 126 YLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSL 185
           YLDS ++VLT  ++I +   ++ R +K  + LN   S LG+  R+ DI  I F+ DGLSL
Sbjct: 107 YLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDGLSL 166

Query: 186 LILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLN 245
            + S  EG D+  I P LP R      +    + K+  LY+ +  +T    K   ++ L 
Sbjct: 167 YLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIEYLE 226

Query: 246 FMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXX 305
           F+ ++  Q          L++ +       QGP+++  +P +LY  +             
Sbjct: 227 FVTQLL-QAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVPLGESE 285

Query: 306 S-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTY 364
           + LL ++F + T +L     E +MSW       + +L L+E+                T 
Sbjct: 286 AHLLLLSFDDSTNILLFPSTEVLMSW-TKDLKNAYTLMLVEEFT-------------ATG 331

Query: 365 GKFVVTDNVKSNFFVNTCDWSTI-----LAQIIDDSDIKLLANLKVKSNIENLQQLATTF 419
             F   D V +   +++     I     L   I D ++  L ++   S+I    ++   F
Sbjct: 332 TAFATCDGV-AVLGIDSAQRVEIPYLQALEDCIRDCNLAALQDINFTSSI---CKIPGKF 387

Query: 420 KSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGL 479
            S+  +         ++ D   +       I  +T     + + S  E++LD    K   
Sbjct: 388 HSVARFNAPGNKGIILVGDHHAK-------IVPST-----EAAKSDTETELDSQPGKEPT 435

Query: 480 YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYM 539
           Y V F   L EI +  +   +  ++Q    +P  +++ PL +  NE  L +LT IS+  M
Sbjct: 436 YTVCFPNSLEEILNTNKELQRR-KHQPLPLVPPALKNIPLNSDLNEQHLATLTNISKEVM 494

Query: 540 KMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQ 599
             I ++Q+ G +   R+     E  RQ+ET   I           E  ++++  V ++ +
Sbjct: 495 DRIILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDR 554

Query: 600 KLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELE 659
           +L +RL  L   +         ++  +S  E++WF E+K   I FN YV +++    EL 
Sbjct: 555 RLKQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELA 614

Query: 660 FIK-EQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699
           F+K E ++   +++ D   E   ++  LQ+LL+ D KII+E
Sbjct: 615 FLKNELESLPEHRQHDRQEEEPFDFRRLQELLKLDSKIITE 655

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 182/697 (26%), Positives = 311/697 (44%), Gaps = 104/697 (14%)

Query: 40  LRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGL 99
           LR      T Y+S + +L F    E  V S +   V  +   EL+V+EV      E++ L
Sbjct: 40  LRVQSDHETQYRSYNVELPFVP--EQMVISPSGGLVAFHANSELYVMEV-----NEQSRL 92

Query: 100 KHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNS 159
           +         F+ +  IK++L+HP +    + ++L +D +I + + +D   +   +  N 
Sbjct: 93  RK-------HFNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITV-FNR 144

Query: 160 KNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHE------ 213
           K+ + GL D +  +  I F   GL+L +LS+   CDI+ I+PCLP+ + +  ++      
Sbjct: 145 KSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTS 204

Query: 214 -------VDTLFAKSLLLYNNMN------VNTTPQE-------KRNIVKQLNFMEKIRGQ 253
                   D +  KSL LYN+++        + P         K +++KQ+ F +  +  
Sbjct: 205 RTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYK-- 262

Query: 254 KTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMAXXXXXXXXXXXXSLLAIAFS 313
               +ND        A  N+ PQGPF +  +P  L                  LL + F 
Sbjct: 263 ----KNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFI 318

Query: 314 NGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLS--IPGTYGKFVVTD 371
           +GT ++  SD E +MSW +      N+L+++         NAK     +  +  K V T 
Sbjct: 319 DGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMF------NAKGQCQLLNSSEPKLVFTG 372

Query: 372 NVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIEN-----LQQLATTFKSIIYWK 426
           +  S+  +    W   LAQ I   D  ++ ++K ++ I       L  L+T    I+Y  
Sbjct: 373 D--SSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNG 430

Query: 427 NENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFAR 486
           N         S K IE  D       +T  K I++++          E+K   Y  K + 
Sbjct: 431 N---------SFKVIESND------KSTTQKPINRTD----------EVK---YTYKPSL 462

Query: 487 PLTEIQHYEQIY--YKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISM 544
           P T  +  + +   YK   N   + IP  +   PLKN+SNE QLE ++++ +  MK + +
Sbjct: 463 P-TSGKELDMLLTKYKTEANGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKL 521

Query: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQI----NKFWDNFEQIREVQNTKIDKVKEKQQK 600
            Q + +    +  + + E  RQ+  T +I    NK   N   ++E    +  + +EK + 
Sbjct: 522 GQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQE----RYSRYEEKSKT 577

Query: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660
           L +RL  L +     +    +  S+IS AE  WF  IK  V++FN+YV   +   +ELEF
Sbjct: 578 LEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEF 637

Query: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKII 697
           + + Q +   +  D  SE   E++ LQQ+L  D K+I
Sbjct: 638 L-DTQLRSTTKGDDFFSE--LEFSSLQQMLLNDKKVI 671

>Kwal_27.11568 s27 (852845..854824) [1980 bp, 659 aa] {ON} YDR221W -
           Hypothetical ORF [contig 27] FULL
          Length = 659

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 481 EVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMK 540
           E +    ++ +   ++IY + LQN+N   + LE    P   ++ E         SE+Y  
Sbjct: 185 EARLKTCVSNLAQAKEIYKQRLQNENPLMLRLEQADVPFIVNTIEMIFTEAQSTSEAYQD 244

Query: 541 MISMAQTLGYIYRKRMIDSI 560
           ++S+  TLGY Y K + D +
Sbjct: 245 LVSLMDTLGYKYNKNLNDEV 264

>TPHA0B01530 Chr2 complement(340332..343493) [3162 bp, 1053 aa] {ON}
           Anc_7.440 YBL104C
          Length = 1053

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 324 LEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGTYGKF--VVTDNVKSNFFVNT 381
           L P   W  S +    +LA+ ++ +L   DN+  LS+P    +F  +V     S  ++N+
Sbjct: 198 LNPFNGWQFSTYGDDGTLAIWDRRRLASHDNSAGLSLPQPLIQFDKLVGTGAASRKYMNS 257

Query: 382 C-DWSTI 387
           C  WST+
Sbjct: 258 CFRWSTV 264

>ADL357C Chr4 complement(77471..81004) [3534 bp, 1177 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML091C
            (RPM2)
          Length = 1177

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 373  VKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENIS- 431
            + + + VN   +   +A +++++ +K  A   V S  + +Q  +   K+     NEN+  
Sbjct: 933  IHAEYLVNIFKFDEAVA-LVENAAVKTTAARDVSSFAQFIQSFSKEVKT-----NENVEN 986

Query: 432  ----CNYIISDKKIEEL-DMLDGISSTTKHKLIDQSNSQVESKLDLPE 474
                 N + S + +EE+ D+ + + S+ +H L+D +N     KL+L E
Sbjct: 987  TLQLANALCSLRSLEEMNDLYESVVSSKQHPLVDGTNIAFAVKLELLE 1034

>NCAS0A04510 Chr1 complement(907090..907803) [714 bp, 237 aa] {ON} 
          Length = 237

 Score = 32.0 bits (71), Expect = 4.0,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 53/136 (38%), Gaps = 10/136 (7%)

Query: 15  GNAAQRFLFSSSDGTKIVSIADR-GHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTAD 73
           G   Q F        K+V   ++ G  R+ H ++   +  +F    EG     ++  +AD
Sbjct: 95  GGIDQLFTVDLDGCIKVVEACEKVGVQRFIHVSAIRIEDREFWWNLEGLKSYFIAKRSAD 154

Query: 74  YVCIYNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIK---------QVLFHPK 124
           +    +  +  +L+  W++ GE  G        + K  E +S+K         Q L HP+
Sbjct: 155 HFVKSSSLDFTILQPGWLHVGEGTGKVLPLDRINEKSSEGYSLKREDLASMIIQCLLHPE 214

Query: 125 SYLDSTILVLTNDDSI 140
                TI +   D  I
Sbjct: 215 KTSRRTICLANGDQPI 230

>Skud_14.372 Chr14 complement(665776..667593) [1818 bp, 605 aa] {ON}
           YNR039C (REAL)
          Length = 605

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 623 NSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKE 682
           N+N++A       E +    + N YVR  S +   +  I  ++A+     P  S+EN   
Sbjct: 467 NNNLAADAVTNAQEAESKSGKVNPYVRPRSMSSLPIATINREKAKTGFWNPITSTENPT- 525

Query: 683 WNDLQQLLRTDLKIISEFEKKC 704
             +++ ++++ ++ +SEF+ +C
Sbjct: 526 --NIKNMMKSQIEKLSEFKSRC 545

>SAKL0C11330g Chr3 complement(1015136..1022605) [7470 bp, 2489 aa]
            {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
            YBL004W UTP20 Possible snoRNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 2489

 Score = 31.6 bits (70), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 9/92 (9%)

Query: 381  TCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKK 440
            T DW+  +A I ++    ++    V+   ENLQQ ++  K + YW N      ++  D  
Sbjct: 1073 TLDWTEYIADIYNN----VIKPRLVRFEDENLQQPSSIMKMMTYWANHKFLYKFLYFDDY 1128

Query: 441  IEELDMLDGISS-----TTKHKLIDQSNSQVE 467
                 ++  +SS        H L+D SN  V+
Sbjct: 1129 APAKALMRTLSSDNAKEAVVHVLLDYSNKIVK 1160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,506,702
Number of extensions: 3659755
Number of successful extensions: 17446
Number of sequences better than 10.0: 438
Number of HSP's gapped: 18272
Number of HSP's successfully gapped: 539
Length of query: 716
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 599
Effective length of database: 40,065,477
Effective search space: 23999220723
Effective search space used: 23999220723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)