Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J03454g2.285ON69369336370.0
NCAS0G038002.285ON72668929650.0
ZYRO0A01870g2.285ON70770229490.0
Smik_14.3102.285ON70669129450.0
Suva_14.3262.285ON70666829360.0
YNL021W (HDA1)2.285ON70666829340.0
Skud_14.3082.285ON70668829210.0
TDEL0G021602.285ON71469629120.0
NDAI0G006502.285ON68968128840.0
SAKL0E07700g2.285ON71270128830.0
KNAG0H020102.285ON69369128270.0
KLTH0G10340g2.285ON70870527830.0
KAFR0H033202.285ON70269127730.0
Kwal_27.115372.285ON70869827670.0
Ecym_33242.285ON70667627320.0
KLLA0E08383g2.285ON70467526750.0
ADL216C2.285ON70570426610.0
TPHA0C033902.285ON70169426610.0
Kpol_1039.322.285ON65965626050.0
TBLA0B069502.285ON79548519400.0
Kpol_1003.372.285ON57829813561e-180
TPHA0H003208.153ON4503263597e-36
SAKL0H25124g8.153ON4483373597e-36
AFR172C8.153ON4493263597e-36
NCAS0B054808.153ON4513383589e-36
Kpol_246.58.153ON4533403562e-35
Skud_7.798.153ON4523223562e-35
KAFR0C029208.153ON4533273553e-35
KLTH0E06446g8.153ON4493243534e-35
YGL194C (HOS2)8.153ON4523233525e-35
NDAI0B027108.153ON4533463526e-35
Smik_7.798.153ON4523493526e-35
Kwal_55.207908.153ON4493253501e-34
Ecym_23468.153ON4853573521e-34
Suva_7.718.153ON4523493482e-34
TDEL0B045808.153ON4463273472e-34
CAGL0A03322g8.153ON4503323446e-34
ZYRO0G19316g8.153ON4483283439e-34
TBLA0D021408.153ON4563263421e-33
KLLA0F09119g8.153ON4523253384e-33
KNAG0G013508.153ON4513373341e-32
Suva_14.113.8ON4333243312e-32
Skud_14.113.8ON4333243313e-32
KLTH0F19668g3.8ON4323393303e-32
NDAI0G037403.8ON4333243294e-32
Kwal_55.221423.8ON4323393287e-32
CAGL0B01441g3.8ON4333243277e-32
Kpol_1038.113.8ON4333243277e-32
KAFR0A086303.8ON4333243278e-32
KNAG0A011603.8ON4333243261e-31
Smik_14.23.8ON4333243242e-31
YNL330C (RPD3)3.8ON4333243242e-31
TBLA0I005603.8ON4333243232e-31
NCAS0C043203.8ON4343243232e-31
AGR395W3.8ON4333243223e-31
Ecym_20103.8ON4333243223e-31
KLLA0E01981g3.8ON4323243223e-31
ZYRO0C03498g3.8ON4333243214e-31
SAKL0C13706g3.8ON4333243215e-31
TPHA0A003003.8ON4333243215e-31
TDEL0A002703.8ON4333243206e-31
TDEL0C050403.362ON4541811867e-14
NDAI0A051203.362ON5082401869e-14
KLTH0F10582g3.362ON4741771832e-13
Suva_16.3963.362ON4771771823e-13
CAGL0D01430g3.362ON4452771813e-13
Skud_16.3533.362ON4711771805e-13
NCAS0A111803.362ON4902031805e-13
KAFR0H008903.362ON4742151787e-13
TBLA0B023903.362ON5791761771e-12
SAKL0B07854g3.362ON4891771742e-12
Kwal_23.37243.362ON4732031742e-12
ZYRO0C16390g3.362ON4361801724e-12
YPR068C (HOS1)3.362ON4701771724e-12
Smik_16.3093.362ON4701771707e-12
ADL339W3.362ON4372061662e-11
Kpol_376.153.362ON5181771653e-11
KNAG0H006303.362ON4561821634e-11
KLLA0B09394g3.362ON4411771626e-11
Ecym_82908.607ON7093301628e-11
TDEL0A055208.607ON6743211602e-10
ADL265W8.607ON6942481573e-10
SAKL0H08338g8.607ON6903291556e-10
KLTH0D09592g8.607ON7052561556e-10
Ecym_34653.362ON4451831537e-10
TPHA0A011208.607ON6982541547e-10
KLLA0F00858g8.607ON7152671531e-09
YPL116W (HOS3)8.607ON6973201484e-09
Smik_6.3158.607ON6973201475e-09
Kpol_479.68.607ON6882501476e-09
Kwal_26.85058.607ON7083251477e-09
TPHA0M015903.362ON4941511457e-09
TBLA0E040808.607ON6942431468e-09
Suva_16.1948.607ON6991381432e-08
CAGL0J06974g8.607ON6783241413e-08
KNAG0J013008.607ON6771141361e-07
KAFR0H027908.607ON7171371361e-07
NCAS0C017608.607ON7001341352e-07
Skud_16.1648.607ON697581342e-07
NDAI0E024808.607ON684581314e-07
ZYRO0F10780g8.607ON6682641305e-07
TBLA0G014004.133ON352150830.22
CAGL0I01210g5.419ON55160715.7
TBLA0H002003.17ON42473699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J03454g
         (693 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1405   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1146   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1140   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1139   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1135   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1134   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1129   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1126   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1115   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1115   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1093   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1076   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1072   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1070   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1056   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1035   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1029   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1029   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1008   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   751   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   526   e-180
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   142   7e-36
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   142   7e-36
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   142   7e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   142   9e-36
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   141   2e-35
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   141   2e-35
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   141   3e-35
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   140   4e-35
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   140   5e-35
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    140   6e-35
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   140   6e-35
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   139   1e-34
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   140   1e-34
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   138   2e-34
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   138   2e-34
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   137   6e-34
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   136   9e-34
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   136   1e-33
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   134   4e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   133   1e-32
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   132   2e-32
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   132   3e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   131   3e-32
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   131   4e-32
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   130   7e-32
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   130   7e-32
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   130   7e-32
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   130   8e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   130   1e-31
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   129   2e-31
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   129   2e-31
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   129   2e-31
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      129   2e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   128   3e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   128   3e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   128   3e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   128   4e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   128   5e-31
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   128   5e-31
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   127   6e-31
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    76   7e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    76   9e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    75   2e-13
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    75   3e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    74   3e-13
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    74   5e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    74   5e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    73   7e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    73   1e-12
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    72   2e-12
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    72   2e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    71   4e-12
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    71   4e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    70   7e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    69   2e-11
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    68   3e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    67   4e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   6e-11
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    67   8e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    66   2e-10
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    65   3e-10
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    64   6e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    64   6e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    64   7e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    64   7e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    64   1e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    62   4e-09
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    61   5e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    61   6e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    61   7e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    60   7e-09
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    61   8e-09
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    60   2e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   3e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    57   1e-07
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    57   1e-07
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    57   2e-07
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    56   2e-07
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    55   4e-07
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    55   5e-07
TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {O...    37   0.22 
CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly ...    32   5.7  
TBLA0H00200 Chr8 (23854..25128) [1275 bp, 424 aa] {ON} Anc_3.17 ...    31   9.2  

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1405 bits (3637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/693 (98%), Positives = 680/693 (98%)

Query: 1   MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIF 60
           MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIF
Sbjct: 1   MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIF 60

Query: 61  TSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILE 120
           TSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILE
Sbjct: 61  TSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILE 120

Query: 121 VHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRV 180
           VHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRV
Sbjct: 121 VHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRV 180

Query: 181 KNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ 240
           KNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ
Sbjct: 181 KNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ 240

Query: 241 KAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMW 300
           KAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMW
Sbjct: 241 KAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMW 300

Query: 301 AFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV 360
           AFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV
Sbjct: 301 AFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVV 360

Query: 361 LEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGK 420
           LEGGYNLDAIAISALSVAKILIG             KAEALEIIDKVISLQSKYWKCFGK
Sbjct: 361 LEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGK 420

Query: 421 RYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICS 480
           RYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICS
Sbjct: 421 RYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICS 480

Query: 481 PNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINI 540
           PNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINI
Sbjct: 481 PNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINI 540

Query: 541 PQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRS 600
           PQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRS
Sbjct: 541 PQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRS 600

Query: 601 VVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVL 660
           VVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVL
Sbjct: 601 VVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVL 660

Query: 661 RCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           RCDAEGMNNIIEERLEESTDFILDSFEEWSDSE
Sbjct: 661 RCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/689 (77%), Positives = 609/689 (88%), Gaps = 5/689 (0%)

Query: 5   LKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYF 64
           +K+EP   K+K+ D       +RPVIVP R A++ YTPLKTG+CYDVRMRYHAKIFTSYF
Sbjct: 43  VKEEPELKKQKITDVS-----ERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYF 97

Query: 65  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSK 124
           EYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+ DIGDLMLKIP+R AT EEILEVHSK
Sbjct: 98  EYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSK 157

Query: 125 EHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSL 184
           EH +FIEKT  MNREELLK TEKGDSVYFNNDS+A+++LP GG+IEACKAVVEGRVKNSL
Sbjct: 158 EHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSL 217

Query: 185 AVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFY 244
           AVVRPPGHHAEP+AAGGFCLFSNVA+AAKNILKNYPESVRRI+ILDWD+HHGNGTQKAFY
Sbjct: 218 AVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFY 277

Query: 245 DDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQ 304
           DDDRVLYISLHRFELGKYYPGTI GQYDQ GEGKG+GFNCNITWPVGGVGDAEY+WAFEQ
Sbjct: 278 DDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQ 337

Query: 305 VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGG 364
           VVMPM REFQPDLVIISSGFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GNLCVVLEGG
Sbjct: 338 VVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGG 397

Query: 365 YNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGN 424
           YNLDAIA SALSVAKILIG             K EA+EIIDKVI LQSKYWKCF +RYGN
Sbjct: 398 YNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGN 457

Query: 425 LGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLF 484
            G   ++ +   ++SK+FPLQ AIR++Q + LS+DF F TLPLL  E+P+D+V+CSPN++
Sbjct: 458 AGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVY 517

Query: 485 NETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSL 544
              T+++  HDTPEIWAKR+VI GTIDPS+S++VDS  +FIKW  E+KYG++DINIPQ+L
Sbjct: 518 QSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNL 577

Query: 545 FEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKS 604
           FEQENY+A++TSQE+L YIWDNYLK+FP++ KVAFIGIGDA +GIVHLLGHRDTRSVVKS
Sbjct: 578 FEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKS 637

Query: 605 VVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDA 664
           V++FI +K L+ LVPLV+ESL DWYFKNSLVF+D SH+ WGD EN+KPRKK+GR+LRC+ 
Sbjct: 638 VINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCET 697

Query: 665 EGMNNIIEERLEESTDFILDSFEEWSDSE 693
           +G+NNI+EER EE+TDFILDSFEEWSDSE
Sbjct: 698 DGINNIVEERFEEATDFILDSFEEWSDSE 726

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/702 (75%), Positives = 620/702 (88%), Gaps = 14/702 (1%)

Query: 5   LKQEPGESKRKLEDD-------------VASQDVKRPVIVPTRKAQIHYTPLKTGICYDV 51
           +KQE   SKRKLE+              V++   KR +IVP  + +IHYTPLKTG+CYDV
Sbjct: 7   VKQEDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDV 66

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG +DIG+LMLKIP+R
Sbjct: 67  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVR 126

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEA 171
            AT EE+L+VH+KEHLEFIEKT +MNREELLKETE GDSVYFN+DSY+ ++LPCGGAIEA
Sbjct: 127 EATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEA 186

Query: 172 CKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDW 231
           CKAVVEGRVKN+LAV+RPPGHHAEPE AGGFCLFSNVAVAA+NILKNYPESVRRILILDW
Sbjct: 187 CKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDW 246

Query: 232 DVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG 291
           D+HHGNGTQKAFY+DDRVLYISLHRFELGKYYPGTI GQYDQ GEGKG+GFNCNITWPVG
Sbjct: 247 DIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVG 306

Query: 292 GVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKS 351
           GVGDAEYM AFEQ+VMPM RE++PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKS
Sbjct: 307 GVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKS 366

Query: 352 LARGNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQ 411
           LARGNLCV LEGGYNLDAIA SALSVAKILIG             K EA+E+IDKVI +Q
Sbjct: 367 LARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQ 426

Query: 412 SKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNME 471
           SKYWKCF +R GN G   +  V   +++K+FPLQ AIRQEQFHQL +++GFVTLP+  +E
Sbjct: 427 SKYWKCF-RRLGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLE 485

Query: 472 VPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLER 531
           +P+D+V+CSP++F E+T+++ VHDTPEIWAKR+VITG IDPSTS+ VDS  +FIKW L R
Sbjct: 486 LPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLAR 545

Query: 532 KYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVH 591
           KYG++D+NIPQSLFEQ+NY+A++TSQE+LIY+WDN++K+FPSL+KVAF+G+GDA +GIVH
Sbjct: 546 KYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVH 605

Query: 592 LLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRK 651
           LLGHRDTRSVVK+V++F+G+K LKPLVPLV+ESLGDWYFKNSLVF+D ++ CW DNEN+K
Sbjct: 606 LLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKK 665

Query: 652 PRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           PR+KFGRVLRC+++G+NN +EER +E+TDFILDSFEEWSDSE
Sbjct: 666 PRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/691 (75%), Positives = 612/691 (88%), Gaps = 7/691 (1%)

Query: 10  GESKRKLEDDVASQDV-------KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTS 62
           G  KR+LE+    Q+        KR VIVP    +IHY+PLKTG+CYDVRMRYHAKIFTS
Sbjct: 16  GNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTS 75

Query: 63  YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVH 122
           YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV+D+GDLMLKIP+RAAT+EEILEVH
Sbjct: 76  YFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVH 135

Query: 123 SKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKN 182
           +KEHLEFIE TEKM+RE+LLKETEKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKN
Sbjct: 136 TKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKN 195

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKA 242
           SLAVVRPPGHHAEP+AAGGFCLFSNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+
Sbjct: 196 SLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKS 255

Query: 243 FYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAF 302
           FY DD+VLY+SLHRFE+GKYYPGTIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAF
Sbjct: 256 FYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAF 315

Query: 303 EQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE 362
           EQVVMPMGREF+PDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE
Sbjct: 316 EQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLE 375

Query: 363 GGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRY 422
           GGYNLDAIA SALSVAK+LIG             K E +E+IDKVI LQSKYW CF +R+
Sbjct: 376 GGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRH 435

Query: 423 GNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPN 482
            N G      +   ++SK+FPLQ AIRQ+Q H LS++F  VTLPL+NM++P ++V+C+PN
Sbjct: 436 ANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPN 495

Query: 483 LFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQ 542
           ++  TT+LVVVHDT +IWAKRNVI+GTID S+S+++D+  +FIKWGL+RKYGI+D+NIP 
Sbjct: 496 VYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPL 555

Query: 543 SLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVV 602
           SLFE +NY+ ++TSQE+LIY+WDNY+K+FP++ K+AF+GIGD+ +GIVHLLGHRDTR+V 
Sbjct: 556 SLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVT 615

Query: 603 KSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRC 662
           K+V++F+G K LKPLVPLV+E+L +WYFKNSL+F+++SH CW +NE+RKPRKKFGRVLRC
Sbjct: 616 KTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRC 675

Query: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           D +G+NN IEER EE+TDFILDSFEEWSD E
Sbjct: 676 DTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/668 (77%), Positives = 603/668 (90%)

Query: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85
           KR VIVP    ++HYTPL+TG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145
           ENGLINDPTLSGV+D+GDLMLKIP+RAAT+EEILEVH+KEHLEFIE TEKM+RE+LLKET
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205
           EKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEP+AAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265
           SNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+FY DD+VLYISLHRFE+GKYYPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278

Query: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFD 325
           TIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF+PDLVIISSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 326 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGXX 385
           AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAK+LIG  
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEP 398

Query: 386 XXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQ 445
                      K E +E+IDKV+ LQSKYW CF +R+ N G      +   ++SK+FPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 446 TAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNV 505
            AIRQ+Q H LS++F FVTLPL+NME+P + V+C+PN+   +T+LVVVHDT ++WAKRNV
Sbjct: 459 KAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNV 518

Query: 506 ITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWD 565
           I+GTID S+S+V+D+  +FIKWGL+RKYGI+D+NIP +LFE +NY+ ++TSQE+LIY+WD
Sbjct: 519 ISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578

Query: 566 NYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESL 625
           NY+K+FP++ K+A+IGIGD+ +GIVHLLGHRDTR+V K+V++F+G K LKPLVPLV+E+L
Sbjct: 579 NYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 626 GDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDS 685
            +WYFKNSLVFT++SH CW +NE+RKPRKKFGRVLRCD +G++N +EER EE+TDFILDS
Sbjct: 639 TEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDS 698

Query: 686 FEEWSDSE 693
           FEEWSD E
Sbjct: 699 FEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/668 (77%), Positives = 603/668 (90%)

Query: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85
           KR VIVP    +IHY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145
           ENGLINDPTLSGV+D+GDLMLKIP+RAAT+EEILEVH+KEHLEFIE TEKM+REELLKET
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKET 158

Query: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205
           EKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEP+AAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265
           SNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+FY DD+VLY+SLHRFE+GKYYPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFD 325
           TIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREF+PDLVIISSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 326 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGXX 385
           AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIA SALSVAK+LIG  
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 386 XXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQ 445
                      K E +E+IDKVI LQSKYW CF +R+ N G      +   ++SK+FPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 446 TAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNV 505
            AIRQ+Q H LS++F FVTLPL++M++P ++V+C+PN+    TI++VVHDT +IWAKRNV
Sbjct: 459 KAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNV 518

Query: 506 ITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWD 565
           I+GTID S+S+++D+  +FIKWGL+RKYGI+D+NIP +LFE +NY+ ++TSQE+LIY+WD
Sbjct: 519 ISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWD 578

Query: 566 NYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESL 625
           NY+K+FPS+ K+AFIGIGD+ +GIVHLLGHRDTR+V K+V++F+G K LKPLVPLV+E+L
Sbjct: 579 NYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 626 GDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDS 685
            +WYFKNSL+F+++SH CW +NE+RKPRKKFGRVLRCD +G+NNIIEER EE+TDFILDS
Sbjct: 639 SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDS 698

Query: 686 FEEWSDSE 693
           FEEWSD E
Sbjct: 699 FEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/688 (75%), Positives = 605/688 (87%), Gaps = 7/688 (1%)

Query: 13  KRKLEDDVASQDV-------KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFE 65
           KR LE+    Q+        KR VIVP    +IHY+PLKTG+CYDVRMRYHAKIFTSYFE
Sbjct: 19  KRTLENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFE 78

Query: 66  YIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKE 125
           YIDPHPEDPRRIYRIYKILAENGLINDPTLSGV+DIGDLMLKIP+RAAT+EEILEVH+KE
Sbjct: 79  YIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKE 138

Query: 126 HLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLA 185
           HLEFIE TEKM+RE+LLKETEKGDSVYFNNDSYA++RLPCGGAIEACKAVVEGRVKNSLA
Sbjct: 139 HLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA 198

Query: 186 VVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYD 245
           VVRPPGHHAEP+AAGGFCLFSNVAVAAKNILKNYPESVRRI+ILDWD+HHGNGTQK+FY 
Sbjct: 199 VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQ 258

Query: 246 DDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQV 305
           DD+VLY+SLHRFE+GKYYPGTIQGQYDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQV
Sbjct: 259 DDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQV 318

Query: 306 VMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
           VMPMGREF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVLEGGY
Sbjct: 319 VMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGY 378

Query: 366 NLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNL 425
           NLDAIA SALSVAK+LIG             K E +E+IDKVI LQSKYW CF +R+ N 
Sbjct: 379 NLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANS 438

Query: 426 GLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFN 485
           G      +   ++SK+FPLQ AIRQ+Q   LS +F FVTLPL+NM +P ++ +C+PN+F 
Sbjct: 439 GCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFE 498

Query: 486 ETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLF 545
              +LVVVHDT ++WAKRNVI+GTID S+S+++D+  +FIKWGL+RKYGI+D+NIP +LF
Sbjct: 499 SNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLF 558

Query: 546 EQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSV 605
           E +NY+ ++TSQE+LIY+WDNY+K+FP++ K+AFIGIGD+ +GIVHLLGHRDTR+V K+V
Sbjct: 559 EADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTV 618

Query: 606 VSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAE 665
           ++F+G K LKPLVPLV+E+L +WYFKNSL+F+++SH CW +NE+RKPRKKFGRVLRCD +
Sbjct: 619 INFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTD 678

Query: 666 GMNNIIEERLEESTDFILDSFEEWSDSE 693
           G++N IEER EE+TDFILDSFEEWSD E
Sbjct: 679 GLSNTIEERFEEATDFILDSFEEWSDDE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/696 (74%), Positives = 600/696 (86%), Gaps = 13/696 (1%)

Query: 11  ESKRKLEDDVASQDVKRP-------------VIVPTRKAQIHYTPLKTGICYDVRMRYHA 57
           + KRK+E+     D K+              VIVP     +HYTPLKT +CYDVRMRYHA
Sbjct: 19  QVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHA 78

Query: 58  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEE 117
           KIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+++IGDLMLKIP+R AT EE
Sbjct: 79  KIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEE 138

Query: 118 ILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVE 177
           ILEVHSKE+LEF+E++ +M REELLKETEKGDSVYFNNDSY +++L CGG I+ACKAVVE
Sbjct: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVE 198

Query: 178 GRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGN 237
           GRVKN+LAVVRPPGHHAEPEA GGFCLFSNVAVAA+NILK YPESVRRILILDWD+HHGN
Sbjct: 199 GRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGN 258

Query: 238 GTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAE 297
           GTQKAFY+D RVLYISLHRFE+GKYYPGTI G+YDQ GEGKG+GFNCNITWPVGGVGDAE
Sbjct: 259 GTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAE 318

Query: 298 YMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNL 357
           YM AFEQ+VMPM REFQPDLVIISSGFDAADGDTIGQCHVTPSCYG MTHMLKSLARGNL
Sbjct: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNL 378

Query: 358 CVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKC 417
           CV LEGGYNLDAIAISALSVAK+LIG             K EA+E+ID VI  QSKYWKC
Sbjct: 379 CVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKC 438

Query: 418 FGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSV 477
           F +++GN G      V   ++SKSFPLQTAIRQEQF QLS+++GFVTLP+  +E+P DSV
Sbjct: 439 FQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSV 498

Query: 478 ICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMD 537
           +CSP +F ++TI+++VHDTPEIWAKR+VITG IDPSTS++VDS  +F KW + RKYG++D
Sbjct: 499 LCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVID 558

Query: 538 INIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRD 597
           +NIPQSLFEQ+NY+A++TSQE+L+YIWDNY+K+FPSL KVAF+G GDA AGIVHLLGHRD
Sbjct: 559 VNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRD 618

Query: 598 TRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFG 657
           TR+ VK+VVSFIG+K LKPLVPLV+ESL DWYFKNSL+FTD +H CW DNE++KPRKKFG
Sbjct: 619 TRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFG 678

Query: 658 RVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           RVLRCD +G+N+ +EER EE+TDFILD FEEWSDSE
Sbjct: 679 RVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/681 (74%), Positives = 600/681 (88%), Gaps = 6/681 (0%)

Query: 13  KRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPE 72
           KRK++ +       R +IVP R AQIHYTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPE
Sbjct: 15  KRKIDPE------SRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPE 68

Query: 73  DPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEK 132
           DPRRIYRIYKILAENGLI DPTLSG++DIGDLMLKIP+R AT+EEILEVHSKEHL+FIE 
Sbjct: 69  DPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIES 128

Query: 133 TEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGH 192
           T KMNRE+LLK TE GDSVYFN+DSYA+++LP GGAIEACKAVVEGRVKN+LAVVRPPGH
Sbjct: 129 TSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGH 188

Query: 193 HAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYI 252
           HAEPEAAGGFCLFSNVA+AAKNILKNYPESVR+ILILDWD+HHGNGTQKAFYDDDR+LY+
Sbjct: 189 HAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYV 248

Query: 253 SLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGRE 312
           SLHRF++GKYYPGTI G+YDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQ+VMPMGRE
Sbjct: 249 SLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGRE 308

Query: 313 FQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAI 372
           FQPDLVIIS+GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IAI
Sbjct: 309 FQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAI 368

Query: 373 SALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENV 432
           SALSVAKILIG             K E +E+IDKV+ +QSKYWKCF  ++GN G   +  
Sbjct: 369 SALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQ 428

Query: 433 VKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVV 492
           +   + +K+FPLQ+AIRQ+Q   LS++F F  LP+   E+P+D+++CS N++   TI++ 
Sbjct: 429 INNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIIC 488

Query: 493 VHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTA 552
           VHDTPEIWAKR+ I GTIDPS+S++VDS  + IKW +ERKYG++DINIPQ+L EQENY +
Sbjct: 489 VHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYS 548

Query: 553 VLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKK 612
           ++T+QE+LI +WDNYLK+FP++ K+AF+GIGDA +GIVHLLGHRDTRSVVK+V++F+G+K
Sbjct: 549 IITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQK 608

Query: 613 SLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIE 672
            LKPLVPLV+ESLG+WYFKNSLVF++ +H  WGD EN+KPRKK+GRVLRCD +G++NI+E
Sbjct: 609 QLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIME 668

Query: 673 ERLEESTDFILDSFEEWSDSE 693
           ER EE+TDFILDSFEEWSDSE
Sbjct: 669 ERFEEATDFILDSFEEWSDSE 689

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1115 bits (2883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/701 (74%), Positives = 600/701 (85%), Gaps = 11/701 (1%)

Query: 2   GVELKQEPGESKR--KLEDDVASQDVKR-----PVIVPTRKAQIHYTPLKTGICYDVRMR 54
            VE+K E    ++   +ED+V S+  KR     PVIVP    +IHYT LKTG+CYDVRMR
Sbjct: 14  AVEVKMEDSLKRKVDTMEDEVESR--KRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMR 71

Query: 55  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAAT 114
           YHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGV++IG+LMLKIP+R AT
Sbjct: 72  YHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREAT 131

Query: 115 AEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKA 174
           AEEIL+VH+KEHL F+EKT KM RE+LLKETE GDSVYFNNDS  +++L CGGAIEACKA
Sbjct: 132 AEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKA 191

Query: 175 VVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVH 234
           VVEGRVKN+LAV+RPPGHHAEPE AGGFCLFSNVAVAA+NILKNYPESVRRI+ILDWD+H
Sbjct: 192 VVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIH 251

Query: 235 HGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVG 294
           HGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT+ G Y+Q GEGKG+GFNCNI WP GG+G
Sbjct: 252 HGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLG 311

Query: 295 DAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR 354
           DAEYMWAF+QVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLAR
Sbjct: 312 DAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLAR 371

Query: 355 GNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKY 414
           GNLCVVLEGGYNLD+IA SAL VAKILIG             K EA+E I+ VI  QSKY
Sbjct: 372 GNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKY 431

Query: 415 WKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQ 474
           W CF   + N G   +  V    +SK+FPLQ AIRQEQ  QLSE FGFVTLPLLNMEVPQ
Sbjct: 432 WNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQ 491

Query: 475 DSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYG 534
           D+VICSPN+++  T++V VHDTPEIWA+RN ITGTIDPSTS++VD+  + IKW L+RKY 
Sbjct: 492 DTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYS 551

Query: 535 IMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLG 594
           ++D+NIPQSLFEQ+NY+A++TSQE+L+YIWDNYLK+FPSL KVAFIG+GDA +GIVHLLG
Sbjct: 552 VIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLG 611

Query: 595 HRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKP 652
           HRDTRSVVK+ VSF+  K LK LVPLV+ESLG+WYFKNSLVFT  +HSCWG   NEN+KP
Sbjct: 612 HRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKP 671

Query: 653 RKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           RK+FGRVL+CD  GMNNI+EER +E+TDFILDSFEEWSDSE
Sbjct: 672 RKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/691 (72%), Positives = 599/691 (86%), Gaps = 5/691 (0%)

Query: 5   LKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYF 64
           +K+E  +S++  E   +S   KR +IV     ++ YTPLKTG+CYDVRMRYHAKIFTSYF
Sbjct: 6   VKRENPDSQKPAE---SSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYF 62

Query: 65  EYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSK 124
           EYIDPHPEDPRRIYRIYKILAENGLI DP LSG++DIGDLMLKIP+R AT++E+LEVHSK
Sbjct: 63  EYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSK 122

Query: 125 EHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSL 184
           EHLEFIE   KM+ +ELLK TE GDSVYFNNDS ++++L CGGAIEACKAVVEGRVKN+ 
Sbjct: 123 EHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAF 182

Query: 185 AVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFY 244
           AVVRPPGHH+EPE+AGGFCLFSNVAVA+KNIL+NYPESVRRI+ILDWD+HHGNGTQKAFY
Sbjct: 183 AVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFY 242

Query: 245 DDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQ 304
           DDDRVLYISLHRFELGKYYPGT QG YD+ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQ
Sbjct: 243 DDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 302

Query: 305 VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGG 364
           VVMPM REF+PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLA GNLCVVLEGG
Sbjct: 303 VVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGG 362

Query: 365 YNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGN 424
           YNLDAIA SALSVAK+LIG             K EA+EII+KVI LQSKYWKCF +R+GN
Sbjct: 363 YNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGN 422

Query: 425 LGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLF 484
            G   E  +   + + +FPLQ+AIRQ+QF  LS++FGFV  PL  M++  D+VICSP ++
Sbjct: 423 SGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVY 482

Query: 485 NETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSL 544
           N+ TI+++V DTPEIWAKR+VI GTIDPS S++ D+   FIKW +ER YG++D+NIPQSL
Sbjct: 483 NKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSL 542

Query: 545 FEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKS 604
           FEQ+NY+A++T+QE++ ++WDNY++FF S +K+AF+G+GDA +GIVHLLGHRDTRS VKS
Sbjct: 543 FEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKS 602

Query: 605 VVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRC 662
           V++FI +K+LKPL+PLV+E+LGDWYFKNSLVF+D +H+CWGD  NEN+KPRKKFGRVLRC
Sbjct: 603 VINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRC 662

Query: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           +++G+ NIIEER EE+TDF+LDSFEEWS+S+
Sbjct: 663 NSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/705 (71%), Positives = 589/705 (83%), Gaps = 15/705 (2%)

Query: 3   VELKQE-PGESKRKLEDDVASQDV-----------KRPVIVPTRKAQIHYTPLKTGICYD 50
            E+KQE P E    L+ D  S  +           KRP IVP  + ++HYTPLKTG+CYD
Sbjct: 5   AEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYD 64

Query: 51  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPI 110
           VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGV+ IGDLMLKIP+
Sbjct: 65  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPV 124

Query: 111 RAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIE 170
           R AT EEIL+VH+KEHLEFI KT  M R++LLKETEKGDSVYFNNDSY +++L CGGAIE
Sbjct: 125 REATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIE 184

Query: 171 ACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILD 230
           ACKAVVEGRVKN+LAVVRPPGHHAEPE AGGFCLFSNVAVAA+NILKNYPESVR+I++LD
Sbjct: 185 ACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLD 244

Query: 231 WDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV 290
           WDVHHGNGTQKAFYDDDRVLYISLHR ELGKYYPGTI G  D++GEGKG+GFNCNI WP 
Sbjct: 245 WDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPW 304

Query: 291 GGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLK 350
            GVGD+EY+WAFEQV+MPMGREF+PDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLK
Sbjct: 305 KGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLK 364

Query: 351 SLARGNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISL 410
           SLARGNLC VLEGGY+LD+IA SAL+VAK+LIG             K EA+E+ID VI  
Sbjct: 365 SLARGNLCAVLEGGYSLDSIAKSALAVAKVLIG-EPPDELPVVKQPKLEAVEVIDSVIKT 423

Query: 411 QSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNM 470
           QSKYWKCF   +GN G   +       ++K+FPLQ AIRQ+Q   L+ +F FVTLPL   
Sbjct: 424 QSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKK 483

Query: 471 EVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLE 530
           E+P D+ ICSPN+++ + I+V VHDTP IWA+R+  TGTIDPSTS++VD+  + IKW   
Sbjct: 484 ELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASS 543

Query: 531 RKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIV 590
           R YG++DINIPQSL EQ+NY+AV+T+QE+L++IWDNYLK+FPSL +VAF+ IGDA +G+V
Sbjct: 544 RNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVV 603

Query: 591 HLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NE 648
           HLLGHRDTRSVVKS VSF+ ++ L+PL+PLV+E+L DWYFKNSLVF    H+CWG+  NE
Sbjct: 604 HLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNE 663

Query: 649 NRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           N+KPRKKFGRVL+CD++G+NNI+EER EE+TDFILD+FEEWSDSE
Sbjct: 664 NKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/691 (70%), Positives = 591/691 (85%), Gaps = 7/691 (1%)

Query: 10  GESKRKLEDD-VASQDV--KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEY 66
           G +KRK E++ + S +V  KR VIVPT+K Q+HY PLKTG+CYDVRMRYHAKIFTSYFEY
Sbjct: 12  GSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEY 71

Query: 67  IDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEH 126
           IDPHPEDPRRIYRIYKILAENGLIND  LSGV+DIGD+MLKIP+R ATA+EILEVHS+EH
Sbjct: 72  IDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREH 131

Query: 127 LEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAV 186
           LEF+E T  MNRE LLKETEKGDSVYFNNDSY +++L CGGAIEACKAVVEG+VKN+LAV
Sbjct: 132 LEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAV 191

Query: 187 VRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDD 246
           VRPPGHH+EPE++GGFCLFSNVAVAAKNILKNYPESVR+I+ILDWD+HHGNGTQKAFY D
Sbjct: 192 VRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQD 251

Query: 247 DRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVV 306
           +RVLY+SLHRFE GKYYPGT+QGQYDQ GEGKG+GFNCNITWP GGVGDAEYMWAFEQ+V
Sbjct: 252 ERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIV 311

Query: 307 MPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYN 366
           MPMGREFQPDLVIISSGFDAADGD IGQCHVTPSCYGHMTHMLKSLARGNL VVLEGGYN
Sbjct: 312 MPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYN 371

Query: 367 LDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLG 426
           LD+IAISALSVAK LIG             K EALE+I KVI +QSKYWKCF +R+GN  
Sbjct: 372 LDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYN 431

Query: 427 LPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNE 486
           +    V    + +K+FPLQTAIRQ+Q++ L +++ FV  P  N+++P D ++CSPN+   
Sbjct: 432 INFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTA 491

Query: 487 TTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLF- 545
            T++++VHDTP+IW ++++I+ T+DP +S+++DS  +F+KW   RKYGI+D+NIPQSL  
Sbjct: 492 ETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIY 551

Query: 546 ---EQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVV 602
                +NY++++ +QEIL+++WDN++KF   + K+AFIG+GD+ +G+VHLLGHRDT+  V
Sbjct: 552 GDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERV 611

Query: 603 KSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRC 662
           K+V++F+  K LKPLVPLV+ESL DWYFKNSLVF++ +H CWGD EN+KPRKK+GRVLRC
Sbjct: 612 KAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRC 671

Query: 663 DAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           D +G+N+ IEER +E+TDFILDSFEEWSDSE
Sbjct: 672 DTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/698 (71%), Positives = 595/698 (85%), Gaps = 11/698 (1%)

Query: 5   LKQEPGESKRKLEDDVASQD-------VKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHA 57
           LKQE G  KR  E+ +  ++       VKRPVIVP  +A++HYTPLKTG+CYDVRMRYHA
Sbjct: 13  LKQENG-FKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHA 71

Query: 58  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEE 117
           KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGV+DIGDLMLKIP R AT EE
Sbjct: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEE 131

Query: 118 ILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVE 177
           IL+VH+ EHLEF+ KT  M RE+LLKETEKGDSVYFNNDSY +++L CGGAIEAC+AVVE
Sbjct: 132 ILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVE 191

Query: 178 GRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGN 237
           GRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESV++I+ILDWDVHHGN
Sbjct: 192 GRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGN 251

Query: 238 GTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAE 297
           GTQKAFY+DDRVLY+SLHR ELGKYYPGTI G  D++GEGKG+GFNCNI WP  GVGDAE
Sbjct: 252 GTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAE 311

Query: 298 YMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNL 357
           Y+WAFEQVV+PMGREFQPDLVIISSGFDAADGDT+GQCHVTPSCYGHMTHMLKSLARGN+
Sbjct: 312 YIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNI 371

Query: 358 CVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKC 417
           C VLEGGY+LD+IA SAL VAK+LIG             K EA+E+ID VI +QS+YW+C
Sbjct: 372 CAVLEGGYSLDSIAKSALGVAKVLIG-EPPDELPVVKQPKPEAVEVIDAVIKMQSRYWQC 430

Query: 418 FGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSV 477
           F   + N G   +  V   +++++FPLQTAIRQ+Q   L+ ++ FVTLPL+  E+P D+ 
Sbjct: 431 FKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTA 490

Query: 478 ICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMD 537
           +CSPN+++  +I+V VHDTPEIWA+R+  TGTIDPSTS++VD+  + IKW  +R YG++D
Sbjct: 491 LCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVID 550

Query: 538 INIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRD 597
           INIPQSL EQ+NY+AVLT+QE+L+YIWD+YLK+F SL+KVAF+ IGDA +G+VHLLGHRD
Sbjct: 551 INIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRD 610

Query: 598 TRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDN--ENRKPRKK 655
           TR+VVK+ +SFI ++ L+PLVPLV+ESL DWYFKNSLVF    H+CWG++  EN+KPRKK
Sbjct: 611 TRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKK 670

Query: 656 FGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           FGRVL+C+++G+NNI+EER EE+TDFILD+FEEWSDSE
Sbjct: 671 FGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/676 (72%), Positives = 576/676 (85%), Gaps = 4/676 (0%)

Query: 20  VASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 79
           VA Q  KRP+IVP  K +IHY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR
Sbjct: 33  VAQQ--KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 90

Query: 80  IYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNRE 139
           IYKILAENGLI DPTLSGV+DIG+LMLKIPIR AT +EIL VHSKEH+EF++ T  M+RE
Sbjct: 91  IYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSRE 150

Query: 140 ELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAA 199
           +LLKETE GDSVY+NNDS  +++L CGGAIEACKAVVEGRVKN+LAVVRPPGHHAEPE A
Sbjct: 151 QLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVA 210

Query: 200 GGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFEL 259
           GGFCLFSNVAVAA+NILKNYPESVR+++ILDWD+HHGNGTQ+AFY+D+RVLY+SLHR+EL
Sbjct: 211 GGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYEL 270

Query: 260 GKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVI 319
           G+YYPGT  G Y+Q GEGKG+GFNCNI W  GGVGDAEYMWAFEQ+V+PMGREFQPDLVI
Sbjct: 271 GRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVI 330

Query: 320 ISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAK 379
           ISSGFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GN+CVVLEGGYNLD+IA SAL V K
Sbjct: 331 ISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVK 390

Query: 380 ILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMS 439
           +LIG             K EA+  I+ VI  Q+KYW CF  ++GN G+  +  V   +  
Sbjct: 391 VLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTF 450

Query: 440 KSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEI 499
           K+FPLQ+A+RQEQF +LS+++ FVTLPLL+ME+  D++ICSPN+    T+++ VHDTPE+
Sbjct: 451 KNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEV 510

Query: 500 WAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEI 559
           WAKRN +TG IDPSTS++VD+      W L R YGI+DINIPQSLFE +NY+AVLTSQE+
Sbjct: 511 WAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEV 570

Query: 560 LIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVP 619
           L Y+WD+YLKFF  LT+VAF+GIGDA +G VHLLGHRDTRS+VK  +SF  KK L+PLVP
Sbjct: 571 LSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVP 630

Query: 620 LVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRCDAEGMNNIIEERLEE 677
           LV+ES+ DWYFKNSL+FT   HSCWG   N+++KPRKKFGRVL+C+++GMNNI+EER EE
Sbjct: 631 LVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEE 690

Query: 678 STDFILDSFEEWSDSE 693
           +TDFILDSFEEWSDSE
Sbjct: 691 ATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/675 (69%), Positives = 568/675 (84%), Gaps = 2/675 (0%)

Query: 21  ASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 80
           +  + +RPVIVP  K +I Y+ LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89

Query: 81  YKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREE 140
           YKILAENGLI DPTLSG + IGDLM+K+P+R A  EEIL+VHS++HL+FI +TE++ RE 
Sbjct: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149

Query: 141 LLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAG 200
           LLKETE GDSVYFNNDSY +++L CGGAIEACKAVVEGRVKNS+AVVRPPGHHAEPE AG
Sbjct: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209

Query: 201 GFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELG 260
           GFCLFSNVAVAA N+LK+YPESVR+I+I+DWD+HHGNGTQKAFYDDDRVLY+SLHR++LG
Sbjct: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269

Query: 261 KYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVII 320
           KYYPGTI G YDQ GEGKG+GFNCNITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+I
Sbjct: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329

Query: 321 SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKI 380
           SSGFDAADGDTIGQCHVTP+CYGHMTHML SLA+GNLCVVLEGGYNLD+IA SAL V K+
Sbjct: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389

Query: 381 LIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSK 440
           L+G               EA ++I+ VI  QSKYW CF  R+GN G+  ++ + + + ++
Sbjct: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449

Query: 441 SFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIW 500
           +FPLQ AIR+ Q  QLS  F FV LP+L++ +P ++++C+  + +  T++V+VHDTPEIW
Sbjct: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509

Query: 501 AKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEIL 560
           ++R+  TG IDPS+S++VD+  + I W ++R+YGI+DINIPQ+LFE  NY  V +SQEIL
Sbjct: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569

Query: 561 IYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPL 620
           IY+WDNYLKFF +L KVAFIGIGDA  GIVHLLGHRDTRSVVK  +SF+ KK LK +VPL
Sbjct: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629

Query: 621 VNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRCDAEGMNNIIEERLEES 678
           ++E+LGDWYFKNSLVFT  +HSCWG   NEN+K RKK+GRVL+ D +GM NI +ER EE+
Sbjct: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689

Query: 679 TDFILDSFEEWSDSE 693
           TDFILDSFEEWS+SE
Sbjct: 690 TDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1029 bits (2661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/704 (69%), Positives = 573/704 (81%), Gaps = 17/704 (2%)

Query: 7   QEPGESKRKLEDDVASQDV------------KRPVIVPTRKAQIHYTPLKTGICYDVRMR 54
           +E  + KRKLE+     +             KRPVIVP  + +I Y PLKTG+CYDVRMR
Sbjct: 2   EERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMR 61

Query: 55  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAAT 114
           YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+++IG+LM KIP+R AT
Sbjct: 62  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREAT 121

Query: 115 AEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKA 174
            EEIL VHSKEH+EF++ T  M+RE+LLKETE GDSVY+NNDS  ++RL CGGAIEACKA
Sbjct: 122 EEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKA 181

Query: 175 VVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVH 234
           VVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNYPESVRR++ILDWD+H
Sbjct: 182 VVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIH 241

Query: 235 HGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVG 294
           HGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT  G YDQ G+GKG+GFNCNI W   GVG
Sbjct: 242 HGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVG 301

Query: 295 DAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR 354
           DAEYMWAFEQVV+PMGREFQPDLVIISSGFDAADGDTIGQCHV+P+CYGH+THMLKSLAR
Sbjct: 302 DAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLAR 361

Query: 355 GNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDK-VISLQSK 413
           GN+CVVLEGGYNLD+IA SAL VAK+LIG             K EA+  ID  ++  QSK
Sbjct: 362 GNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSK 421

Query: 414 YWKCFGKRYGNLGLP-SENVVKALMMSKSFPLQTAIR-QEQFHQLSEDFGFVTLPLLNME 471
           YW CF  R+GN G+   E  V   + SK+FPLQ       QF +L++++ FVTLPLLNME
Sbjct: 422 YWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNME 481

Query: 472 VPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLER 531
           +P D++ICSPN+     I++ VHDTPEIWA+R+ +TG IDPSTS++VD+    I W L R
Sbjct: 482 LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGR 541

Query: 532 KYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVH 591
            YG++DINIPQSLFEQ+NY+AVL+SQE++ Y+WD+YLK FP L +VAF+GIGDA +G VH
Sbjct: 542 NYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVH 601

Query: 592 LLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGD--NEN 649
           LLGHRDTRSVVK  ++F  KK L+PLVPLV+ESLGDWYFKNSLVFT   H CWG   N++
Sbjct: 602 LLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDS 661

Query: 650 RKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           +KPRKKFGRVLR   +GMNNI+EERLEE+TDFILDSFEEWS+SE
Sbjct: 662 KKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score = 1029 bits (2661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/694 (68%), Positives = 579/694 (83%), Gaps = 15/694 (2%)

Query: 13  KRKLEDDVASQDV-------------KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKI 59
           KRKL+D+     V             KRPVIVPT+K  +HYTPLKTGICYDVRMRYHAKI
Sbjct: 8   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 67

Query: 60  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEIL 119
           FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP+L+GV+DIGDLMLKIP+R AT EEIL
Sbjct: 68  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 127

Query: 120 EVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGR 179
           +VH++EH++F+E TEKM REELL +TEKGDSVY NNDSY ++RL CGGAIEACKAVVEGR
Sbjct: 128 DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 187

Query: 180 VKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGT 239
           VKN+LA+VRPPGHHAEP+AAGGFCLFSNV+VAAK+ILK YPESVR+ILI+DWD+HHGNGT
Sbjct: 188 VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 247

Query: 240 QKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYM 299
           QKAFY+DD VLYISLHRFELGK+YPG  +G YD++G+GKGKGFNCNITWPV GVGD EY+
Sbjct: 248 QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 307

Query: 300 WAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCV 359
           WAFEQ+V+PM REF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCV
Sbjct: 308 WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 367

Query: 360 VLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDKVISLQSKYWKCFG 419
           VLEGGYNLD+I+ SAL+VAKILIG             K   LE+I+KVI +QSKYWKCF 
Sbjct: 368 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 427

Query: 420 KRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVIC 479
           +++GN G   EN +++  + K FPLQ AIR  Q     +DFG ++L L N+ +P++S+IC
Sbjct: 428 RKFGNFGGEYENAIES-QIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLPKNSIIC 486

Query: 480 SPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDIN 539
           S N F   ++ V++HDTPE+W  R++ITG IDPSTS++ DS  +FI W +ER+  ++DIN
Sbjct: 487 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 546

Query: 540 IPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTR 599
           IP+S FE +NY++ L SQ+++I +WDN+ K+  SL K+ FIGIG+A++GIVHLLG RDTR
Sbjct: 547 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 606

Query: 600 SVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRV 659
           +V K+ ++F+G  SLKP+VP ++ESLGDWYFKNSLVFTDH H CW +N+ +KPRKK+GRV
Sbjct: 607 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 665

Query: 660 LRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           LRCD +G++NIIEER EE+TDFILD+F+EWSD+E
Sbjct: 666 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/656 (68%), Positives = 556/656 (84%)

Query: 36  AQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTL 95
           + + YTPLKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP L
Sbjct: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62

Query: 96  SGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNN 155
           SG++DIGDLM KIP+R AT+EEILEVH KE LE++EKT+ +NR+ELL +TE GDSVYFNN
Sbjct: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122

Query: 156 DSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNI 215
           DSY +++L CGGAIEACKA+V+G+VKNSLA+VRPPGHH+EPE AGGFCLFSNVAVA KNI
Sbjct: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182

Query: 216 LKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIG 275
           LKNYP+ V++++I+DWD+HHGNGTQKAFY+DDRVLY+SLHRFELGKYYPGTI GQYDQ+G
Sbjct: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242

Query: 276 EGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQC 335
           EGKG+GFNCNI W VGG+GDAEY+WAFEQ+VMPMGREF+PDLVI+SSGFDAADGDTIG+C
Sbjct: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302

Query: 336 HVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXX 395
           HVTPSCYGHMTHMLKSLA G LCVVLEGGYNLDAIA SAL+VAK+LIG            
Sbjct: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362

Query: 396 XKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQ 455
            K EA+E+ID+VI L+SKYWKCF ++  N     +  +     +K FP+Q AIR +Q   
Sbjct: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422

Query: 456 LSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTS 515
           L+ D+  V LPL+N  +P+D+V+CS ++      ++ VHDTPEIW+KR+ I G ID S S
Sbjct: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482

Query: 516 LVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLT 575
           L +D+  +F  W L+R YGI+D+NIPQ+L+EQ+NY+A LT+QE+LI +WDN LK+FP++ 
Sbjct: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542

Query: 576 KVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLV 635
           K+A+IG+G+A +G+VHLLGHRDTRSVVKSV+ F+GKK LK LVPLV ESL DWYFK SL+
Sbjct: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602

Query: 636 FTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSD 691
           F D +HSCWG+N+++KPRK++GRVLRCD++G+ ++IEER EE+TDFI+DS +EW++
Sbjct: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/485 (72%), Positives = 406/485 (83%), Gaps = 14/485 (2%)

Query: 1   MGVELKQEPGESKRKLED------DVASQDV--------KRPVIVPTRKAQIHYTPLKTG 46
           M ++++   G  KR  E+      +V++ ++        K+ +IVP +  +IHY PLKTG
Sbjct: 1   MSIKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTG 60

Query: 47  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLML 106
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV++IGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLML 120

Query: 107 KIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCG 166
           K+PIR AT  EILEVHS EH +++EKT   NRE+LLKETE GDSVYFNNDS+ +++L CG
Sbjct: 121 KLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCG 180

Query: 167 GAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRI 226
           GAIEACKAVVEGRVKN++AVVRPPGHH+EPE+AGGFCLFSNVAVA KNILKNYPESVR++
Sbjct: 181 GAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240

Query: 227 LILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNI 286
           LILDWD+HHGNGTQKAFY+DD VLYISLHRFELGKYYPGTIQGQYDQ GEGKG+GFNCNI
Sbjct: 241 LILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNI 300

Query: 287 TWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMT 346
           TWP+G VGDAEYMWAFEQVVMPM REFQPDLVIISSGFDAADGDTIGQCHV+PSCYGHMT
Sbjct: 301 TWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMT 360

Query: 347 HMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGXXXXXXXXXXXXXKAEALEIIDK 406
           HMLKSLARGNLCVVLEGGYNLDAIA SALSV+KILIG             K E +E+IDK
Sbjct: 361 HMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDK 420

Query: 407 VISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLP 466
           +I LQSKYWKCF +R+GNLG   +  +   ++SK+FPLQTAIR  Q  +L ++  F+TLP
Sbjct: 421 IIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLP 480

Query: 467 LLNME 471
           + N +
Sbjct: 481 IKNFQ 485

 Score =  325 bits (832), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 185/220 (84%)

Query: 474 QDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKY 533
           +++++CSP +    T++V+VHD+P++W KR+V TG +D S+++++DS  +FIKW L+R Y
Sbjct: 576 ENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNY 635

Query: 534 GIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLL 593
           G++DINIPQ+LFEQ+NY+++L +QE L+  WDNYLK+FP + K+ FIG GDA AGIVHLL
Sbjct: 636 GVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLL 695

Query: 594 GHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPR 653
           GHRDTRSVVKSV++F+GKK LK LVPLV+E+L DWYFKNSLVFTD +H  W DNEN+KPR
Sbjct: 696 GHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPR 755

Query: 654 KKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           KKFGRVLR   +G+ N+IEER +E+TDFILDSFEEWSD E
Sbjct: 756 KKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  526 bits (1356), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 235/298 (78%), Positives = 272/298 (91%)

Query: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85
           KR VIVP R+ ++HYTPLKTG+CYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145
           ENGLI D  LSG++DIGD+MLKIP+R AT EEIL VH++EHL+FIE  E  +REEL+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205
           EK DSVY+NNDSY +++L CGG IEAC+AVVEGRVKNSLA+VRPPGHHAEP+AAGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265
           SNV+VAA++IL+ YPESVR+ILILDWD+HHGNGTQKAFY+D+ VLYISLHR+E   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSG 323
           TI G+YDQ+GEGKG+GFNCNITWPVGGVGDAEYMWAFE VVMP+GREF+PDLVI+SSG
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  264 bits (674), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 175/239 (73%)

Query: 455 QLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPST 514
           +   D   V+     M+  +  V+ S  +F   T++++VHDTPE+W  R++ITG +DPST
Sbjct: 338 EFRPDLVIVSSGXXXMKPHEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPST 397

Query: 515 SLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSL 574
           S+++D+  +FIKW  +R Y I+DINIP+S  E+E +++   + EI++ +WDN+L++  +L
Sbjct: 398 SVLIDTSMKFIKWAADRNYSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTL 457

Query: 575 TKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSL 634
           TK+ FIGIG++  GIVHL+G RD R + K+V++F+G   LK L    +E++ DWYFKNSL
Sbjct: 458 TKICFIGIGESYQGIVHLIGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSL 517

Query: 635 VFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693
           VFT+ SH+CW ++E ++PRKKFGRVL+ D++G+ +II ER +E+TDFILD+FEEWSD E
Sbjct: 518 VFTNDSHNCWKESEEKRPRKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 163/326 (50%), Gaps = 30/326 (9%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y  R+ YH     S + Y   HP  P R      +++  GL N            +M
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IM 69

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET----EKGDSVYFNNDSYATS 161
                R AT EE+L+ HS++++EF+ K    N  ++ + T      GD      + Y   
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYEYC 129

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
           +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 130 KLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP 187

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
               R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD+IG  +GK
Sbjct: 188 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEGK 240

Query: 281 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTP 339
            F  N+  P+  G+ D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  ++  
Sbjct: 241 HFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNI 298

Query: 340 SCYGHMTHMLKSLARGNLCVVLEGGY 365
             +G     ++S     + VV  GGY
Sbjct: 299 KAHGECVKFIRSFGIP-MVVVGGGGY 323

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 167/337 (49%), Gaps = 30/337 (8%)

Query: 35  KAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPT 94
           K +  Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL     
Sbjct: 9   KTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL----- 63

Query: 95  LSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTE-----KMNREELLKETEKGD 149
               + I DL      R AT +E+LE HS +++EF+ K       KM R  L K     D
Sbjct: 64  ----HKIMDLY---ETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDD 116

Query: 150 SVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNV 208
              F    +  S L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++
Sbjct: 117 CPIFQG-IFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDI 173

Query: 209 AVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQ 268
            +A  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  
Sbjct: 174 VLAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 226

Query: 269 GQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAAD 328
           G +D+IG  +GK F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+  
Sbjct: 227 GDFDEIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG 285

Query: 329 GDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
            D +G  ++    +G     +KS     L VV  GGY
Sbjct: 286 HDRLGCFNLNIRAHGECVKFVKSFGIPML-VVGGGGY 321

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 95/326 (29%), Positives = 168/326 (51%), Gaps = 30/326 (9%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKP------FRLMLTDHLVSRYGLHKVMDLYE-- 72

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFNNDSYATS 161
                RAAT EE+L  H++++++F+      N  +L    L++   GD        +  S
Sbjct: 73  ----TRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
               R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+IG  +GK
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 281 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTP 339
            F+ N+  P+  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 240 HFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 297

Query: 340 SCYGHMTHMLKSLARGNLCVVLEGGY 365
             +G     +KS     LCV   GGY
Sbjct: 298 RAHGECVKFVKSFGIPMLCVG-GGGY 322

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  142 bits (358), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 102/338 (30%), Positives = 171/338 (50%), Gaps = 29/338 (8%)

Query: 33  TRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIND 92
           T+K Q  +   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL   
Sbjct: 11  TKKEQPQFE-YEFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL--- 66

Query: 93  PTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET-EK---G 148
                 + I DL      R AT EE+ + HS++++EF+ K    N  ++ + T EK   G
Sbjct: 67  ------HKIMDLY---ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIG 117

Query: 149 DSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSN 207
           D      + Y  S L  G +++A + ++    ++ +A+    G HHA+     GFC  ++
Sbjct: 118 DDCPIFQNIYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVND 175

Query: 208 VAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTI 267
           + ++  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  IS H+F  G+++PGT 
Sbjct: 176 IVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT- 229

Query: 268 QGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAA 327
            G +D+IG  KGK F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+ 
Sbjct: 230 -GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSL 287

Query: 328 DGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
             D +G  ++    +G     +KS     + VV  GGY
Sbjct: 288 GHDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGY 324

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 172/340 (50%), Gaps = 31/340 (9%)

Query: 31  VPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI 90
           + T+ AQ  +   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL 
Sbjct: 13  IKTKNAQPMF---EFGSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL- 68

Query: 91  NDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETE 146
                   + I DL      R+AT +E+L+ HS +++ F++K    N  ++    L++  
Sbjct: 69  --------HKIMDLY---ETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYN 117

Query: 147 KGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLF 205
            GD      + Y  S L  G +++A + ++    ++ +A+    G HHA+     GFC  
Sbjct: 118 IGDDCPIFQNLYDYSALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYV 175

Query: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265
           +++ +A  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  IS H++  G+++PG
Sbjct: 176 NDIVLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPG 230

Query: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFD 325
           T  G YD+IG  +GK F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D
Sbjct: 231 T--GNYDEIGCAQGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGAD 287

Query: 326 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
           +   D +G  ++    +G     ++S     L VV  GGY
Sbjct: 288 SLGHDRLGCFNLNIKAHGECVKFIRSFGIPML-VVGGGGY 326

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 163/322 (50%), Gaps = 28/322 (8%)

Query: 49  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKI 108
           Y  R+ YH     S++ Y   HP  P R+     +++  GL         + I DL    
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 109 PIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFNNDSYATSRLP 164
             R+AT +E+LE HS++++ F+ K    N  +L    L+    GD      + Y  + L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 165 CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESV 223
            G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 224 RRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFN 283
            RIL +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   +IG  KGK F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 284 CNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 343
            N+     G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 344 HMTHMLKSLARGNLCVVLEGGY 365
                +KS     L VV  GGY
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGY 322

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 164/327 (50%), Gaps = 32/327 (9%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL         + I DL 
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 73

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKT-----EKMNREELLKETEKGDSVYFNNDSYAT 160
                R AT EE+ + HS ++L+F+EK       K+ R  L K     D   F N  Y  
Sbjct: 74  ---ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 161 SRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNY 219
           S L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 220 PESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKG 279
           P    R+L +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G YD+IG   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 280 KGFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVT 338
           K F  N+  P+  G+ D  Y+  F+ ++ P+   +QP ++I   G D+   D +G  ++ 
Sbjct: 241 KHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLN 298

Query: 339 PSCYGHMTHMLKSLARGNLCVVLEGGY 365
              +G     + S     + VV  GGY
Sbjct: 299 IKAHGECVKFVSSFGIP-MLVVGGGGY 324

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 163/324 (50%), Gaps = 29/324 (8%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y+  + YH     S F Y   HP  P R+     +++  GL         + I DL 
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 71

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET-EK---GDSVYFNNDSYATS 161
                R AT EE+ E H+ +++EF+ K    N  +L + T EK   GD        Y  S
Sbjct: 72  ---ETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
            L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
               R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+ G  +GK
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 281 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPS 340
            F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 341 CYGHMTHMLKSLARGNLCVVLEGG 364
            +G     +KS   G   +VL GG
Sbjct: 299 AHGECVRFVKSF--GIPMLVLGGG 320

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/323 (29%), Positives = 164/323 (50%), Gaps = 28/323 (8%)

Query: 48  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLK 107
            Y  R+ YH     S++ Y   HP  P R+     +++  GL         + I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 108 IPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK----GDSVYFNNDSYATSRL 163
              R+AT +E+L+ HS++++ F+ K    N  +L + T +    GD      + Y  + L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 164 PCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPES 222
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 223 VRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGF 282
             RIL +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G   +IG  KGK F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 283 NCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCY 342
             N+     G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 343 GHMTHMLKSLARGNLCVVLEGGY 365
           G     +KS     L VV  GGY
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGY 322

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/346 (28%), Positives = 170/346 (49%), Gaps = 37/346 (10%)

Query: 25  VKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL 84
            K+P+   +      YTP         R+ YH     S + Y   HP  P R+     ++
Sbjct: 13  AKQPLFEESFDNSSSYTP---------RVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLV 63

Query: 85  AENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL--- 141
           +  GL         + I DL      R AT EE+++ HS+++L+F+ K    N  ++   
Sbjct: 64  SSYGL---------HKIMDLY---ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRG 111

Query: 142 -LKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAA 199
            L++   GD      + Y  S L  G +++A + ++    ++ +A+    G HHA+    
Sbjct: 112 TLEKFNIGDDCPIFQNLYDYSTLYTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNP 169

Query: 200 GGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFEL 259
            GFC  +++ ++  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  IS H+F  
Sbjct: 170 SGFCYINDIVLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN- 224

Query: 260 GKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVI 319
           G+++PGT  G YD+ G  KGK F  N+     G+ D  Y+  F+ ++ P+   ++P +++
Sbjct: 225 GEFFPGT--GDYDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIV 281

Query: 320 ISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
              G D+   D +G  ++    +G     +KS     + VV  GGY
Sbjct: 282 QQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIP-MLVVGGGGY 326

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 172/349 (49%), Gaps = 37/349 (10%)

Query: 22  SQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIY 81
           S DVK     P+ +    Y+P         R+ YH     S++ Y   HP  P R+    
Sbjct: 6   SYDVKTEENQPSFEYNSAYSP---------RVSYHFNSKVSHYHYGVKHPMKPFRLMLTD 56

Query: 82  KILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL 141
            +++  GL         + I DL      R+AT +E+L+ HS++++ F+ K    N  +L
Sbjct: 57  HLVSSYGL---------HKIMDLY---ETRSATRDELLQFHSEDYVNFLSKVSPDNANKL 104

Query: 142 ----LKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEP 196
               L+    GD      + Y  + L  G +++A + ++    ++ +A+    G HHA+ 
Sbjct: 105 PRGTLENFNIGDDCPIFQNLYDYTTLYTGASLDATRKLINN--QSDIAINWSGGLHHAKK 162

Query: 197 EAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHR 256
            +  GFC  +++ ++  N+L+ +P    RIL +D D+HHG+G Q+AFY  DRV  +S H+
Sbjct: 163 NSPSGFCYVNDIVLSILNLLRYHP----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHK 218

Query: 257 FELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPD 316
           +  G+++PGT  G   +IG  KGK F  N+     G+ D  Y+  F+ +V P+   F+P 
Sbjct: 219 YN-GEFFPGT--GDLTEIGCDKGKHFALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPT 274

Query: 317 LVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
           L++   G D+   D +G  ++    +G     +KS     L VV  GGY
Sbjct: 275 LIVQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGLPML-VVGGGGY 322

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 97/325 (29%), Positives = 162/325 (49%), Gaps = 28/325 (8%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  +   + YH     S F Y   HP  P R+     +++  GL         + I DL 
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 71

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFNNDSYATS 161
                R AT EE+ E HS++++EF+ +    N  +L    L++   GD        Y  S
Sbjct: 72  ---ETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
               R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+IG  +GK
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 281 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPS 340
            F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 341 CYGHMTHMLKSLARGNLCVVLEGGY 365
            +G     +KS     L VV  GGY
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGY 322

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 174/357 (48%), Gaps = 28/357 (7%)

Query: 14  RKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPED 73
           R LE    +  +     +   K      P + G  Y  ++ YH     S + Y   HP  
Sbjct: 25  RILEKQFEAVYIMSETFLYDAKTSQQQLPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMK 84

Query: 74  PRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKT 133
           P      ++++  + L+   +  G++ I DL      R AT EE+LE H+ +++EF+   
Sbjct: 85  P------FRLMLTDHLV---SCYGLHKIMDLY---ETREATKEELLEFHAPDYIEFLSHV 132

Query: 134 EKMNREEL----LKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRP 189
              N  +L    L++   GD        +  S L  G +++A + ++    ++ +A+   
Sbjct: 133 TPENLNKLPRGSLEKFNIGDDCPIFQGMFDYSILYAGASLDAARKLINN--QSEIAINWS 190

Query: 190 PG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDR 248
            G HHA+     GFC  +++ +A  ++L+ +P    R+L +D D+HHG+G Q+AFY  DR
Sbjct: 191 GGLHHAKKSNPSGFCYVNDIVLAIISLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDR 246

Query: 249 VLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMP 308
           V  +S H++  G+++PGT  G  D+IG  KGK F+ N+     G+ D  Y+  F+ ++ P
Sbjct: 247 VFTVSFHKYN-GEFFPGT--GDLDEIGCSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDP 302

Query: 309 MGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
           +   ++P ++I   G D+   D +G  ++    +G     +KS     LCV   GGY
Sbjct: 303 LVTSYKPTVIIQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGIPILCVG-GGGY 358

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/349 (28%), Positives = 172/349 (49%), Gaps = 37/349 (10%)

Query: 22  SQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIY 81
           S DVK     P+ +   +Y+P         R+ YH     S++ Y   HP  P R+    
Sbjct: 6   SNDVKTKKSQPSFEFNSNYSP---------RVSYHFNPKASHYHYGVKHPMKPIRLMLTD 56

Query: 82  KILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL 141
            +++  GL         + I DL      R+AT +E+ E H+++++ F+ K    N  +L
Sbjct: 57  HLVSSYGL---------HKIMDLY---ETRSATKDELFEFHTEDYVNFLSKVSPENVNKL 104

Query: 142 LKETEK----GDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEP 196
            + T +    GD      + Y  + L  G  ++A + ++    ++ +A+    G HHA+ 
Sbjct: 105 PRGTLENFNIGDDCPIFQNLYDYTTLYTGATLDATRKLINN--QSDIAINWSGGLHHAKK 162

Query: 197 EAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHR 256
            +  GFC  +++ ++  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  +S H+
Sbjct: 163 NSPSGFCYVNDIVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHK 218

Query: 257 FELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPD 316
           +  G+++PGT  G   +IG  KGK F  N+     G+ D  Y+  F+ +V P+   F+P 
Sbjct: 219 YN-GEFFPGT--GDLTEIGCDKGKHFALNVPLE-DGIDDDSYINLFKSIVDPLITTFKPT 274

Query: 317 LVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
           +++   G D+   D +G  ++    +G     +KS     L VV  GGY
Sbjct: 275 VIVQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGLPML-VVGGGGY 322

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 167/327 (51%), Gaps = 32/327 (9%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLS--GVNDIGD 103
           G  Y  R+ YH     S + Y   HP  P R+           L+ D  +S  G++ I D
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHKIMD 69

Query: 104 LMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFNNDSYA 159
           L      R AT+EEI E H++++++F+ K    N  ++    L++   GD      + + 
Sbjct: 70  LY---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFN 126

Query: 160 TSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKN 218
             +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ 
Sbjct: 127 YCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRY 184

Query: 219 YPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGK 278
           +P    R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G +D++G   
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCAN 237

Query: 279 GKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVT 338
           GK F  N+     G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D IG  ++T
Sbjct: 238 GKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLT 296

Query: 339 PSCYGHMTHMLKSLARGNLCVVLEGGY 365
              +G     ++S     L VV  GGY
Sbjct: 297 IKGHGECVKFIRSFGIPML-VVGGGGY 322

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 168/332 (50%), Gaps = 29/332 (8%)

Query: 40  YTPL-KTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV 98
           + PL + G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG 
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY 62

Query: 99  NDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFN 154
             +  +M     R ATAEE+ E HS++++ F+ K    N  +L    L++   GD     
Sbjct: 63  G-LHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 155 NDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAK 213
            + +  S L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 214 NILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQ 273
           N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  IS H++  G+++PGT  G+ D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 274 IGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIG 333
            G   GK F  N+     G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 334 QCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
             ++    +G     ++S     + VV  GGY
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIP-MLVVGGGGY 322

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  136 bits (343), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 95/328 (28%), Positives = 167/328 (50%), Gaps = 28/328 (8%)

Query: 43  LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIG 102
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL         + I 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL---------HKIM 67

Query: 103 DLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET-EK---GDSVYFNNDSY 158
           DL      R AT EE+   HS+E+++F+++    N  +L + T EK   GD      + Y
Sbjct: 68  DLY---ETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 159 ATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILK 217
             S L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 218 NYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEG 277
            +P    R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G +D++G  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 278 KGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHV 337
           +GK F  N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 338 TPSCYGHMTHMLKSLARGNLCVVLEGGY 365
               +G   + ++S     L VV  GGY
Sbjct: 295 NVKAHGECVNFVRSFGLPML-VVGGGGY 321

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 163/326 (50%), Gaps = 30/326 (9%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y  R+ YH     S + +   HP  P R+           ++ D  +SG   +  +M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 70

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTE-----KMNREELLKETEKGDSVYFNNDSYAT 160
                R A+ +E+LE H+ +++ F++K       KM R  L K     D   F+N  Y  
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHN-LYEY 129

Query: 161 SRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNY 219
           S L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +
Sbjct: 130 SSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFH 187

Query: 220 PESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKG 279
           P    R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNG 240

Query: 280 KGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTP 339
           K F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  ++  
Sbjct: 241 KHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 340 SCYGHMTHMLKSLARGNLCVVLEGGY 365
             +G     +KS     L VV  GGY
Sbjct: 300 KAHGECVKFVKSFGIPML-VVGGGGY 324

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 164/325 (50%), Gaps = 28/325 (8%)

Query: 46  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLM 105
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKP------FRLMLTDHLVSAYGLHKVMDLYE-- 75

Query: 106 LKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREEL----LKETEKGDSVYFNNDSYATS 161
                R+AT +E+ + HS++++ F+ K       +L    L++   GD        +  +
Sbjct: 76  ----TRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
               R+L +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G  D+IG  +GK
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 281 GFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPS 340
            F  N+     G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 243 HFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 341 CYGHMTHMLKSLARGNLCVVLEGGY 365
            +G     +KS     L VV  GGY
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGY 325

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/337 (28%), Positives = 167/337 (49%), Gaps = 28/337 (8%)

Query: 34  RKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP 93
           RK        + G    +R+ YH     S++ Y   HP  P R+           ++ D 
Sbjct: 10  RKTADLLPQFELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDH 58

Query: 94  TLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET-EK---GD 149
            +SG   +  +M     RAAT +E+ E H+++++ F++K    N  +L + T EK   GD
Sbjct: 59  LVSGYG-MHKVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGD 117

Query: 150 SVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNV 208
                 + Y  + L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++
Sbjct: 118 DCPIFQNLYDYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDI 175

Query: 209 AVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQ 268
            ++  N+L+ +P    R+L +D D+HHG+G Q+AFY  DRV  IS H++  G ++PGT  
Sbjct: 176 VLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT-- 228

Query: 269 GQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAAD 328
           G  D+ G   G+ F  N+     G+ D  Y+  F+ V+ P+   + P ++I   G D+  
Sbjct: 229 GDIDETGCDAGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLG 287

Query: 329 GDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 365
            D +G  ++    +G     +KS     L VV  GGY
Sbjct: 288 HDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGY 323

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  132 bits (331), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 158/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G GKGK ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE VV  +   +QP  V++ +G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/339 (28%), Positives = 161/339 (47%), Gaps = 28/339 (8%)

Query: 37  QIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLS 96
           Q+ +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 97  GVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYF 153
                   M     + AT +E+ + HS E+++F+ +    N E   KE+ K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 154 NNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAA 212
            +  Y    +  GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 213 KNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYD 272
             +L+ +P    R+L +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+  
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 273 QIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTI 332
             G GKGK ++ N+     G+ D  Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 333 GQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIA 371
           G  +++   + +  + +KS     L VV  GGY +  +A
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVA 319

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  131 bits (329), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  130 bits (328), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 161/339 (47%), Gaps = 28/339 (8%)

Query: 37  QIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLS 96
           Q+ +  LK       R+ Y      S + Y   HP  P RI   + ++   GL       
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 97  GVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYF 153
                   M     + AT +E+ + H+ E+++F+ +    N E   KE+ K   GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 154 NNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAA 212
            +  Y    +  GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 213 KNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYD 272
             +L+ +P    R+L +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+  
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 273 QIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTI 332
             G GKGK +  N+     G+ D+ Y   FE V+  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 333 GQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIA 371
           G  +++   + +  + +KS     L VV  GGY +  +A
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVA 319

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  130 bits (327), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  130 bits (327), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     L VV  GGY +  +A
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVA 319

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  130 bits (327), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MESAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   +E+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  129 bits (323), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  129 bits (323), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   KE+ K   GD     +  Y    +  GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 129 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVA 320

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 91/324 (28%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     L +V  GGY +  +A
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVA 319

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + +V  GGY +  +A
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVA 319

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  128 bits (321), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 90/324 (27%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N     KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+    G GKGK ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  128 bits (321), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 89/324 (27%), Positives = 156/324 (48%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N +   KE+ K   GD     +  +    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   +G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 155/324 (47%), Gaps = 28/324 (8%)

Query: 52  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIR 111
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 112 AATAEEILEVHSKEHLEFIEKTEKMNREELLKETEK---GDSVYFNNDSYATSRLPCGGA 168
            AT +E+ + H+ E+++F+ +    N E   KE+ K   GD     +  Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 169 IEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRIL 227
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    R+L
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 228 ILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNIT 287
            +D DVHHG+G ++AFY  DRV+  S H++  G+++PGT  G+   IG G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 288 WPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 347
               G+ DA +   FE VV  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 348 MLKSLARGNLCVVLEGGYNLDAIA 371
            +KS     + VV  GGY +  +A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 91/181 (50%), Gaps = 11/181 (6%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  +++ +  + + +   +  ++I  +D+D+HHG+G +KAF     V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGR 311
           ISLH FE+G ++PGT       + E   +    NI   + G+ D       EQ+V P+  
Sbjct: 263 ISLHLFEVG-FFPGT-----GNLSESDKRRNVVNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 312 EFQPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDAI 370
             +PD+++I  G D   GD   +  ++       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 371 A 371
           +
Sbjct: 376 S 376

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 24/240 (10%)

Query: 137 NREELLKETEKGDSVYFNNDSYATSRLPC------GGAIEACKAVVEGRVKNSLAVVRPP 190
           N +E+++E  KG ++    D    S LP       G  +   K +     + ++AV    
Sbjct: 173 NEKEMIREKLKGYNL--EGDCPIFSYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDG 230

Query: 191 G-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRV 249
           G HHA    A GFC  +++ +  + +  N     +RI  +D+D+HHG+G Q++F     V
Sbjct: 231 GRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYSTSV 287

Query: 250 LYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPM 309
             IS H FE G ++P T   +  ++G+        NI   + GV D       E+V++P 
Sbjct: 288 QTISAHMFEPG-FFPCTGSLKESKMGKNI-----VNIPL-LHGVDDMLMNEIVEKVMIPC 340

Query: 310 GREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGGYN 366
            + + P++++I  G D   GD   +  +T   +G + ++LK L     C V+    GGYN
Sbjct: 341 VKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGGYN 398

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 88/177 (49%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA    A GFC  +++A+  + + +     +RRI  +D+D+HH +G ++AF     V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 310
           IS+H  E G ++PGT  G   +   GK       +  PV  G+ D       ++V+MP  
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCI 329

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYN 366
           R   P++++I  G D   GD   +  +T      ++ ++++     N+ ++  GGYN
Sbjct: 330 RSHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  ++V +  + + K     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 310
           IS+H +E G ++PGT  G  +    GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 366
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 130/277 (46%), Gaps = 31/277 (11%)

Query: 114 TAEEILEVHSKEHLEFIEKTEKMNR-EELLKETEKGDSVY-------FN--NDSYATSRL 163
           T  E+L  + ++H+E  E  +K    E  L + E GD V        FN  +D      L
Sbjct: 110 TYSELLHYY-RDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYL 168

Query: 164 P------CGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNIL 216
           P       G  +   + ++EG  + ++A+    G HH+    A GFC  +++A+    + 
Sbjct: 169 PLYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLR 227

Query: 217 KNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGE 276
           +     V RI  +D+D+HHG+G +KAF    +V  ISLH +E G ++P +  G  +    
Sbjct: 228 RG---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSS 281

Query: 277 GKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCH 336
           GK      NI   + G+ D+      +++++P   + QP++++I  G D   GD   +  
Sbjct: 282 GKSI---VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQ 337

Query: 337 VTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAIS 373
           +  S  G  + +   + + N  +VL GG   + + +S
Sbjct: 338 L--SIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMS 372

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  ++V +  + + K     + +I  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYM-WAFEQVVMPMG 310
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 366
           +   PD++II  G D   GD   +  +T       + +++K   R ++ ++  GGYN
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 14/203 (6%)

Query: 167 GAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRR 225
           GA  +    ++   + S+A+    G HHA    A GFC  +++ +  + I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 226 ILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCN 285
           I  +D+D+HHG+G QKAF     V  +SLH FE G ++P T       + E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVN 299

Query: 286 ITWPVGGVGDAEYMWAFEQ-VVMPMGREFQPDLVIISSGFDAADGDTIGQCHVT-PSCYG 343
           I  P+    D  ++    + +++P+  + +P++++I  G D   GD   +  +T     G
Sbjct: 300 I--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 344 HMTHMLKSLARGNLCVVLEGGYN 366
            +  ++ +    ++ ++  GGYN
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYN 380

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 99/215 (46%), Gaps = 17/215 (7%)

Query: 162 RLPCGGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
           ++  G  +   K +V      ++ +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 221 ESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGK 280
              ++I  LD+D+HHG+G +KAF     +  ISLH FE G ++PGT        G    K
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT--------GGLSNK 295

Query: 281 GFNCNITWPVG-GVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTP 339
           G    I  P+  G+ D       +Q+++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 340 SCYGHMTHMLKSLARGNLC-VVLEGGYNLDAIAIS 373
              G    ++  + + + C +VL GG   + + +S
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVS 388

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 91/176 (51%), Gaps = 11/176 (6%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HH+  + A GFC  +++ +    I K   +  R+I  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGR 311
           IS+H FE G ++P T       + E K  GFN      + G+ D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT-----GSLEETK-HGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 312 EFQPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYN 366
           + +P+ +++  G D   GD   +  +T S    ++  +L++    ++ ++  GGYN
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 14/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HH+    A GFC  +++ +A + + +N+      I  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 310
           ISLH  E G ++PGT   +  Q G          I  P+  G  D   M   E VV+P  
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-------INIPLRHGADDDCLMKITESVVIPCI 349

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVT-PSCYGHMTHMLKSLARGNLCVVLEGGYN 366
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 14/203 (6%)

Query: 167 GAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRR 225
           GA          R + +++V    G HHA    A GFC  +++A+  + + +     + +
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 226 ILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCN 285
           I  LD+D+HHG+G ++AF     V  IS+H +E G ++PGT  G       G+       
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI----- 306

Query: 286 ITWPV-GGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVT-PSCYG 343
           +  PV  G+ D        +VV+P      P++VII  G D   GD   +  +T      
Sbjct: 307 VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTD 366

Query: 344 HMTHMLKSLARGNLCVVLEGGYN 366
            +  +++     N+ ++  GGYN
Sbjct: 367 TIMKVVEDFPSSNIVLLGGGGYN 389

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 85/180 (47%), Gaps = 19/180 (10%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  +++ +    I K   +  +R+  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 252 ISLHRFELGKYYP--GTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPM 309
           IS+H FE G ++P  G++        E   KG N        G+ D        QVV+P+
Sbjct: 252 ISMHLFECG-FFPTSGSL--------EDNKKGKNIANIPLAHGLNDEYLNEIVTQVVIPL 302

Query: 310 GREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL---EGGYN 366
                P ++II  G D   GD   +  +T    G   ++LK + R   C ++    GGYN
Sbjct: 303 TDRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  ++V +  + + K     + +I  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAF-EQVVMPMG 310
           IS+H +E G ++PGT       + + +      NI  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT-----GSLSDSRKDKNVVNI--PLKHGCDDNYLELIASKIVNPLI 318

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 366
              +P+ +II  G D   GD   +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA  + A GFC  ++V +  + + K     + +I  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG-GVGDAEYMWAFEQVVMPMG 310
           IS+H +E G ++PGT  G  D    GK       +  P+  G  D+       +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNLCVVLEGGYN 366
            +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 96/206 (46%), Gaps = 19/206 (9%)

Query: 166 GGAIEACKAVVEGRVKNSLAVVRPPG-HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVR 224
            GA  A    +     ++LAV    G HHA    A GFC  +++A+  + + +   +   
Sbjct: 166 AGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFL 222

Query: 225 RILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNC 284
           R+  +D+D+HHG+G + AF     V   SLH FE G ++PGT        G  K    N 
Sbjct: 223 RVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT--------GACKNCTDNS 273

Query: 285 NITWP-VGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYG 343
            +  P + GV D+      + +V P  +   P+++II  G D   GD  G+  +  S +G
Sbjct: 274 VLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHG 331

Query: 344 HMTHMLKSLAR---GNLCVVLEGGYN 366
              ++LK +       + ++  GGYN
Sbjct: 332 LTRNILKLVQAHKFKKIALLGGGGYN 357

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 88/177 (49%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA    A GFC  +++ +  + + K   + + ++  +D+D+HHG+G +KAF     +  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 310
           IS+H +E G ++P T  G  +    GK       +  P+  GV D        +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI-----VNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNLCVVLEGGYN 366
               P++++I  G D   GD   +  +T S    ++ ++++   + ++ ++  GGYN
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 92/182 (50%), Gaps = 24/182 (13%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA    A GFC  +++ +  + + K   +   ++  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 252 ISLHRFELGKYYP--GTIQGQYDQIGEGKGKGFNCNITWPVG-GVGDAEYMWAFEQVVMP 308
           ISLH +E G ++P  G+++G           GF+  +  P+  G+ D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 309 MGREFQPDLVIISSGFDAADGDTIGQCHVT----PSCYGHMTHMLKSLARGNLCVVLEGG 364
           + +   P++++I  G D   GDT  +  ++      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 365 YN 366
           YN
Sbjct: 369 YN 370

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 83/177 (46%), Gaps = 13/177 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA    A GFC  +++ +  +++ +   +  +R+  +D+D+H+G+G  KAF   + V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV-GGVGDAEYMWAFEQVVMPMG 310
           IS+H +E G ++PGT  G  ++    K       +  PV  G+ D   +     V+ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 311 REFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVL-EGGYN 366
             F  + ++I  G D   GD   +  ++     H    +  + R     +L  GGYN
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 134/330 (40%), Gaps = 74/330 (22%)

Query: 115 AEEILEVHS----KEHLEFIE-KTEKMNRE--ELLKETEKGDSVYFNNDSYATSRLPCGG 167
           +  +L+VH     KE L       EK+ R+  E+  E   GD +Y   ++    R   G 
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGA 163

Query: 168 AIEACKAVVEGRVKNSLA-----VVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES 222
                 ++ +G V    A      +RPPGHH+      GFCL +N  +A +     Y   
Sbjct: 164 VEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--G 221

Query: 223 VRRILILDWDVHHGNGTQ-------------------------KAFYDDDRVLYISLHRF 257
           V   +ILD+D+HHG+GTQ                         K F +  +V Y S+H  
Sbjct: 222 VTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMH-- 279

Query: 258 ELGKYYPGTIQGQYDQIGEGKG---KGFNCNITWPV-----------GGVGDAEY--MWA 301
           ++  +         D++ +         + NI W +             +    Y  ++A
Sbjct: 280 DINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLFA 338

Query: 302 -----FEQVVMPMGREFQP--DLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLK 350
                F+   + M ++ +P   LV++S+GFDA++ + +  Q H   V  S Y   T    
Sbjct: 339 KADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDAL 398

Query: 351 SLAR----GNLCVVLEGGYNLDAIAISALS 376
            LA+    G +  +LEGGY+  AIA    S
Sbjct: 399 KLAQMHTNGKIISLLEGGYSDAAIASGVFS 428

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 132/321 (41%), Gaps = 74/321 (23%)

Query: 118 ILEVHSKEHLEFIEKTEKMNREELLK-ETEKGDS-----VYFNNDSYATSRLPCGGAIEA 171
           +L+VH ++    + +  K   E+L K E E  DS     +Y ++ +    +   G     
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETG 167

Query: 172 CKAVVEG----RVKN-SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRI 226
             ++ EG     V N +  V+RPPGHH       GFCL +N  V+ +     Y   +   
Sbjct: 168 VDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHA 225

Query: 227 LILDWDVHHGNGTQ-------------------------KAFYDDDRVLYISLHRFELGK 261
           ++LD+D+HHG+GTQ                         K F +  RV Y S+H  ++  
Sbjct: 226 VVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMH--DINS 283

Query: 262 YYPGTIQGQYDQIGEGKG---KGFNCNITWPV-----------GGVGDAEYMWAFEQV-- 305
           +   +     D I         G + NI W V             +  ++Y   F +   
Sbjct: 284 FPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEEDFNKLYQSKYRTLFAKADE 342

Query: 306 --------VMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSLA 353
                   +   G++F+  LV+IS+GFDA++ + +  Q H   V  + Y   T     LA
Sbjct: 343 FFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLA 401

Query: 354 R----GNLCVVLEGGYNLDAI 370
           +    G +  VLEGGY+  AI
Sbjct: 402 QMHSEGKVLSVLEGGYSDKAI 422

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 104/248 (41%), Gaps = 60/248 (24%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ-- 240
           +   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 241 ---------------KAFYDD--------DRVLYISLHRF-----ELGKYYPGTIQGQYD 272
                           A YDD         +V Y SLH       E G  +  +I+    
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 273 QIGEGKGKG-FNCNITW----------------PVGGVGDAEYMWAFEQVVMPMGREFQP 315
            I +      +N ++T                  +    D E++   ++ +   G+ ++ 
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKAD-EFLRVSQKRMASEGKNYK- 359

Query: 316 DLVIISSGFDAADGDTIGQ----CHVTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNL 367
            L+IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY+ 
Sbjct: 360 GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYS- 418

Query: 368 DAIAISAL 375
           DA  +S +
Sbjct: 419 DAALVSGV 426

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 138/329 (41%), Gaps = 79/329 (24%)

Query: 118 ILEVHS----KEHLEFIEKT-EKMNRE--ELLKETEKGDSVYFNNDSYATSRLPCGGAIE 170
           +L+VH     KE L+  +++ EK+  +  E+  +   GD +Y +  + A      G    
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGALET 167

Query: 171 ACKAVVEGRVKNSLA-----VVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRR 225
              ++ +G  +  +A      VRPPGHH+      GFCL +N  +A +     +  +V  
Sbjct: 168 GIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTH 225

Query: 226 ILILDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRF---- 257
            ++LD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 226 AVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDINSFP 285

Query: 258 -ELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG-----------GVGDAEYMWAFEQV 305
            ELG      I+     I        + NI W V             +  ++Y   F + 
Sbjct: 286 TELGYATKENIKNASTCIMN----AHDLNI-WNVHLSHYETEEDFVKLYQSKYRSLFAKA 340

Query: 306 ----------VMPMGREFQPDLVIISSGFDAADGDTIG-QCH--VTPSCYGHM-THMLKS 351
                     +   G++F+  LV+IS+GFDA++ +    Q H    P+C+ +M T     
Sbjct: 341 DEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALK 399

Query: 352 LAR----GNLCVVLEGGYNLDAIAISALS 376
           LA+    G +  V+EGGY+  AI+    S
Sbjct: 400 LAQMHTSGKVLSVMEGGYSDGAISSGVFS 428

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 101/256 (39%), Gaps = 69/256 (26%)

Query: 176 VEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHH 235
           VE     +   +RPPGHH+      GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 236 GNGTQ-------------------------KAFYDDDRVLYISLHRF-----ELGKYYPG 265
           G+GTQ                         K F +  +V Y SLH       ELG     
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKE 295

Query: 266 TIQGQYDQIGEGKGKGFNCNITWPVG----------------------GVGDAEYMWAFE 303
            ++     I +      + NI W V                          D EY    +
Sbjct: 296 NVRNAATCIMD----AHDVNI-WNVHLQSYDSDEAFTKLYQTKYRTLFAKAD-EYFRTAK 349

Query: 304 QVVMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSLAR----G 355
           Q +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G
Sbjct: 350 QNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHG 408

Query: 356 NLCVVLEGGYNLDAIA 371
            L  VLEGGY+  AI+
Sbjct: 409 KLLSVLEGGYSDGAIS 424

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLY 251
           HHA    A GFC  +++ +  + + KN      R+  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 252 ISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG-----GVGDAEYMWAFEQVV 306
            SLH FE G ++PGT            G   NC  T  V      G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 307 MPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSL---ARGNLCVVLEG 363
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 364 GYN 366
           GYN
Sbjct: 357 GYN 359

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 101/254 (39%), Gaps = 65/254 (25%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ-- 240
           +   +RPPGHH       GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 241 -------------------KAFYDD--------DRVLYISLHRFELGKYYPGTIQGQYDQ 273
                              K  YDD         +V Y S+H  ++  +   +     D 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMH--DINSFPTESGYATKDN 301

Query: 274 IGEGKG---KGFNCNI------TWPV----GGVGDAEYMWAFEQV----------VMPMG 310
           I           + NI      TW        +   +Y   F +           +  M 
Sbjct: 302 IKNASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMN 361

Query: 311 REFQPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR----GNLCVVLE 362
           + F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G +  VLE
Sbjct: 362 KPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLE 420

Query: 363 GGYNLDAIAISALS 376
           GGY+  AIA    S
Sbjct: 421 GGYSDKAIASGVFS 434

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 100/267 (37%), Gaps = 73/267 (27%)

Query: 176 VEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHH 235
           VE     +   +RPPGHH+      GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 236 GNGTQ---------------------------------KAFYDDDRVLYISLHRF----- 257
           G+GTQ                                 K+F +  +V Y SLH       
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 258 ELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV--------------------GGVGDAE 297
           ELG      I+     I +      + NI W V                         A+
Sbjct: 294 ELGYATKENIRNASTCIMDAH----DINI-WNVHLQSYKDEEEFVKLYQTKYRSIFAKAD 348

Query: 298 YMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIG----QCHVTPSCYGHMTHMLKSLA 353
             +   ++ M  G      LV+IS+GFDA++ +         +V  S Y   T     LA
Sbjct: 349 EFFKNAKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLA 408

Query: 354 R----GNLCVVLEGGYNLDAIAISALS 376
           +    G +  V+EGGY+  AIA    S
Sbjct: 409 QMHSNGKIISVMEGGYSDGAIASGVFS 435

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 133/320 (41%), Gaps = 67/320 (20%)

Query: 115 AEEILEVH-SKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRL--PCGGAIEA 171
           A  +L+VH S    E IE  +  + + L  E E  D+ + + D Y +S+      G I A
Sbjct: 107 APHVLKVHGSSWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGA 165

Query: 172 CKAVVEGRVK---------NSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES 222
            +  V+   K          +   +RPPGHH       GFCL +N  VA +     Y  +
Sbjct: 166 IETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--N 223

Query: 223 VRRILILDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRF- 257
           V  +++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 224 VTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDIN 283

Query: 258 ----ELGKYYPGTIQGQYDQIGEGKGKG-FNCNIT-WPVGGVGDAEY------MWA---- 301
               E G      I+     I        +N +++ W      +  Y      ++A    
Sbjct: 284 SFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADE 343

Query: 302 -FEQVVMPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR 354
            F    + M ++ +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+
Sbjct: 344 FFRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 355 ----GNLCVVLEGGYNLDAI 370
               G +  ++EGGY+  AI
Sbjct: 404 MHCHGKVLSLMEGGYSDKAI 423

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 134/320 (41%), Gaps = 67/320 (20%)

Query: 115 AEEILEVH-SKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCG-----GA 168
           A  +L+VH S    E IE  +  + + L  E E  D+ + + D Y +S+         GA
Sbjct: 107 APHVLKVHGSHWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGA 165

Query: 169 IEA-CKAVVEG----RVKN-SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES 222
           IE    ++ EG     + N +   +RPPGHH       GFCL +N  VA +     Y  +
Sbjct: 166 IETGVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--N 223

Query: 223 VRRILILDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRF- 257
           V  +++LD+D+HHG+GTQ                        K F +  +V Y S+H   
Sbjct: 224 VTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDIN 283

Query: 258 ----ELGKYYPGTIQGQYDQIGEGKGKG-FNCNIT-WPVGGVGDAEY------MWA---- 301
               E G      I+     I        +N +++ W      +  Y      ++A    
Sbjct: 284 SFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADE 343

Query: 302 -FEQVVMPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR 354
            F      M +  +P   LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+
Sbjct: 344 FFRSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 355 ----GNLCVVLEGGYNLDAI 370
               G +  ++EGGY+  AI
Sbjct: 404 MHCHGKVLSLMEGGYSDKAI 423

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 93/250 (37%), Gaps = 61/250 (24%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ-- 240
           +   +RPPGHH   +   GFCL +N  +A +     Y   +   +ILD+D+HHG+GTQ  
Sbjct: 185 AFVAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDI 242

Query: 241 -----------------------KAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEG 277
                                  K F +  +V Y S+H  ++  +   +     + I   
Sbjct: 243 CWKRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMH--DINSFPTESQYATKENIRNA 300

Query: 278 KG---KGFNCNI------TWPVGGVGDAEYMWAFEQVVM--------------PMGREFQ 314
                   + NI       W      D  Y   +  +                 +G+ FQ
Sbjct: 301 STCVMNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ 360

Query: 315 PDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLA--------RGNLCVVLEGGYN 366
             LV+IS+GFDA++ +       + +   H   M    A         G +  ++EGGY+
Sbjct: 361 -GLVVISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYS 419

Query: 367 LDAIAISALS 376
             AIA    S
Sbjct: 420 DKAIASGVFS 429

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 131/325 (40%), Gaps = 77/325 (23%)

Query: 115 AEEILEVHSK----EHLEFIEKTEK-MNREEL-LKETEKGDSVYFNNDSYATSRLPCGGA 168
           A+ +L+VH      E L+  ++++K ++R E+ + E+     +Y +  +        G  
Sbjct: 108 ADHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGAL 167

Query: 169 IEACKAVVEGRV-----KNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESV 223
                ++  G         +   +RPPGHH+      GFCL +N  +A +     Y  +V
Sbjct: 168 ETGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NV 225

Query: 224 RRILILDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRF-- 257
              ++LD+D+HHG+GTQ                        K F +  +V Y S+H    
Sbjct: 226 THAVVLDFDLHHGDGTQDICWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINS 285

Query: 258 ---ELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPV-----------GGVGDAEYMWAF- 302
              ELG      I+     I +      + NI W V             +   +Y   F 
Sbjct: 286 FPTELGYATKENIRNAATCIMD----AHDVNI-WNVHLQPYDSEEAFTKLYQTKYRTLFA 340

Query: 303 ---------EQVVMPMGREFQPDLVIISSGFDAADGDTIG-QCH---VTPSCYGHMTHML 349
                    +Q +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T   
Sbjct: 341 KADEFFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDA 399

Query: 350 KSLAR----GNLCVVLEGGYNLDAI 370
             LA+    G +  V+EGGY+  AI
Sbjct: 400 LKLAQMHSHGKVLSVMEGGYSDGAI 424

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 12/151 (7%)

Query: 192 HHAEPEAAGGFCLFSNVAVAAKNILKNYPESV---RRILILDWDVHHGNGTQKAFYDDDR 248
           HHA    A GFC  +++ V+  N L+  P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 249 VLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVG-GVGDAEYMWAFEQVVM 307
           +  IS+H FE G +YP T   ++     GK K  N  I  PV  G+ ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 308 PMGREFQPDLVIISSGFDAADGDTIGQCHVT 338
           P+    Q D ++I  G D  + D   +  +T
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT 348

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 101/243 (41%), Gaps = 57/243 (23%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ-- 240
           +   +RPPGHH +     GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 241 -----------------------KAFYDDDRVLYISLHRF-----ELGKYYPGTIQGQYD 272
                                  K F +  +V Y S+H       E G      I+    
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 273 QIGEGKGKG-FNCNITWPVGGVGDAEYMWA-------------FEQVVMPMGREFQP--D 316
            I +G     +N +++ P     D + ++              F      M +E +P   
Sbjct: 305 CIMDGHDLNIWNIHLS-PWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKG 363

Query: 317 LVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLD 368
           LV+IS+GFDA++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+  
Sbjct: 364 LVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDK 423

Query: 369 AIA 371
           A+ 
Sbjct: 424 ALT 426

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 66/138 (47%), Gaps = 15/138 (10%)

Query: 115 AEEILEVH-SKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRL--PCGGAIEA 171
           A  +L+VH S    E IE  +  + + L  E E  D+ + + D Y +S+      G I A
Sbjct: 107 APHVLKVHGSHWPTELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIQALQGTIGA 165

Query: 172 CKAVVEGRVK---------NSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES 222
            +  V+   K          +   +RPPGHH       GFCL +N  VA +     Y   
Sbjct: 166 IETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--D 223

Query: 223 VRRILILDWDVHHGNGTQ 240
           V  +++LD+D+HHG+GTQ
Sbjct: 224 VTHVVVLDFDLHHGDGTQ 241

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 131/324 (40%), Gaps = 69/324 (21%)

Query: 118 ILEVHSKEHLEFIEKTEKMNREELLK-ETEKGDSVYFNNDSYATSRL--PCGGAIEACKA 174
           +L+VH  E    + +  K +  +L + E E  D+ +   D Y TSR      G I A + 
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDN-WNAGDIYLTSRTIEALQGTIGAVET 164

Query: 175 VVEG--------RVKNSLAV-VRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRR 225
            V+          + N + V +RPPGHH       GFCL +N  +  +     Y   V  
Sbjct: 165 GVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTH 222

Query: 226 ILILDWDVHHGNGTQ------------------------KAFYDDDRVLYISLHRF---- 257
            +ILD+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 223 AVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFP 282

Query: 258 -ELGKYYPGTIQGQYDQIGEGKGKG-FNCNIT-WPV----GGVGDAEYMWAFEQV----- 305
            E G      I+     I        +N +++ W        +  ++Y   F +      
Sbjct: 283 TESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFK 342

Query: 306 -----VMPMGREFQPDLVIISSGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA--- 353
                +  +G+ F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA   
Sbjct: 343 NSKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMH 401

Query: 354 -RGNLCVVLEGGYNLDAIAISALS 376
            +G +  +LEGGY+  AI     S
Sbjct: 402 CQGKVLSLLEGGYSDKAITSGVFS 425

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 134 EKMNREEL--LKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLA-----V 186
           EK+ R E+   KE   GD +Y ++ +    R   G        +  G     ++     V
Sbjct: 128 EKLARGEIEVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVV 186

Query: 187 VRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ 240
           VRPPGHH       GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 187 VRPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 13/137 (9%)

Query: 115 AEEILEVHS----KEHLEFIEKTEKMNREELLK--ETEKGDSVYFNNDSYATSRLPCGGA 168
           A  +++VH      E +    + +   RE  L+  E+     +Y N+D+    +   G  
Sbjct: 106 APHVIKVHGSKWPNEVIRLCHEADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAI 165

Query: 169 IEACKAVVEGR-----VKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESV 223
                ++  G         +   +RPPGHH       GFCL +N  +  +     Y   V
Sbjct: 166 ETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GV 223

Query: 224 RRILILDWDVHHGNGTQ 240
             +++LD+D+HHG+GTQ
Sbjct: 224 THVVVLDFDLHHGDGTQ 240

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 297 EYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIG----QCHVTPSCYGHMTHMLKSL 352
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + +       +V  + Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 353 AR----GNLCVVLEGGYNLDAIA 371
           A+    G +  ++EGGY+  AI 
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAIT 427

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 13/134 (9%)

Query: 118 ILEVHSKEHLEFI-----EKTEKMNREEL-LKETEKGDSVYFNNDSYATSRLPCGGAIEA 171
           + +VH KE  + +     E  EK+ + E+ + E+     +Y ++ +    +   G     
Sbjct: 108 VYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETG 167

Query: 172 CKAVVEG----RVKN-SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRI 226
             ++ +G     + N +   +RPPGHH       GFCL +N  VA +     Y   V  +
Sbjct: 168 VDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHV 225

Query: 227 LILDWDVHHGNGTQ 240
            +LD+D+HHG+GTQ
Sbjct: 226 AVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ 240
           +   +RPPGHH       GFCL +N  VA +     Y  +V  +++LD+D+HHG+GTQ
Sbjct: 186 AFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 183 SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQ 240
           +   +RPPGHH       GFC+ +N  VA +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 184 AFVAIRPPGHHCHFATPSGFCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 109/264 (41%), Gaps = 63/264 (23%)

Query: 167 GAIE-ACKAVVEG----RVKN-SLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYP 220
           GA+E A  ++ +G     + N +   +RPPGHH       GFCL +N  VA +     + 
Sbjct: 160 GALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF- 218

Query: 221 ESVRRILILDWDVHHGNGTQ-------------------------KAFYDDDRVLYISLH 255
             V    ILD+D+HHG+GTQ                         K F +  RV Y S+H
Sbjct: 219 -GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMH 277

Query: 256 RF-----ELGKYYPGTIQGQYDQIGEGKGKG-FNCNITWPVGGVGDAEYMWA-------- 301
                  E G      ++     I        +N +++ P     D   ++         
Sbjct: 278 DINSFPTESGYATKENVKNASTCIMNAHDVNIWNIHLS-PWETEEDFAKLYHTKYRSLFV 336

Query: 302 -----FEQVVMPMGREFQP--DLVIISSGFDAADGD-TIGQCHVT--PS-CYGHMTHMLK 350
                F+Q  + M  + +P   LV+ISSGFDA++ + T  Q H T  P+  Y   T    
Sbjct: 337 KADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDAL 396

Query: 351 SLAR----GNLCVVLEGGYNLDAI 370
            L++    G +  ++EGGY+  AI
Sbjct: 397 KLSQMHCHGKVLSIMEGGYSDKAI 420

>TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {ON}
           Anc_4.133 YLR316C
          Length = 352

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 30/150 (20%)

Query: 70  HPEDPRRI-YRIYKILAENGLINDPT-LSGVNDIGDLMLKIPIRAATAEEILEVHSKEHL 127
           +P D + I Y +   +AENG+  D + ++G+  + DL +K   RA  ++  L   S EH 
Sbjct: 205 NPNDSKNIIYSMDTRVAENGIPTDHSIMNGIKKVADLEVKR--RALMSKSDL---SNEHQ 259

Query: 128 EFIEKTEKMNREELLKETEKGDSVY--FNNDSYATSRLPCGGAIEACKAVVEGRVKNSLA 185
                         + +  K    Y  FN D Y T   PC        A+V  R+K  L 
Sbjct: 260 --------------VNDDIKNHQTYLCFNFDIYTTHE-PCSMC---SMALVHSRIK-RLI 300

Query: 186 VVRP--PGHHAEPEAAGGFCLFSNVAVAAK 213
            ++P       +PE+  GFC+ SN  + +K
Sbjct: 301 FIKPMVKTGTLKPESGKGFCMHSNKLLNSK 330

>CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P38818 Saccharomyces cerevisiae
           YHR109w CTM1 cytochrome c methyltransferase
          Length = 551

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 213 KNILKNYPESVRRILILDWDVHHGNGTQK-AFYDDDR-----VLYISLHRFELGKYYPGT 266
           +N + NY  +   + ILD+ V+HG+ T + A+YD DR     +LY+ L     GK  P T
Sbjct: 208 ENYMDNYVVTPSLVPILDY-VNHGDKTSRNAYYDVDRRKGDIILYLDLTVVNPGKLKPNT 266

>TBLA0H00200 Chr8 (23854..25128) [1275 bp, 424 aa] {ON} Anc_3.17
           YOL140W
          Length = 424

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 117 EILEVHSKEHLEFIEKTEKMNREELLKETEK--GDSVYFNNDSYATSRLPCGGAIEACKA 174
           E+ EV SK+ L+ +  +     EE LK +EK    ++ F+  S AT    C    EA +A
Sbjct: 72  EVAEVISKQALKLVHSSNLYYNEECLKLSEKLIEKTIQFDGQSDATKVFLCNSGTEANEA 131

Query: 175 VVE-----GRVKN 182
            ++     G +KN
Sbjct: 132 ALKFAKKHGIIKN 144

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,545,519
Number of extensions: 3327515
Number of successful extensions: 9004
Number of sequences better than 10.0: 111
Number of HSP's gapped: 8985
Number of HSP's successfully gapped: 120
Length of query: 693
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 576
Effective length of database: 40,065,477
Effective search space: 23077714752
Effective search space used: 23077714752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)