Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J03432g2.284ON62259229980.0
Skud_14.3092.284ON63940911951e-156
KAFR0H033302.284ON36931411441e-152
KNAG0H020202.284ON59232111621e-152
NCAS0G038102.284ON66134611631e-151
TDEL0G021502.284ON66131111581e-150
Suva_14.3272.284ON63231011431e-148
Suva_9.1042.284ON80541111551e-148
NDAI0G006402.284ON62131111391e-148
Smik_14.3112.284ON63731011351e-147
YNL020C (ARK1)2.284ON63831111311e-146
KLTH0G10318g2.284ON79030311421e-146
SAKL0E07722g2.284ON79131111411e-146
KAFR0J013702.284ON78036911311e-145
NCAS0B062602.284ON72332011241e-144
Smik_9.842.284ON80831211281e-144
Kwal_27.115422.284ON79131111261e-144
KLLA0E08405g2.284ON77731111201e-143
YIL095W (PRK1)2.284ON81031211211e-143
TPHA0C033802.284ON69734911071e-142
CAGL0G02607g2.284ON68831110961e-141
Skud_9.782.284ON80931211061e-140
ZYRO0A01848g2.284ON70431110961e-140
Kpol_1003.352.284ON71331110921e-139
ADL217W2.284ON75030210881e-138
NDAI0B035602.284ON75631110851e-138
TBLA0B059302.284ON71732410761e-137
Ecym_33232.284ON74830310761e-137
Kpol_1039.332.284ON70131110701e-136
TBLA0B069402.284ON144332811131e-136
KNAG0A054302.284ON7883149811e-122
TPHA0D015402.284ON7073099661e-121
KNAG0J008203.273ON10913227747e-90
KAFR0A010403.273ON9123207422e-86
CAGL0H10208g3.273ON10273167454e-86
SAKL0D03234g3.273ON8583117356e-86
KNAG0H012203.273ON9133207352e-85
TDEL0D035203.273ON10493187253e-83
Kpol_1052.223.273ON11013067264e-83
Kwal_27.109453.273ON9353127194e-83
KLTH0C07260g3.273ON9013127167e-83
TPHA0M011203.273ON7883147109e-83
Kpol_251.43.273ON8383127121e-82
KLLA0F18612g3.273ON8143087082e-82
KAFR0C004303.273ON9493277126e-82
Skud_2.1793.273ON10903157151e-81
Suva_4.2973.273ON11073157151e-81
CAGL0K11990g3.273ON9913157111e-81
ZYRO0E06864g3.273ON11153157142e-81
NDAI0A057003.273ON11573277152e-81
YBR059C (AKL1)3.273ON11083157114e-81
Ecym_26503.273ON8943097034e-81
NCAS0A105903.273ON10953167115e-81
TPHA0A040303.273ON10543337062e-80
Smik_2.1913.273ON11083157072e-80
TBLA0E025903.273ON10613126832e-77
AGR027C3.273ON9613076723e-76
TBLA0I019303.273ON13613126592e-73
Kwal_56.242746.262ON3463342371e-20
KAFR0G012001.24ON5072652421e-20
TDEL0C067801.24ON4682762382e-20
KNAG0F029006.31ON6492592394e-20
Smik_1.793.177ON9742772387e-20
Suva_16.706.262ON3643482317e-20
Kpol_1037.206.31ON7042902378e-20
Kpol_1023.266.31ON7392712378e-20
ZYRO0E07876g6.262ON3692962318e-20
KLTH0H03080g6.262ON3463312272e-19
SAKL0C00946g1.24ON5642762322e-19
KAFR0A050906.31ON6682402323e-19
NCAS0D021006.31ON7262752323e-19
Skud_16.426.262ON3643332253e-19
NDAI0C026806.31ON7502752297e-19
KNAG0E008506.31ON7112912289e-19
Smik_6.4416.262ON3643332229e-19
YAR019C (CDC15)3.177ON9742772281e-18
Kpol_2002.241.24ON4872712251e-18
TDEL0A067506.262ON3723472193e-18
YPL236C (ENV7)6.262ON3643322183e-18
TPHA0J004206.31ON7072902233e-18
ZYRO0F18062g1.24ON4712792204e-18
TPHA0F024306.31ON7982712225e-18
TDEL0G043806.31ON7222902216e-18
Skud_1.723.177ON9742752226e-18
SAKL0H06754g8.668ON8841972209e-18
Kpol_1072.198.668ON8962762209e-18
ZYRO0C07480g6.31ON7742912181e-17
CAGL0K02167g8.140ON11622752182e-17
KNAG0F001701.24ON5432502152e-17
TBLA0B004906.31ON7872752163e-17
KAFR0G026906.31ON7132902163e-17
Smik_13.1596.31ON7052902153e-17
SAKL0E01584g6.31ON6952912144e-17
Skud_13.1546.31ON7052902144e-17
Suva_13.1636.31ON7052902135e-17
ACL006W6.31ON7082912135e-17
YMR001C (CDC5)6.31ON7052902136e-17
KLTH0C10912g6.31ON6972912136e-17
CAGL0J11638g6.31ON7462912136e-17
NDAI0F045201.24ON4892712116e-17
TPHA0E038501.24ON4822242107e-17
KAFR0C014403.92ON10952672129e-17
KLLA0C06138g6.31ON7082902101e-16
KLTH0F16676g5.406ON8782552111e-16
Suva_16.1608.668ON9182782101e-16
TBLA0A074601.24ON5162052072e-16
NCAS0C016708.668ON8962772092e-16
NDAI0G034508.141ON9483212092e-16
Kwal_56.224766.31ON6972912082e-16
YDR523C (SPS1)1.24ON4901932062e-16
CAGL0M02299g8.668ON8932892083e-16
NCAS0C041008.141ON9053292083e-16
TBLA0A047207.86ON12622792083e-16
Smik_7.928.141ON8973132074e-16
Kwal_55.215455.406ON8652432074e-16
YPL150W8.668ON9012792074e-16
Ecym_30356.31ON7402912064e-16
Ecym_21536.262ON3633512014e-16
Skud_16.1328.668ON9242772064e-16
Suva_1.863.177ON9742752065e-16
Smik_4.8031.24ON4901932036e-16
Skud_4.7971.24ON4851932036e-16
KNAG0D048107.86ON14403032066e-16
YGL179C (TOS3)8.140ON5602072036e-16
Suva_2.7031.24ON4851932026e-16
SAKL0A03344g6.262ON3643522007e-16
TPHA0G016308.668ON8711972049e-16
NCAS0I004707.86ON10822792049e-16
TDEL0F009308.140ON11302742041e-15
ZYRO0F07194g8.668ON9382812031e-15
KLLA0F11319g8.668ON8431952021e-15
NCAS0A002801.24ON5352822011e-15
Smik_6.3478.668ON9172792021e-15
YGL180W (ATG1)8.141ON8973022021e-15
Skud_7.918.141ON8973012022e-15
TBLA0E022907.86ON13002802022e-15
Kwal_26.73551.271ON14462702022e-15
Ecym_26407.86ON13252962012e-15
KAFR0D049505.406ON10082512003e-15
Kpol_463.81.271ON14472682003e-15
Suva_7.828.141ON9003021993e-15
Skud_7.928.140ON5632431983e-15
Suva_7.838.140ON5692431983e-15
Kwal_33.131121.24ON5052801973e-15
Smik_7.938.140ON5632511973e-15
KLTH0E06754g8.141ON8733051976e-15
CAGL0F00913g7.86ON12062911976e-15
KNAG0J016708.668ON10092801976e-15
Smik_10.1471.271ON14782671977e-15
KAFR0D012207.86ON10552811968e-15
TDEL0A061408.668ON8612781968e-15
ACR133C8.668ON8511951951e-14
ZYRO0E07018g6.222ON3672301901e-14
Ecym_10301.24ON4402751911e-14
KLLA0F14190g1.271ON13382371941e-14
Ecym_84008.141ON10663651941e-14
Skud_10.1191.271ON14812581941e-14
KAFR0K007007.86ON13812861941e-14
Kpol_265.14.384ON7572761931e-14
Kwal_26.87518.668ON8481951932e-14
ZYRO0G19052g8.140ON11313331942e-14
KAFR0A014201.271ON13982601932e-14
KLLA0B03586g4.384ON7342761922e-14
Ecym_52513.177ON8932691922e-14
SAKL0B12364g4.384ON7222761922e-14
TBLA0D050101.374ON4342881892e-14
TBLA0D022308.141ON11542621922e-14
NDAI0H024707.86ON14112901922e-14
Kwal_26.71547.86ON12132791923e-14
TDEL0D053203.92ON10572601923e-14
Ecym_12751.374ON4512991893e-14
Kwal_47.172528.141ON8722971913e-14
KLLA0F07623g7.86ON12292821923e-14
KNAG0B017801.271ON15802041923e-14
NDAI0E023908.668ON8831981913e-14
KNAG0F002901.52ON11252951913e-14
KLTH0D11044g8.668ON8491951903e-14
NCAS0A094701.271ON15152031914e-14
Kpol_1072.298.654ON8932361904e-14
KLLA0C00979g1.24ON4833081884e-14
SAKL0B09856g7.86ON12742801914e-14
NDAI0G054701.271ON15552581914e-14
Suva_6.1691.271ON14842031914e-14
KAFR0H025108.668ON8792861894e-14
KLTH0F00946g1.24ON5121921885e-14
Ecym_35863.92ON10771901895e-14
SAKL0D05522g1.271ON14742131905e-14
KLLA0C12485g3.92ON9252721895e-14
TPHA0C001604.384ON7542761885e-14
Ecym_24058.668ON8552001895e-14
ACR281C7.86ON12592951896e-14
NDAI0A038702.496ON8952171886e-14
Kpol_1031.105.406ON11272291896e-14
ZYRO0D05500g7.86ON12622791887e-14
KLLA0C04191g3.177ON7972741887e-14
Smik_7.3191.374ON4462601857e-14
CAGL0H01639g1.24ON5212691867e-14
NCAS0F015807.86ON13822811888e-14
TPHA0H026307.86ON13672991889e-14
YJL095W (BCK1)1.271ON14782581889e-14
SAKL0H07084g8.654ON9192701871e-13
KNAG0K012403.177ON9802851871e-13
TBLA0B082503.92ON13471941871e-13
AFR724C1.24ON4402751841e-13
ACL054W8.141ON9723721871e-13
CAGL0I07513g3.92ON10762471871e-13
Kpol_1044.37.86ON9322801861e-13
Kwal_47.183075.591ON6211931851e-13
Suva_15.2975.406ON10742301861e-13
ADL389W4.384ON7112761851e-13
CAGL0L11550g5.406ON10722311861e-13
AER223C3.177ON9022711861e-13
KLTH0D03454g1.271ON14332641861e-13
NCAS0C041208.140ON9153211851e-13
TDEL0H036407.86ON12372831862e-13
ZYRO0G15290g1.271ON14872031852e-13
CAGL0C05005g3.177ON10762681852e-13
CAGL0F09075g4.384ON7462761842e-13
Kpol_1040.207.86ON12972781852e-13
Kpol_541.488.140ON10552671852e-13
Kwal_47.167614.384ON7442761842e-13
SAKL0G01848g5.406ON8851781842e-13
TDEL0D003304.384ON7442761832e-13
TBLA0B038608.668ON9882771842e-13
NCAS0A064404.384ON7492761832e-13
Kpol_1069.131.374ON4273041812e-13
CAGL0L03520g1.271ON14472621843e-13
KLTH0D17204g4.384ON7552761833e-13
Ecym_74734.384ON7392771833e-13
Ecym_21946.222ON3662691793e-13
Smik_8.1805.406ON10732301833e-13
Ecym_55055.406ON10032321833e-13
TBLA0A106904.384ON9692761833e-13
TPHA0H016305.406ON10362221833e-13
CAGL0L06006g8.141ON9423031823e-13
ZYRO0G00506g4.384ON7882761823e-13
Suva_15.4114.384ON8152761823e-13
Skud_3.391.52ON10172011823e-13
TPHA0O011201.374ON4292791793e-13
Skud_8.1635.406ON10762301823e-13
NCAS0B044906.222ON3492301774e-13
Suva_1.507.86ON13603001824e-13
KNAG0M001904.384ON7922761814e-13
NCAS0B037408.279ON10492421824e-13
Skud_4.7831.52ON11353051824e-13
KLLA0E21693g5.406ON10162411824e-13
TPHA0I009201.271ON14342591824e-13
YCR091W (KIN82)6.371ON7202881814e-13
NDAI0C017005.406ON10201851814e-13
Smik_8.2954.384ON8242761814e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J03432g
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...  1159   0.0  
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   464   e-156
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   445   e-152
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   452   e-152
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   452   e-151
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   450   e-150
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   444   e-148
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   449   e-148
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    443   e-148
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   441   e-147
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   440   e-146
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   444   e-146
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   444   e-146
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   440   e-145
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   437   e-144
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   439   e-144
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   438   e-144
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   436   e-143
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   436   e-143
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   431   e-142
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   426   e-141
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   430   e-140
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   426   e-140
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   425   e-139
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   423   e-138
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   422   e-138
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   419   e-137
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   419   e-137
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   416   e-136
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   433   e-136
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   382   e-122
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   376   e-121
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   302   7e-90
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   290   2e-86
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   291   4e-86
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   287   6e-86
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   287   2e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   283   3e-83
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   284   4e-83
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   281   4e-83
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   280   7e-83
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   278   9e-83
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   278   1e-82
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   277   2e-82
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   278   6e-82
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   280   1e-81
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   280   1e-81
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   278   1e-81
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   279   2e-81
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   280   2e-81
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   278   4e-81
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   275   4e-81
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   278   5e-81
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   276   2e-80
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   276   2e-80
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   267   2e-77
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   263   3e-76
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   258   2e-73
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    96   1e-20
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    98   1e-20
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    96   2e-20
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               97   4e-20
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    96   7e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    94   7e-20
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    96   8e-20
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    96   8e-20
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    94   8e-20
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    92   2e-19
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    94   2e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             94   3e-19
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      94   3e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    91   3e-19
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    93   7e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    92   9e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    90   9e-19
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    92   1e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    91   1e-18
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    89   3e-18
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    89   3e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    91   3e-18
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    89   4e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    90   5e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    90   6e-18
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    90   6e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    89   9e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    89   9e-18
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    89   1e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    89   2e-17
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    87   2e-17
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    88   3e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    88   3e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    87   3e-17
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    87   4e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    87   4e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    87   5e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    87   5e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    87   6e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    87   6e-17
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    87   6e-17
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    86   6e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    86   7e-17
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    86   9e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    86   1e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    86   1e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    86   1e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    84   2e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    85   2e-16
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     85   2e-16
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    85   2e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    84   2e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    85   3e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     85   3e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    85   3e-16
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    84   4e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    84   4e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    84   4e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    84   4e-16
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    82   4e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    84   4e-16
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    84   5e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    83   6e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    83   6e-16
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    84   6e-16
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    83   6e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    82   6e-16
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    82   7e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    83   9e-16
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       83   9e-16
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    83   1e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    83   1e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    82   1e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        82   1e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    82   1e-15
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    82   1e-15
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    82   2e-15
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    82   2e-15
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    82   2e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    82   2e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    82   3e-15
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    82   3e-15
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    81   3e-15
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    81   3e-15
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    81   3e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    80   3e-15
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    80   3e-15
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    80   6e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    80   6e-15
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    80   6e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    80   7e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    80   8e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    80   8e-15
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    80   1e-14
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    78   1e-14
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    78   1e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    79   1e-14
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    79   1e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    79   1e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    79   1e-14
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    79   1e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    79   2e-14
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    79   2e-14
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    79   2e-14
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    79   2e-14
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    79   2e-14
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    79   2e-14
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    77   2e-14
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    79   2e-14
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    79   2e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    79   3e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    79   3e-14
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    77   3e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    78   3e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    79   3e-14
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    79   3e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    78   3e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    78   3e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    78   3e-14
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    78   4e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    78   4e-14
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    77   4e-14
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    78   4e-14
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    78   4e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    78   4e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    77   4e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   5e-14
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    77   5e-14
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    78   5e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    77   5e-14
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    77   5e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    77   5e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   6e-14
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     77   6e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    77   6e-14
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    77   7e-14
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    77   7e-14
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    76   7e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    76   7e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    77   8e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   9e-14
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    77   9e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    77   1e-13
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    77   1e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    77   1e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    75   1e-13
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    77   1e-13
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    77   1e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    76   1e-13
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    76   1e-13
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    76   1e-13
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    76   1e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    76   1e-13
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    76   1e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    76   1e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    76   1e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    76   2e-13
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    76   2e-13
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    76   2e-13
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    75   2e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    76   2e-13
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    76   2e-13
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    75   2e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    75   2e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    75   2e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    75   2e-13
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    75   2e-13
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    74   2e-13
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    75   3e-13
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    75   3e-13
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    75   3e-13
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    74   3e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    75   3e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   3e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    75   3e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    75   3e-13
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    75   3e-13
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    75   3e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    75   3e-13
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    75   3e-13
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    74   3e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    75   3e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     73   4e-13
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    75   4e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    74   4e-13
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    75   4e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    75   4e-13
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    75   4e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    75   4e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    74   4e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    74   4e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    74   4e-13
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    73   5e-13
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    74   5e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    74   5e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    74   6e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    74   6e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    74   6e-13
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    74   6e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     74   7e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    74   7e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    72   7e-13
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    73   7e-13
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    72   7e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    74   8e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    74   8e-13
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    73   8e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    74   8e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    74   9e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    74   9e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    73   9e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    74   9e-13
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    73   1e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    72   1e-12
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    74   1e-12
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    73   1e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    73   1e-12
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    73   1e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    73   1e-12
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    73   1e-12
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    72   1e-12
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    73   1e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    73   1e-12
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    73   1e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    73   1e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    73   1e-12
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    73   1e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    73   2e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    72   2e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    72   2e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    72   2e-12
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    72   2e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    72   2e-12
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    72   2e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    72   2e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    72   2e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    72   2e-12
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    72   2e-12
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    72   2e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    72   2e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    72   2e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    72   2e-12
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    72   2e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    72   2e-12
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    72   2e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    72   2e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    72   2e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    72   3e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    72   3e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    72   3e-12
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               71   3e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    72   3e-12
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    70   3e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   3e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    72   3e-12
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    72   3e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    72   3e-12
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    72   3e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    72   3e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    72   3e-12
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    72   3e-12
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    72   4e-12
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    71   4e-12
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    71   4e-12
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    71   5e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    71   5e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    71   5e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    71   5e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    71   5e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    71   5e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    71   5e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    71   5e-12
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    71   5e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    71   5e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    70   5e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    71   6e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    71   6e-12
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    71   6e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   6e-12
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    71   6e-12
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    71   7e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    71   7e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    71   7e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    71   7e-12
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    71   7e-12
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    70   7e-12
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    69   7e-12
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    70   7e-12
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    70   7e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    70   7e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    70   8e-12
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    70   9e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    70   9e-12
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    69   9e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    70   9e-12
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    69   1e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    70   1e-11
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    70   1e-11
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    69   1e-11
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    70   1e-11
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    70   1e-11
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    69   1e-11
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    70   1e-11
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    70   1e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    69   1e-11
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    70   1e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    70   1e-11
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    70   1e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    69   1e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    70   1e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    70   1e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    70   1e-11
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    70   1e-11
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    69   1e-11
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    70   1e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   1e-11
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    70   1e-11
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    70   1e-11
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    70   1e-11
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    69   1e-11
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    69   1e-11
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    70   1e-11
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    69   2e-11
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    68   2e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    69   2e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    69   2e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    70   2e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    69   2e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    68   2e-11
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    69   2e-11
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    69   2e-11
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    68   2e-11
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    69   2e-11
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    69   2e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               69   2e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    69   2e-11
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    69   2e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    69   2e-11
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    69   2e-11
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    69   2e-11
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    69   2e-11
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    69   2e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    69   2e-11
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    69   2e-11
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    68   2e-11
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    69   2e-11
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    69   2e-11
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    69   2e-11
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    69   2e-11
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     69   2e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    69   2e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    68   2e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    69   2e-11
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    69   3e-11
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    69   3e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    69   3e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   3e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    69   3e-11
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    68   3e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    69   3e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    69   3e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    69   3e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    69   3e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   3e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    67   3e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   3e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    69   3e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    68   3e-11
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    69   3e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              69   3e-11
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    68   4e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    68   4e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    67   4e-11
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    67   4e-11
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    68   4e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    68   4e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    68   4e-11
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    68   4e-11
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    67   4e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    68   4e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    68   4e-11
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    68   5e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    68   5e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    68   5e-11
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    68   5e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     67   5e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    68   5e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    67   5e-11
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    67   5e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    68   5e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    68   5e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    68   5e-11
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    68   5e-11
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    68   6e-11
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    68   6e-11
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              68   6e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    67   6e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    67   6e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    68   7e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    67   7e-11
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    67   7e-11
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    67   7e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    67   7e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    67   7e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    67   7e-11
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    67   7e-11
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    67   7e-11
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    67   8e-11
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    67   8e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    67   8e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   8e-11
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    67   8e-11
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    66   9e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    67   9e-11
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    67   9e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    67   9e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    67   9e-11
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    67   9e-11
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    67   1e-10
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    66   1e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    67   1e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    67   1e-10
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    67   1e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    67   1e-10
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    67   1e-10
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    67   1e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     67   1e-10
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    67   1e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    66   1e-10
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    67   1e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    67   1e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    67   1e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    65   1e-10
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    66   1e-10
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    66   1e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              67   1e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    67   1e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   1e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    67   1e-10
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     66   1e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    66   1e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    66   1e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    66   1e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    65   1e-10
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    66   2e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    66   2e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    66   2e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    66   2e-10
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    66   2e-10
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    66   2e-10
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    66   2e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    66   2e-10
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               65   2e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    66   2e-10
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    65   2e-10
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    66   2e-10
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    65   2e-10
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    65   2e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    65   2e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    65   2e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   2e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    65   2e-10
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    65   2e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    65   2e-10
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    66   2e-10
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    66   2e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    65   2e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    65   2e-10
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    65   2e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    65   3e-10
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    65   3e-10
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    65   3e-10
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    65   3e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   3e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    65   3e-10
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    64   3e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    65   3e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    64   3e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    65   3e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    65   3e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   3e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    64   3e-10
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    64   3e-10
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    65   3e-10
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    65   3e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   3e-10
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    65   3e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    65   3e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    64   3e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   3e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    65   3e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    64   3e-10
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    65   3e-10
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    65   4e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               65   4e-10
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    64   4e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    65   4e-10
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               65   4e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    65   4e-10
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    65   4e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    65   4e-10
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    64   4e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    65   4e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    65   4e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     64   4e-10
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    65   4e-10
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    65   4e-10
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    64   4e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    64   4e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    65   4e-10
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    65   5e-10
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    65   5e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    65   5e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    65   5e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    64   5e-10
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    64   5e-10
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    65   5e-10
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    64   5e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    64   5e-10
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    64   5e-10
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    64   5e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               64   5e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    64   5e-10
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    64   5e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    64   5e-10
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    64   6e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   6e-10
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    64   6e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    64   6e-10
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    64   6e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   6e-10
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    64   6e-10
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    64   6e-10
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    64   6e-10
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    64   6e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    63   7e-10
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    64   7e-10
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    64   7e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    63   7e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    64   7e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    64   7e-10
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    63   8e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    63   8e-10
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    64   8e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    64   8e-10
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              64   9e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    64   9e-10
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    64   9e-10
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    64   9e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    64   9e-10
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    64   9e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    63   9e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    63   9e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    63   9e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    64   1e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    63   1e-09
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    62   1e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    64   1e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    64   1e-09
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    62   1e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    64   1e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    64   1e-09
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    63   1e-09
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    64   1e-09
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    64   1e-09
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    64   1e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    63   1e-09
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    63   1e-09
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    63   1e-09
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    63   1e-09
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    64   1e-09
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    63   1e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    63   1e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    62   1e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    62   1e-09
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    62   1e-09
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    62   1e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    62   1e-09
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               63   1e-09
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    62   1e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    62   2e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    63   2e-09
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    63   2e-09
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    62   2e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    62   2e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    62   2e-09
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    63   2e-09
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    63   2e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    63   2e-09
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    62   2e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    63   2e-09
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    62   2e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    62   2e-09
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    62   2e-09
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    62   2e-09
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     62   2e-09
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    62   2e-09
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    62   2e-09
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    62   2e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       62   2e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    62   2e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   2e-09
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    61   2e-09
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    62   2e-09
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    62   2e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    62   2e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    62   2e-09
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    62   2e-09
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    62   3e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    62   3e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    62   3e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    62   3e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    62   3e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   3e-09
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    62   3e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    62   3e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    61   3e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    62   3e-09
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    62   3e-09
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    62   3e-09
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    62   3e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    61   3e-09
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    61   3e-09
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    61   3e-09
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    62   3e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   3e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    62   3e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    61   3e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    61   3e-09
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    60   3e-09
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    62   4e-09
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    62   4e-09
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    62   4e-09
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    62   4e-09
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    61   4e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    61   4e-09
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    62   4e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    61   4e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     60   4e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    60   4e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    62   5e-09
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    60   5e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    61   5e-09
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    62   5e-09
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    61   5e-09
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    60   5e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   5e-09
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    61   5e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    61   5e-09
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    61   5e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    61   5e-09
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    61   5e-09
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    61   5e-09
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    60   5e-09
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    61   5e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    59   6e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    61   6e-09
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    60   6e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    61   6e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    61   6e-09
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    60   6e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    61   6e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    61   6e-09
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    61   6e-09
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    60   6e-09
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    60   6e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    60   6e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    60   6e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    60   6e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   6e-09
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    60   7e-09
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              61   7e-09
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    60   7e-09
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    60   7e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    61   7e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    61   7e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    60   7e-09
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    59   7e-09
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    60   7e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    61   7e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    60   7e-09
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    60   7e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     60   7e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   8e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    60   8e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    60   8e-09
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    60   8e-09
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    59   8e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    60   8e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    61   8e-09
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    61   8e-09
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               60   8e-09
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    59   9e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    60   9e-09
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    60   9e-09
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    59   9e-09
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    61   9e-09
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    60   9e-09
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    60   9e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    60   9e-09
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    59   9e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   9e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    59   9e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    60   1e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    60   1e-08
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    60   1e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   1e-08
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    60   1e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    60   1e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    60   1e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    60   1e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              60   1e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      60   1e-08
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    60   1e-08
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    59   1e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    60   1e-08
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    59   1e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    60   1e-08
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    59   1e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    59   1e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    60   1e-08
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    59   1e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    60   1e-08
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    60   1e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    60   1e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    59   1e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    60   1e-08
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    59   1e-08
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    59   1e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    60   1e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    59   1e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    59   1e-08
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    60   1e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    60   1e-08
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    59   1e-08
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    60   2e-08
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    60   2e-08
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    59   2e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    59   2e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    60   2e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    59   2e-08
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    60   2e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    59   2e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    58   2e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    60   2e-08
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    59   2e-08
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    59   2e-08
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    59   2e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    60   2e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    60   2e-08
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    59   2e-08
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    58   2e-08
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    59   2e-08
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    60   2e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    59   2e-08
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    59   2e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    59   2e-08
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    59   2e-08
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    59   2e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   2e-08
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    59   2e-08
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    59   2e-08
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    59   2e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    59   2e-08
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    59   2e-08
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    58   2e-08
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    57   2e-08
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    59   2e-08
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    59   2e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    59   2e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    59   2e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    59   2e-08
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    59   3e-08
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    59   3e-08
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    58   3e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    59   3e-08
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    59   3e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    59   3e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    58   3e-08
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    57   3e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    58   3e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   3e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    58   3e-08
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    57   3e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    59   3e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    58   3e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    59   3e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    59   3e-08
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    59   3e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    59   3e-08
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    59   3e-08
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    59   3e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   3e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    59   3e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    59   3e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    59   3e-08
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    58   3e-08
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    59   3e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    58   4e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    59   4e-08
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    59   4e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     58   4e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    59   4e-08
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    58   4e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    59   4e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    59   4e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    58   4e-08
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    59   4e-08
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    58   4e-08
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    58   4e-08
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    58   4e-08
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    58   5e-08
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    58   5e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    58   5e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    58   5e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    57   5e-08
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    58   5e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   5e-08
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    57   5e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    58   5e-08
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    58   5e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    57   5e-08
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    58   5e-08
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    58   6e-08
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    58   6e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    58   6e-08
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    58   6e-08
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    57   6e-08
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    57   6e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    57   6e-08
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    58   6e-08
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    57   6e-08
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    57   6e-08
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    57   6e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    57   6e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    57   6e-08
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    57   6e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    57   6e-08
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    57   6e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    57   6e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    57   7e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    58   7e-08
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    57   7e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    57   7e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    57   7e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    57   7e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    57   8e-08
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    57   8e-08
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    56   8e-08
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    57   8e-08
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    57   8e-08
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    56   8e-08
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    57   8e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    56   8e-08
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    57   9e-08
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    57   9e-08
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    56   9e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    57   9e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    57   9e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    56   9e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    57   9e-08
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    57   1e-07
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    57   1e-07
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    57   1e-07
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    57   1e-07
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    57   1e-07
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    57   1e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    57   1e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    57   1e-07
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    57   1e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    57   1e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              56   1e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   1e-07
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    57   1e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   1e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    57   1e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    57   1e-07
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    57   1e-07
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              57   1e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    57   1e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    57   1e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   1e-07
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    55   1e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               56   1e-07
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    57   1e-07
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    56   1e-07
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    56   1e-07
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    57   1e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    56   1e-07
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    57   1e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    55   1e-07
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    56   1e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    57   1e-07
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    57   1e-07
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    57   1e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    56   2e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    56   2e-07
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    55   2e-07
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    56   2e-07
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    56   2e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    56   2e-07
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    57   2e-07
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    56   2e-07
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    56   2e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    56   2e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    56   2e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    56   2e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    56   2e-07
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    55   2e-07
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    56   2e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    57   2e-07
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    56   2e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    56   2e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   2e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     55   2e-07
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    56   2e-07
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    56   2e-07
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    55   2e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    56   2e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    56   2e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    55   2e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    55   2e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    56   2e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    55   2e-07
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    55   2e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    56   2e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    55   3e-07
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    55   3e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    55   3e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    55   3e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    56   3e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    55   3e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    56   3e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    55   3e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   3e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    55   3e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    55   3e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    55   3e-07
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    55   3e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   3e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    55   3e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    55   3e-07
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    55   3e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    55   3e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    55   3e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    55   3e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   3e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    55   3e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    55   4e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    55   4e-07
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    55   4e-07
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    55   4e-07
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    55   4e-07
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    55   4e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   4e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    55   4e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    55   4e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    55   4e-07
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    54   4e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    55   4e-07
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    54   4e-07
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    55   4e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    55   4e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    55   5e-07
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    54   5e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   5e-07
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     54   5e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    55   5e-07
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    54   5e-07
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    54   5e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    55   5e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    54   5e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     55   5e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    55   5e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    55   5e-07
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    54   5e-07
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    54   5e-07
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    55   5e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    55   5e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    55   6e-07
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    54   6e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    55   6e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    54   6e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    54   6e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    54   6e-07
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    54   6e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    55   6e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   6e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    55   6e-07
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    54   6e-07
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    54   6e-07
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    54   6e-07
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    54   6e-07
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    54   7e-07
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    55   7e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    54   7e-07
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    55   7e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    54   7e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   7e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    54   7e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    54   7e-07
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    54   7e-07
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    53   7e-07
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    53   7e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    54   8e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   8e-07
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    54   8e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    54   8e-07
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   8e-07
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    53   8e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    54   8e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    54   9e-07
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    54   9e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    54   9e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    54   9e-07
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    54   9e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    54   9e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    54   9e-07
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    54   9e-07
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    54   9e-07
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    54   1e-06
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    54   1e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    54   1e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    54   1e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    54   1e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    54   1e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    54   1e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    54   1e-06
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    53   1e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    54   1e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   1e-06
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    54   1e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    53   1e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    53   1e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    53   1e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    53   1e-06
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    54   1e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    54   1e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    53   1e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    53   1e-06
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     54   1e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    53   1e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    53   1e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    53   1e-06
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    54   2e-06
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    53   2e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    53   2e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    54   2e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    53   2e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    53   2e-06
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    53   2e-06
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    53   2e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    52   2e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    53   2e-06
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    53   2e-06
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    53   2e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    53   2e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    53   2e-06
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    53   2e-06
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    52   2e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    53   2e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    53   2e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    53   2e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    53   2e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   2e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    53   2e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    53   2e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    53   2e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   2e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    52   2e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               52   2e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    53   2e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    52   2e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    53   2e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    52   2e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    53   2e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    52   2e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    52   2e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   2e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    52   2e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    53   2e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    52   3e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    52   3e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    52   3e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   3e-06
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    52   3e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    52   3e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    52   3e-06
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    52   3e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    52   3e-06
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    52   3e-06
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    52   3e-06
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    52   3e-06
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    52   3e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    52   3e-06
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    52   3e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    52   3e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    52   3e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    52   3e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    52   3e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    52   4e-06
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     52   4e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    52   4e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    52   4e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    52   4e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    52   4e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    52   4e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    52   4e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    52   4e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    52   4e-06
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    52   4e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    52   4e-06
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    51   4e-06
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    52   4e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    52   4e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    52   4e-06
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    52   4e-06
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    52   4e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    52   4e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    51   4e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    52   5e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    51   5e-06
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    51   5e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    52   5e-06
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    52   5e-06
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    52   5e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   5e-06
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    52   5e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              52   5e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    51   5e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    52   5e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    51   5e-06
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    51   5e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    50   5e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    51   6e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    51   6e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    51   6e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   6e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    51   6e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    51   6e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    51   6e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    51   6e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    51   6e-06
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    52   6e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    51   6e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    51   6e-06
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    51   6e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    51   6e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    50   6e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    50   7e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    51   7e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   7e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    51   7e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    51   7e-06
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    51   7e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    51   7e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     51   7e-06
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    51   8e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    50   8e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    51   8e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    51   8e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    50   8e-06
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    51   8e-06
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    51   8e-06
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    50   8e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    50   9e-06
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    50   9e-06
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    50   9e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    51   9e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    51   9e-06
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    50   9e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    51   9e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    50   9e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    51   9e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    50   9e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    51   1e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    51   1e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    50   1e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    50   1e-05
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    50   1e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    50   1e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    50   1e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    50   1e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    50   1e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    50   1e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    50   1e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    50   1e-05
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    50   1e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    50   1e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    50   1e-05
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    50   1e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    50   1e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    50   1e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    50   1e-05
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    50   1e-05
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    49   1e-05
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    50   1e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    50   1e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    50   1e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    50   1e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    50   1e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    50   1e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    50   1e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    50   1e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   1e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    50   1e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    50   1e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    50   1e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    50   1e-05
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    49   1e-05
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    50   2e-05
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    50   2e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   2e-05
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    50   2e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      50   2e-05
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    49   2e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    50   2e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    50   2e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     50   2e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   2e-05
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     50   2e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    50   2e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    50   2e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    50   2e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    50   2e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    49   2e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    49   2e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   2e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   2e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    49   2e-05
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    50   2e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   2e-05
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    49   2e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   2e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    49   2e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    49   2e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             49   2e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    49   2e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    49   2e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    49   2e-05
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    49   2e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   2e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    49   2e-05
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    49   3e-05
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    50   3e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    49   3e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   3e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    49   3e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    49   3e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    49   3e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   3e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    49   3e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    49   3e-05
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    49   3e-05
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    49   3e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    49   3e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    49   3e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   3e-05
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    49   3e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    49   3e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    49   3e-05
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    48   3e-05
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    49   3e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    49   3e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    49   3e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   4e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    49   4e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    49   4e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    49   4e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    49   4e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    49   4e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    48   4e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    49   4e-05
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    49   4e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    49   4e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    49   4e-05
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    49   4e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    49   4e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    48   4e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    48   4e-05
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    49   4e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    48   5e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    49   5e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    49   5e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    48   5e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    48   5e-05
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     48   5e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    48   5e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    48   5e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    48   5e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    48   5e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    48   5e-05
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    48   5e-05
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               48   5e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    48   5e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    48   5e-05
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    48   5e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    49   5e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    48   6e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    48   6e-05
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    48   6e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    48   6e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    48   6e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    48   6e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    48   6e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    48   6e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    48   6e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    48   6e-05
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    48   6e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    48   6e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    47   6e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    48   6e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    47   6e-05
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    48   7e-05
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    47   7e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    48   7e-05
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    47   7e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     48   7e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    47   7e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    48   7e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    48   7e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    48   7e-05
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    47   7e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    47   7e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   7e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    47   7e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    48   7e-05
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    48   7e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    48   8e-05
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    48   8e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    47   8e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    47   8e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    48   8e-05
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    48   8e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    47   8e-05
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    48   9e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               48   9e-05
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    47   9e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    47   9e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    47   9e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    47   9e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    47   1e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    47   1e-04
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    48   1e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   1e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    47   1e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    47   1e-04
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   1e-04
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    47   1e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    47   1e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    47   1e-04
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              47   1e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    47   1e-04
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   1e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    47   1e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    47   1e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    46   1e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   1e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    47   1e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    47   1e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    47   1e-04
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    47   1e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    47   1e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    47   1e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    46   1e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    47   1e-04
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               47   1e-04
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              47   1e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    47   1e-04
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    47   1e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    47   1e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    46   1e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    47   1e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   1e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    47   2e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    46   2e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    47   2e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    47   2e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   2e-04
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    47   2e-04
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    46   2e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    46   2e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    47   2e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    47   2e-04
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    44   2e-04
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    47   2e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    47   2e-04
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    47   2e-04
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    46   2e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   2e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    47   2e-04
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    47   2e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    46   2e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    46   2e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   2e-04
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    46   2e-04
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    46   2e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    46   2e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    45   2e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    46   2e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    46   2e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    46   2e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    46   2e-04
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    46   2e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    46   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    45   2e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   2e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    46   3e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   3e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    46   3e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    46   3e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    46   3e-04
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    45   3e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    46   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    46   3e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    46   3e-04
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    46   3e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   3e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    45   3e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   3e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    45   3e-04
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    46   3e-04
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    46   3e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    45   3e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    46   3e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    46   3e-04
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    46   3e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    45   3e-04
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    45   3e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    46   3e-04
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    45   3e-04
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    45   3e-04
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    45   3e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    45   4e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    45   4e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    45   4e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   4e-04
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    45   4e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    45   4e-04
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    45   4e-04
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    45   4e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     45   4e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    45   4e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   4e-04
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    45   4e-04
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    45   4e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    45   4e-04
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    45   4e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    45   4e-04
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    45   4e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    45   4e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    45   4e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    45   4e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    45   5e-04
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    45   5e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    45   5e-04
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    45   5e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    45   5e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    45   5e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   5e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    45   5e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   5e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    45   5e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    45   5e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   5e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       45   5e-04
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    45   5e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    45   6e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    45   6e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     45   6e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    45   6e-04
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    44   6e-04
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    44   6e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    45   7e-04
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   7e-04
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    44   7e-04
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    44   8e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               44   8e-04
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    44   8e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    44   8e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    44   8e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    44   9e-04
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    44   9e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    44   9e-04
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    44   0.001
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    44   0.001
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    44   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   0.001
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    44   0.001
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    44   0.001
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    44   0.001
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    44   0.001
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    44   0.001
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    44   0.001
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    44   0.001
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    44   0.001
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    44   0.001
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.001
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    44   0.001
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    44   0.001
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    43   0.001
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    44   0.001
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.001
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    44   0.001
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    44   0.001
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    44   0.001
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    44   0.001
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    44   0.002
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    44   0.002
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    43   0.002
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    44   0.002
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    43   0.002
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    44   0.002
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    44   0.002
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    44   0.002
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    44   0.002
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    43   0.002
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    44   0.002
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    44   0.002
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    43   0.002
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    43   0.002
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    44   0.002
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    43   0.002
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    43   0.002
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    43   0.002
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    43   0.002
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    43   0.002
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    43   0.002
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    43   0.002
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    43   0.002
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    43   0.002
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    43   0.002
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    43   0.002
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    43   0.002
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    43   0.002
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    42   0.002
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.003
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      43   0.003
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    43   0.003
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.003
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    42   0.003
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      43   0.003
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    42   0.003
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    43   0.003
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    43   0.003
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.003
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    42   0.003
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    42   0.003
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    42   0.004
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    42   0.004
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    42   0.004
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    42   0.004
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    42   0.004
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    42   0.004
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    42   0.004
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    42   0.004
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    42   0.005
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    42   0.005
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    42   0.005
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.005
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    42   0.005
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    42   0.005
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    42   0.005
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.005
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    42   0.005
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    42   0.005
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    42   0.005
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    42   0.005
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.006
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    42   0.006
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    42   0.006
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    42   0.006
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    42   0.006
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    41   0.006
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    42   0.006
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    41   0.006
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.007
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    41   0.007
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    41   0.007
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    41   0.007
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    41   0.008
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    41   0.008
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    41   0.008
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    41   0.008
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    41   0.008
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    41   0.009
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    41   0.009
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    40   0.009
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    40   0.009
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    41   0.010
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    41   0.010
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    41   0.011
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    41   0.011
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.012
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    41   0.012
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    40   0.012
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    40   0.012
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    40   0.012
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     40   0.013
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    40   0.013
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 40   0.014
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.014
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    40   0.014
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               40   0.014
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    40   0.015
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    40   0.016
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    40   0.017
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    40   0.017
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    40   0.017
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    40   0.017
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    40   0.018
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.018
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    40   0.019
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    40   0.019
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.019
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    40   0.020
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.020
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    40   0.020
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    40   0.020
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    40   0.020
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    40   0.020
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    40   0.021
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    40   0.021
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    40   0.021
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    40   0.022
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    40   0.022
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    40   0.022
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    40   0.022
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    40   0.022
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    40   0.022
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    40   0.023
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    40   0.024
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    39   0.025
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    40   0.025
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    39   0.025
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.026
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    39   0.026
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    40   0.027
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    40   0.027
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    39   0.028
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    39   0.028
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    39   0.029
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    39   0.029
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    39   0.030
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.030
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    39   0.031
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.031
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    39   0.032
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.032
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    39   0.032
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.032
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    39   0.033
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    39   0.033
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    39   0.034
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    39   0.034
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    39   0.038
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    39   0.039
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.039
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    39   0.039
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    39   0.039
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    39   0.039
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.040
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    39   0.040
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    39   0.043
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    39   0.044
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    39   0.045
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    39   0.046
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    39   0.046
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    39   0.047
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    39   0.049
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.050
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    39   0.051
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    39   0.052
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    39   0.053
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.053
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    39   0.056
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    39   0.057
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    38   0.060
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    38   0.061
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    39   0.064
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    38   0.065
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    38   0.068
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    38   0.069
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    38   0.069
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    38   0.070
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    38   0.072
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    38   0.074
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    38   0.074
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      38   0.077
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.081
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    38   0.085
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    38   0.087
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    38   0.089
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    38   0.090
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    38   0.091
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    38   0.093
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.099
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    37   0.099
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    37   0.10 
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    38   0.10 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    37   0.11 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    37   0.11 
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    37   0.11 
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    37   0.11 
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    37   0.12 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    37   0.13 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.13 
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    37   0.13 
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    37   0.14 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    37   0.14 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.14 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    37   0.15 
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    37   0.15 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             37   0.16 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    37   0.16 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.16 
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    37   0.17 
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    37   0.17 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.17 
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    37   0.18 
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    37   0.18 
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    37   0.18 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    37   0.19 
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    36   0.20 
AFL068C Chr6 complement(306410..308752) [2343 bp, 780 aa] {ON} S...    37   0.21 
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    37   0.21 
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    37   0.21 
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    36   0.22 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    36   0.22 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.23 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    36   0.23 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    36   0.23 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    36   0.24 
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    36   0.24 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    36   0.24 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    36   0.27 
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    36   0.27 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    36   0.30 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    36   0.30 
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    36   0.30 
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    36   0.30 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    36   0.30 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    36   0.30 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    36   0.32 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.36 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    36   0.37 
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    36   0.38 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    35   0.40 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    35   0.40 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    35   0.44 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    35   0.50 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    35   0.50 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    35   0.52 
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    35   0.52 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.52 
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    35   0.57 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    35   0.63 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    35   0.67 
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    35   0.67 
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    35   0.72 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    35   0.72 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    35   0.73 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    35   0.74 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.75 
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    34   0.76 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    35   0.76 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    34   0.87 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    35   0.90 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.90 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    35   0.93 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    35   0.94 
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    34   0.99 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   1.00 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.00 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    34   1.0  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    34   1.0  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    34   1.0  
CAGL0D06446g Chr4 complement(608505..614213) [5709 bp, 1902 aa] ...    34   1.1  
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    34   1.1  
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               34   1.2  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    34   1.3  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    34   1.3  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    33   1.3  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    33   1.3  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   1.3  
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    34   1.3  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   1.4  
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    34   1.4  
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               33   1.5  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    33   1.7  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    33   1.7  
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    33   1.8  
TBLA0B02440 Chr2 complement(564793..565713) [921 bp, 306 aa] {ON...    33   1.8  
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    33   1.9  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    33   1.9  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   2.2  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    33   2.2  
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    33   2.4  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    33   2.5  
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    33   2.6  
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    33   2.6  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   2.7  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   2.9  
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    33   3.1  
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    33   3.2  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...    33   3.2  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   3.2  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    32   3.5  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    32   4.0  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   4.1  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    32   4.2  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    32   4.2  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    32   4.6  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    32   5.2  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    32   5.4  
ZYRO0D04070g Chr4 complement(332174..333142) [969 bp, 322 aa] {O...    32   5.8  
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     32   5.9  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    32   6.8  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    31   7.3  
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    32   7.6  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    31   8.4  

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score = 1159 bits (2998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/592 (94%), Positives = 561/592 (94%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDMP 360
           NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDMP
Sbjct: 301 NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDMP 360

Query: 361 KPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKKAELEATPNPLEXXXXXXXXXX 420
           KPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKKAELEATPNPLE          
Sbjct: 361 KPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKKAELEATPNPLESSKYIDDDSS 420

Query: 421 XXXXXXXXXXHASFISKTQSAHSVSTVDRFNAYLKANXXXXXXXXXXXFMPGASHLNRFR 480
                     HASFISKTQSAHSVSTVDRFNAYLKAN           FMPGASHLNRFR
Sbjct: 421 STTSEDSFDDHASFISKTQSAHSVSTVDRFNAYLKANDSISEEDSDESFMPGASHLNRFR 480

Query: 481 SDTQETSNKRQTKDEILLKRRSLPFTNNEARRNQSTDSELDTLSKAEKKEQLRQRMMSAL 540
           SDTQETSNKRQTKDEILLKRRSLPFTNNEARRNQSTDSELDTLSKAEKKEQLRQRMMSAL
Sbjct: 481 SDTQETSNKRQTKDEILLKRRSLPFTNNEARRNQSTDSELDTLSKAEKKEQLRQRMMSAL 540

Query: 541 NASEDVIKKTKSRDGSVSNDNNYLLKSKLHGRRDNEQRFSSVVVNPLDNSNN 592
           NASEDVIKKTKSRDGSVSNDNNYLLKSKLHGRRDNEQRFSSVVVNPLDNSNN
Sbjct: 541 NASEDVIKKTKSRDGSVSNDNNYLLKSKLHGRRDNEQRFSSVVVNPLDNSNN 592

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  464 bits (1195), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/409 (55%), Positives = 290/409 (70%), Gaps = 8/409 (1%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YSA I P D    +N+A LKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAM+ L++++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS +++YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP+ P+EL+YV+ DI  +TTAQYR+PEM+D+ +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL+G  EFPPYP YS+ ++ LI  +L +NP  RPN++Q+++ +S + 
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDMP 360
           NV CPI +I VP      ++      +S     + +N +S I  P       A FQ+ MP
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPN----AAFQSSMP 356

Query: 361 KPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKKAELEATPNPL 409
             +T    Q LFSR K+  +D   LN  ++     L K   +    +PL
Sbjct: 357 DAAT----QTLFSRKKSQTSDNTTLNYSAENPQTSLDKSESVSHVLDPL 401

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  445 bits (1144), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 257/314 (81%), Gaps = 1/314 (0%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y PGT + VGSH V I+KY+TSGG+AQIY+ +I P D F  +N+A LKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAMK L+++K++VSYIDSHA+KS + +G+YEVFL+MEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRLTE+E+L+I   ++QG+AAMH LQPPL+HRDIKIENVLIS  ++YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IRPP  P+EL YV+HD++ +TTAQYR+PEM+D  +G  +++KSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           YYTTPFE+  GEA IL+   E+P +P YS+ +K LI +ML +NP  RPNI+Q+I+ +SK+
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 LNVNCPIPNIHVPT 313
            NV CPI N ++ T
Sbjct: 301 QNVPCPIVNFYLVT 314

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  452 bits (1162), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/321 (62%), Positives = 261/321 (81%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P+I  Y  GTT+TVGSH V I+KYLT+GG+AQIY   I P D F GTN+A LKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LN LRAEVDAMK L++++ +VSYIDSHAAKS + +GTYEVFL+MEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           +N+RLQNRL E+E++ I   +SQGVAAMH LQPPL+HRDIKIENVL+S ++++KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IRPP  P+ELA V++DIM +TTAQYR+PEM+D+++GF +++KSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE++GEAGIL    EFP +P YSD ++ LI  +LA  P HRPNI+ +++ +S + 
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVNCPIPNIHVPTDISIAVSN 321
           N++CPI N ++  +++ A +N
Sbjct: 301 NISCPIINFYLKPNMTDASNN 321

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  452 bits (1163), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 206/346 (59%), Positives = 261/346 (75%), Gaps = 8/346 (2%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y+PGT +TVGSH V ++KYLTSGG+AQIY+ QI P D+F  TN+A LKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVD MK L+++ ++VSYIDSHAAK    +G+YEVFL+MEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQ RL E EIL I   ++QG+AAMH L PPL+HRDIKIENVL+++  +YK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP   +E++YV+HDIM +TTAQYRAPEM+DL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GEA IL+   +FP YP YSD +K+LI  ML + P  RPN +Q+++ VS + 
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPH 346
           NV CPIPN +        + NNN     +    +P N  + +++P+
Sbjct: 301 NVQCPIPNFY--------LMNNNVTQGQMAMQTQPQNNGAMMASPN 338

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  450 bits (1158), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 252/311 (81%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y PGT +TVGSH   ++ YLTSGG+AQ+YSA+I PAD F+ +N+A LKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAMK L+++K++VSYIDSHAAKS + +G+YEVFL+MEYC+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QG+AAMH LQPPLIHRDIKIENVLIS+  +YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP+ P+E AYV+HD++ +TTAQYR+PEM+DL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL+   +FP  P YSD +K LI  ML +NP  RPN+ Q+++ VS++ 
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVNCPIPNIHV 311
            + CP+ N ++
Sbjct: 301 GIQCPVRNFYL 311

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  444 bits (1143), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 197/310 (63%), Positives = 249/310 (80%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YSA I P D    +N+A LKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK+ LNTLRAEVDAMK L++++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E+EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS  ++YKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP+ P+EL+YV  D++ +TTAQYR+PEM+D+ +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  ILNG  EF PYP+YS+ ++ LI  +L +NP  RPN+FQ+++ ++ + 
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVNCPIPNIH 310
           N   PI ++ 
Sbjct: 301 NAPYPIRDVQ 310

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  449 bits (1155), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 230/411 (55%), Positives = 286/411 (69%), Gaps = 24/411 (5%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MNTP I  YEPGT +TVGSH   I+KYLTSGG+AQ+YSA+I P D +   N+A LKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT-YEVFLIMEYCSRGGLID 119
           PDK  LNTLRAEVDAMK LK++K++VSYIDSHAAKS  ++G  YEVF++MEYC RGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
           FMNTRL+NRL E+EIL I     QG+AAMH LQPPLIHRDIKIENVLIS++  YK+CDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239
           SVSG IRPPK P+E  YV+HDI+ +TTAQYR+PEM+DL +G  +++KSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           CYYTTPFE+TGEA IL+   ++P +P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 LNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDM 359
            N  CPI N ++   +     N   G+ S +  Y P  Q   + +P S       FQN  
Sbjct: 299 QNRPCPIRNFYL---LRAMNQNAQFGSESTSMTYTPAQQ---LVSPQS-------FQNIQ 345

Query: 360 PKPSTKLGKQELFSRSKTVPNDIGG---LNERSDISAFLLRKKAELEATPN 407
             P+         S  KT PN       +N  + + A L  +  +LE  PN
Sbjct: 346 AMPNIV-----PLSNIKTTPNLDSASNFVNNNNKMEAMLQLRTQKLETGPN 391

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  443 bits (1139), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 201/311 (64%), Positives = 246/311 (79%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P +  Y PGT ++VGSH   I+KYLTSGG+AQ+Y+A+I P D F+ +++  LKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAMK L+++ ++VSYIDSHAAK     G+YEVFL+MEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   +SQGVAAMH LQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP  P+E  YV+HDIM +TTAQYR+PEM++L KG  +N+KSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+TGE  IL+   +FP +PHYSD +K LI   L   P  RPNI+Q+++ VSK+ 
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVNCPIPNIHV 311
           NV CPIP+ ++
Sbjct: 301 NVPCPIPDFYL 311

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  441 bits (1135), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 200/310 (64%), Positives = 249/310 (80%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YS  I P D    TN+A LKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAM+ LK+++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS +++YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IR P+  +EL+YV+ DI+ +TTAQYR+PEM+D+ +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL+G  EFP YP+YS+ +K LI  +L +NP HRP++FQ+++ +S + 
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVNCPIPNIH 310
           NV CPI +I 
Sbjct: 301 NVPCPINDIQ 310

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  440 bits (1131), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/311 (63%), Positives = 251/311 (80%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y  GT +TVGSH V I+KYLTSGG+AQ+YSA I P D    +++A LKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAM+ LK+++Y+VSYIDSHAAK+   +G+YEVF++MEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH LQPPLIHRDIKIENVLIS +++YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP+  +EL+YV+ DI+ +TTAQYR+PEM+D  +G  +++KSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ G+  IL+G  EFP YP+YS+ +K LI  +L ++P HRPN++Q+++ +S + 
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVNCPIPNIHV 311
           NV CPI +I V
Sbjct: 301 NVPCPINDIQV 311

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  444 bits (1142), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 244/303 (80%)

Query: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNT 68
           Y+PGT +TVGSH   I+KYLTSGG+A IY+A+I PAD      +A LKRV+VPDK  LN 
Sbjct: 9   YQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLVPDKPSLNV 68

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           LRAEVDAMK L+ ++++VSYIDSHAAKS   DG+YEVFL+MEYCS GGLIDFMNTRLQNR
Sbjct: 69  LRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDFMNTRLQNR 128

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           L E E+L I   I+QG+AAMH LQPPLIHRDIKIENVLIS+D  +K+CDFGSV G IRPP
Sbjct: 129 LQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGSVCGVIRPP 188

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
           K P+E  YV+HDI+ +TTAQYRAPEM+DL +G+ +N+KSDIWALGVFLYKLCYYTTPFE+
Sbjct: 189 KNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPN 308
            GEA IL+   +FP YP YSD++K LI  ML++NP  RPNI Q+++ VS++    CP+ N
Sbjct: 249 VGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQGTPCPLRN 308

Query: 309 IHV 311
            +V
Sbjct: 309 FYV 311

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  444 bits (1141), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/311 (64%), Positives = 247/311 (79%), Gaps = 1/311 (0%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           M+ P +  Y  GT +TVGSH   I+KYLTSGG+A IYSA+I P D    +++A LKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LN+LRAEVDAMK LK HK++VSYIDSHAAKS   +G+YEVFL+MEYC+RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E E+L I   +SQGVAAMH LQPPLIHRDIKIENVLIS D  +K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPPK P+EL YV+HDI+ +TTAQYR+PEM+DL +G  V++KSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL+   +FP YP YSD +K LI ++L +NP+ RPNI Q++  VS++ 
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVNCPIPNIHV 311
            V CP+ N ++
Sbjct: 300 GVPCPVKNFYL 310

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  440 bits (1131), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 209/369 (56%), Positives = 268/369 (72%), Gaps = 9/369 (2%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  +  G  +TVGSH   ++KYLTSGGYAQ+Y  +I P+D ++ +N+A LKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LNTLRAEVDAMK LK+++++VSYIDSHA+KS   +G YEVF++ME+C RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MN+RLQ+RLTE EILTI  H SQG+AAMH LQP L+HRDIKIENVLIS +++YK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G +RPPK  +E  +V HDIM +TTAQYR+PEMLDL+KG  +N+KSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQT-GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           YYTTPFE+  GEA IL    ++P YP YSD +K LI  ML+KNP  RPN+ Q+++ VS+L
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 LNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTPHSAGKMLAGFQNDM 359
             + CPI N ++   +    +N  T    +   Y P    + +S P S    LA   + +
Sbjct: 301 QGIPCPIRNFYL---LRAMENNKRTIEQPVQNVYMP----TTLSQP-STQMNLASLNDTL 352

Query: 360 PKPSTKLGK 368
           P  + K  +
Sbjct: 353 PTAALKFNQ 361

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  437 bits (1124), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 251/320 (78%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P+IP Y PGT +TVGSH   I+KYLTSGG+AQIY+ +I P + +  +  A LKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK+ LNTLRAEVDAMK LK+++++VSYIDSHAA+S  + G YEVFL+MEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRLTE EIL I     QGV+AMH LQP LIHRDIKIENVLIS   ++K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V  YIRPP+ P+ELAYV+HD++ +TTAQYRAPEMLDL +G  +N+KSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GEA IL+   ++P +P Y+D +K LI + L ++P  RPNI Q+++ +S++ 
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVNCPIPNIHVPTDISIAVS 320
            + CPI N ++   I++  S
Sbjct: 301 GIPCPINNFYLSRTINVQAS 320

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  439 bits (1128), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 250/312 (80%), Gaps = 3/312 (0%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  YEPGT +TVGSH   I+KYLTSGG+AQ+Y+A+I P D +   N+A LKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT-YEVFLIMEYCSRGGLID 119
           PDK  LNTLRAEVDAMK LK++K++VSYIDSHAAKS  ++G  YEVF++ME+C RGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
           FMNTRLQNRL E+EIL I     QG+AAMH LQPPLIHRDIKIENVLIS++  YK+CDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239
           SVSG IRPP+  +E  YV+HDI+ +TTAQYR+PEM+DL +G  +++KSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           CYYTTPFE++GEAGIL+   ++PP+P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 LNVNCPIPNIHV 311
               CPI N ++
Sbjct: 299 QIKPCPIRNFYL 310

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  438 bits (1126), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/311 (64%), Positives = 246/311 (79%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P    Y  GT +TVGSH   I+KYLTSGG+A IYSA+I PAD     N+A LKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LN LRAEVDAMK L+ +K++VSYIDSHAAKS   DG+YEVFL+MEYCS GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRLTE E+L I   I+QG+AAMH L PPLIHRDIKIENVLIS+D  +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPPK  +E +YV++DI+ +TTAQYR+PEM+DL +G  +N+KSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ G+A IL+   +FP YP YSD +K LI  ML++NP  RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVNCPIPNIHV 311
           NV CP+ N ++
Sbjct: 301 NVPCPLRNFYL 311

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  436 bits (1120), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 239/311 (76%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I KY  GT + VGSH V +LKYL SGG+A +YS +I P D     N+A LKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK+ LNTLRAEVD+MK L+ +K+IVSYIDSHA KS    G YEV+L+MEYCS GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   +SQGVAAMH LQPPLIHRDIKIENVL+S +H++KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IR P+  EE  YV++DIM +TTAQYR PEM+DL +G  +++KSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE+ IL    EFP YP YSD VK LI  ML  +PL RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVNCPIPNIHV 311
            + CPI N ++
Sbjct: 301 GIPCPIKNFYL 311

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  436 bits (1121), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 249/312 (79%), Gaps = 3/312 (0%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MNTP I  YEPGT +TVGSH   I+KYLTSGG+AQ+Y+A+I P D +   N+A LKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG-TYEVFLIMEYCSRGGLID 119
           P K  LNTLRAEVDAMK L+++K++VSYIDSHAA+S  ++G  YEVF++ME+C RGGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS--VNGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
           FMNTRLQNRL E+EIL I     QG+ AMH LQPPLIHRDIKIENVLIS+D  YK+CDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239
           SVSG IRPP+  +E  YV+HDI+ +TTAQYR+PEM+DL +G  +++KSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           CYYTTPFE++GEAGIL+   ++P +P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 LNVNCPIPNIHV 311
            N  CPI N ++
Sbjct: 299 QNKPCPIRNFYL 310

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  431 bits (1107), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 256/349 (73%), Gaps = 5/349 (1%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y PG  + VGSH   ILKYLTSGG+AQ+Y  +I P D   G+N+A LKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQ----YMDGTYEVFLIMEYCSRGG 116
           PDK+ LN  RAEV+AMK L+++KY+VSYIDSHAAKS+      +G+YEVFL+MEYCS  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLC 176
           LIDFMNTRLQNRL E EIL I  H+SQGVAAMH LQPPL+HRDIKIENVLISN +++KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFL 236
           DFGSV G IRPP    EL +V+HDI+ +TTAQYR+PEML L+K   +N+KSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           YK+CYYTTPFE+ GE  IL+   ++P YP YSD +K LI  ML  +P  RPNI Q+++ V
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTP 345
           S+L  V CP+ N ++   I      +N  N  +   + P++    IS+P
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQ-FPPLHLQHSISSP 348

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  426 bits (1096), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/311 (63%), Positives = 243/311 (78%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P + +   GT +TVG+HSV ILKYLTSGG+AQIY+ +I+    F G+N+A LKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LN LRAEVDAMK L ++K++VSYIDSHA +S   DGTYEVFL+MEYC  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRLTE EIL I    +QG+A MH L PPL+HRDIKIENVL+S    YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IRPP+  +EL YV+HDIM +TTAQYR PEMLDL +G  +++K+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL+   +FP +P+YSD +K LI SML ++P  RPN+ Q+++ VS++ 
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVNCPIPNIHV 311
           NV CPI N ++
Sbjct: 301 NVPCPIRNFYL 311

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  430 bits (1106), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/312 (63%), Positives = 247/312 (79%), Gaps = 3/312 (0%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P I  Y+PGT +TVGSH   I+KYLTSGG+AQ+Y+A+I P D +   N A LKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG-TYEVFLIMEYCSRGGLID 119
           PDK  LNTLRAEVDAMK LK++K++VSYIDSHAAKS  ++G  YEVF++ME+C RGGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
           FMNTRLQ+RL E+EIL I     QG+AAMH LQPPLIHRDIKIENVLIS+D  YK+CDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239
           SVSG IRPP+  +E  YV+HDI+ +TTAQYR+PEM+DL +   +++KSDIWALGVFLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           CYYTTPFE++GEA IL+   ++P +P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 LNVNCPIPNIHV 311
            N  CPI N ++
Sbjct: 299 QNEPCPIRNFYL 310

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  426 bits (1096), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 247/311 (79%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y PGT ++VG+H   ILKY+ SGG+AQ+YSA++ PAD   GTN   LKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           P+K+ LN LRAEV+AMK LK  K++V YIDSHAA+S   +GTYEVFL+ME+C+ GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QG+AAMH LQPPLIHRDIKIENVLIS D +YK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IRPP+ P+E A+V+HDI+ +TTAQYR+PEM+DL +  ++++KSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ G+  IL+   +F  +P YSD +K LI  ML++ P+ RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVNCPIPNIHV 311
            V+ P+ N ++
Sbjct: 301 GVSSPMRNFYL 311

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  425 bits (1092), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 241/311 (77%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y  G ++ VG H   ILKYLTSGGYAQ+Y A+I P D   G+++  LKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK+ LNT RAEVDAMK L++  ++VSYIDS+AAKS   +G YEV L+ME+C+ GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E EIL I   ++QGVAAMH+L+PPL+HRDIKIENVLISN  +YKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP + +E  +V+HDI+ +TTAQYRAPEM+DL++   +++KSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GEA IL+   E+  YPHYSD +K LI  MLA  P  RPNI Q+++ VS+L 
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVNCPIPNIHV 311
            + CPI N ++
Sbjct: 301 GIPCPIKNFYL 311

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  423 bits (1088), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/302 (62%), Positives = 238/302 (78%), Gaps = 1/302 (0%)

Query: 10  EPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTL 69
           +PG  +TVGSH V I++YLTSGG+AQIYS +++      G+ +A LKRV VPDK  LNTL
Sbjct: 10  QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHVPDKPSLNTL 68

Query: 70  RAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRL 129
           RAEVDAMK LK H+++VSYIDSHAAKS   DGTYEV+L+MEYC RGGLIDFMN+RLQ RL
Sbjct: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRL 128

Query: 130 TETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPK 189
           +E E+L I  H++QG+ AMH L PPLIHRDIKIENVLIS D  +K+CDFGSVSG IRPPK
Sbjct: 129 SEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPK 188

Query: 190 TPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQT 249
              E  YV+HDI+ +TTAQYRAPEM+DL +   V++KSDIWALGVFLYK+CY+TTPFE+ 
Sbjct: 189 NAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248

Query: 250 GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPNI 309
           GE  IL    +FP YP Y+D +K LI  ML+++P+ RPNI Q+++ VS++  V CP+PN 
Sbjct: 249 GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPNF 308

Query: 310 HV 311
           ++
Sbjct: 309 YL 310

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  422 bits (1085), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/311 (62%), Positives = 245/311 (78%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P+IP Y  GT +TVG+H   I KYLTSGG+AQIY+ +I P D +  +N+A LKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           P KS LNTLRAEVDAMK LK+++++VSYIDS+A KS + +G+YEV L+MEYC  GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MN+RLQNRL+E EIL I    +QGVA MH LQP L+HRDIKIENVL S + ++KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V GYIRPP+  +EL+YV+HDI+ +TTAQYR PEMLDL +G  +++KSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+TGE  IL+   ++P +P YSD +K LI  ML++NP  RPNI ++++ +S + 
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVNCPIPNIHV 311
            V CPI N ++
Sbjct: 301 GVPCPIQNFYL 311

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  419 bits (1076), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/324 (59%), Positives = 241/324 (74%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN PHI  Y+PGT + VG H V I+KYLTSGG+AQIY  Q+ P +   G N+A LKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           P+KS LNTLRAEV+AM+ LK   ++V YIDS+AA+S   DGTYEV  +ME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNTRLQNRL E E+L I   ++QG+ AMH+L PPLIHRDIKIENVLIS++ +YK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           VSG IRPPK  EE  +V+ DIM +TTAQYR PEMLDL +G  +N+KSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE  GE  IL+   ++P YP YS  +K LI  ML + P  RPN+ Q+++ VS + 
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVNCPIPNIHVPTDISIAVSNNNT 324
            + CP+PN ++    +  +  NNT
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNT 324

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  419 bits (1076), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 239/303 (78%), Gaps = 1/303 (0%)

Query: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNT 68
           ++PGT +TVGSH V ++KYLTSGG+AQIY  +++  D  +  ++A LKRV VPDK  LNT
Sbjct: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHVPDKQSLNT 67

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           LRAEVDAMK L+ +K+IVSYIDSHA+KS   +G+YEV L+MEYCSRGGLI FMNTRLQ+R
Sbjct: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           L E E+L I   + QG+ AMH LQPPLIHRDIKIENVLI+ +   K+CDFGSV G IRPP
Sbjct: 128 LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP 187

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
           K   EL+YV+HDI+ +TTAQYRAPEM+DL +GFSV++KSDIWALGVFLYKLCYYTTPFE+
Sbjct: 188 KNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK 247

Query: 249 TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPN 308
           TGE  IL    +FP YP YS+ +K LI  MLA+NP+HRPN  Q+++ V ++    CP+ N
Sbjct: 248 TGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKN 307

Query: 309 IHV 311
            ++
Sbjct: 308 FYL 310

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  416 bits (1070), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/311 (60%), Positives = 240/311 (77%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN   +P Y P T VTVGSH+  I+KYL SGGYAQ+YSA + P D    TN+A LKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           PDK  LN LRAEVDA+K L++ KY+VSYIDSHA+K     G+YEVF++MEYCS G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           +NTRL+NRL E EIL I   ++ GVA MH LQP LIHRDIKIEN+LIS + +YK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
           V G IRPP++ EE+ Y++HDIM +TTAQYR+PEMLDLTKG+ +N+KSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300
           YYTTPFE+ GE  IL    ++P YP YSD++K +I  +L+ +P  RPNI Q+I+ +S+L 
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVNCPIPNIHV 311
            +  P+ N ++
Sbjct: 301 GIVPPMKNFYL 311

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  433 bits (1113), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 205/328 (62%), Positives = 248/328 (75%), Gaps = 5/328 (1%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP---ADQFLGTNMAVLKR 57
           MN P IPKYE G  + +G+H V I KYL  GG+AQ+YS +++    A   LGT MA LKR
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKR 59

Query: 58  VIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117
           VIVPDKS LNTLRAEVDAMK LK +KYIVSYIDSHA +S+   G YEVFL+MEYCSRGG+
Sbjct: 60  VIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGV 119

Query: 118 IDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177
           IDF+NTRL +RL E EIL I   + QGVAAMH LQPPLIHRDIKIENVLIS +  YK+CD
Sbjct: 120 IDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICD 179

Query: 178 FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLY 237
           FGS    +RPPKTP+E A++ HDIM++TTAQYR+PEM+D   G+ +++KSDIWALGVFLY
Sbjct: 180 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 239

Query: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297
           KLCYYTTPFE+ GE  ILN   +FP YP YSD ++ +I  ML K+P+ RPNI Q+++ VS
Sbjct: 240 KLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299

Query: 298 KLLNVNCPIPNIHVPTDISIAVSNNNTG 325
           KL  V CPI N  + T I +  S NN+ 
Sbjct: 300 KLQGVPCPIENFML-TRIKLQNSRNNSN 326

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  382 bits (981), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 234/314 (74%), Gaps = 6/314 (1%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60
           MN P IP Y PG  + VGSH   ILKYLTSGG+AQIYS +I P D++  +N+A LKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120
           P+KS LN LR EVDAMK LK+++++VSYIDS+AAKS++ +G+YEVFL+MEYC RG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180
           MNT+L+ RL E E+L I   + QG+AAMH L PPLIHRDIKIENVLIS D  +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS---DIWALGVFLY 237
           V G IRPP+ P+EL YV+HD+M +TTAQYR+PEM+DL KGF +  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297
            L +YT  F +  E  ILNG  ++P YP YSD +K ++  +L+ +P+ RPNI Q+++ +S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 KLLNVNCPIPNIHV 311
           K+ N+ CPI N ++
Sbjct: 298 KIQNIPCPIDNFYL 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  376 bits (966), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 228/309 (73%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLN 67
           KY+ GT + V SH V I  YLTSGG+AQ+Y+A+I    + L   +  LKRVIVP+K  LN
Sbjct: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLN 67

Query: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN 127
            LRAEVDAMK LK++KYIVSYIDSHA + Q  + +Y V L+MEYCS  GL+DFMN RL+ 
Sbjct: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKE 127

Query: 128 RLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRP 187
           RL E EIL I   +SQGV  MH LQPPL+HRDIKIENVL+S D  +KLCDFGSVSG +R 
Sbjct: 128 RLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187

Query: 188 PKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE 247
           P + EE  Y+++DI+ +TTAQYR+PEM++L  GF +N+KSDIWALG+ LYKLCYYTTPFE
Sbjct: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247

Query: 248 QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIP 307
           + G   I+ G   +P YP Y+D++K +I  +L+ NP+ RPNI Q+++ + ++ + + P+P
Sbjct: 248 EHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLP 307

Query: 308 NIHVPTDIS 316
           N +V   +S
Sbjct: 308 NFYVQRAMS 316

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  302 bits (774), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 217/322 (67%), Gaps = 20/322 (6%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGTN------------- 51
           I K+  G +V VGSH V I+KYLT GG+AQIY  ++    ++F   +             
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 52  -MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIME 110
            +  LKRV+V D++ L+ ++ EV+ MK+L+    +V Y DS+A +++  +G +EVFL+ME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170
           YC    L+D+MN RL  +LTE+EIL I   I+ GV+ +H L  PLIHRDIKIENVL+ ++
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 HKYKLCDFGSVSGYIRPP--KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSD 228
           +++KLCDFGS +  I PP   T ++++ + HDI + TT QYR+PEM+DL +   VN+K+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPN 288
           IWALGVFLYKL +YTTPFE TG+  IL+   E  P  HYS+ +  LI+ MLA+NP  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEI-PQSHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 IFQIIQTVSKLLNVNCPIPNIH 310
           I+Q++  +  +LNV  PIP+I+
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  290 bits (742), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 200/320 (62%), Gaps = 22/320 (6%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP----------------ADQFLG-- 49
           K+ PG  V VG H V I+KYL  GG+AQIYS   +                  D+F    
Sbjct: 18  KFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFK 77

Query: 50  ---TNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVF 106
               N+A LKRV+VPD++ LN LR EV+ M++LK    IV Y DS+A++    +  +EV 
Sbjct: 78  LEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVL 137

Query: 107 LIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVL 166
           L+ME C    L+D+MN RL  +L+E EIL I   ++ G++ MH LQ PLIHRDIKIENVL
Sbjct: 138 LLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVL 197

Query: 167 ISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDK 226
           + + + +KLCDFGS S       + +E+A +  +I + TT QYR+PEM+DL +   +++K
Sbjct: 198 VDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEK 257

Query: 227 SDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
           SDIWALGVFLYKL +YTTPFE TG+  IL+   E PP  +YS  +  LI+ MLA+NP  R
Sbjct: 258 SDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLR 316

Query: 287 PNIFQIIQTVSKLLNVNCPI 306
           PNI+Q++  V   + +  PI
Sbjct: 317 PNIYQVMHQVCITIGIEPPI 336

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  291 bits (745), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 208/316 (65%), Gaps = 11/316 (3%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQF--LGT------- 50
           +N+P+  KY  G  ++VG+H V I+ YL  GG+AQIY  + +   ++F  LG+       
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIME 110
           ++A LKRVIV D+  LN +R EV+ MK+LK    IV Y DS+A++       +EV L+ME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170
            C    L+D+MN RL+ +L+E+EIL I   +S G++ MH L  PLIHRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230
           + +KLCD GS S    P  + +++A +  +I + TT QYRAPEM+DL +   +N+KSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF 290
           ALG+FLYKL +YTTPFE TG+  IL+   +FPP   YS  +  LI+ MLA+NP  RPNIF
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QIIQTVSKLLNVNCPI 306
           Q++  +  ++N+  PI
Sbjct: 311 QVVYHICSIMNLPVPI 326

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  287 bits (735), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 202/311 (64%), Gaps = 9/311 (2%)

Query: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM--------PADQFLGTNMAVL 55
           P + K  PGT + VGSH V I+KYL  GG+A IY  + +        P+      ++A L
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRG 115
           KRV+V D++ LN LR EV+ MK+LK+   IV Y DS+A++ +     YEV L+ME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKL 175
            L+D+MN RL  +L+E E+L I   +++ VA MH L  PLIHRDIKIENVL+ +++ +KL
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVF 235
           CDFGS S       T +++A + ++I + TT QYRAPEM+DL +   +++KSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
           LYKL +YTTPFE TG+  IL+   + P   +YS  +  LI+ MLA+NP  RPNI+Q+I  
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSKLLNVNCPI 306
           V  ++ V+ P 
Sbjct: 326 VCAIMKVDVPF 336

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  287 bits (735), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 204/320 (63%), Gaps = 20/320 (6%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-------------ADQFLGTNM 52
           + KY+PG  + VGSH V IL+Y+  GG+AQIYS + +               DQ    ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  AVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAK------SQYMDGTYEVF 106
           A LKRVIV D++ LN LR EV+ MK+L     IV Y DS+A++      SQ  +  +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVL 166
           L+ME C    L+D+MN RL  +L+E EIL +   +S  +A MH L+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 ISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDK 226
           +   +++KLCDFGS S       T  ++AY+  +I + TT QYR+PEM+DL +   +++K
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
           SDIWALG+FLYKL ++TTPFE+TG+  IL+   EFP   +YS  +  LI+ ML++NP  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 287 PNIFQIIQTVSKLLNVNCPI 306
           PNI+Q++  + +L  V  PI
Sbjct: 314 PNIYQVLHQICQLKQVPIPI 333

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  283 bits (725), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 199/318 (62%), Gaps = 16/318 (5%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT---------- 50
           +  P + ++ PG  V VG+H V ++ YL  GG+AQIY  + +   ++L            
Sbjct: 14  VGNPTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFL---EYLNEFENKSKVPMK 70

Query: 51  --NMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLI 108
             ++A LKRV+V D++ L+ +R EV+ MK+L   + IV Y DS+A +    +  +EV L+
Sbjct: 71  VGDVACLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLL 130

Query: 109 MEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLIS 168
           ME C    L+D+MN RL  +LTE EIL I   +S  V+ MH L+ PLIHRDIKIENVL+ 
Sbjct: 131 MELCPNKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVD 190

Query: 169 NDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSD 228
             + +KLCDFGS S       T +E+A +  +I + TT QYR PEM+DL +   +N+KSD
Sbjct: 191 AQNSFKLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSD 250

Query: 229 IWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPN 288
           IWALG+FLYKL ++ TPFE TG+  IL+   EFPP  HYS  +  LI+ MLA+NP  RPN
Sbjct: 251 IWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPN 309

Query: 289 IFQIIQTVSKLLNVNCPI 306
           I+Q++  +  ++ V  PI
Sbjct: 310 IYQVLNHICTMIGVEVPI 327

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  284 bits (726), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 200/306 (65%), Gaps = 15/306 (4%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGTN---------MAVL 55
           + K+  G+TV VG+  V I+KYLT GG+AQIY  + +  +++F   N         +A L
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT--YEVFLIMEYCS 113
           KRV+V D++ LN +R EV+ MK LK    IV Y DS+A++ +  DGT  +EV L+ME C 
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRK--DGTNGFEVLLLMELCP 139

Query: 114 RGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKY 173
              L+DFMN RL  +L+E EILTI   ++  VA MHTL PPLIHRDIKIENVL+ + + +
Sbjct: 140 NKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGF 199

Query: 174 KLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALG 233
           KL DFGS S         +++A +  DI M TT QYR+PEM+DL K   +++KSDIWALG
Sbjct: 200 KLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALG 259

Query: 234 VFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
           +FLYKL +Y TPFE TG+  IL+   +F P  +YS  +  LI+ ML++NP  RPNI+Q++
Sbjct: 260 IFLYKLLFYITPFEMTGQFAILHSKYDF-PQTNYSSRLINLIIIMLSENPNLRPNIYQVL 318

Query: 294 QTVSKL 299
             +  +
Sbjct: 319 HEICSI 324

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  281 bits (719), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 140/312 (44%), Positives = 200/312 (64%), Gaps = 10/312 (3%)

Query: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM---------PADQFLGTNMAV 54
           P + + + G+ V VG+H V I+KYL  GG+A IY  + +         P  +    ++A 
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSR 114
           LKRV+V D++ LN +R EV  MK+L     IV Y DSHA++++     +EV L+ME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174
             L+D+MN RL  +L+E EIL I   +++ +A MH L  PLIHRD+KIENVL+  +H +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
           LCDFGS S       T +E+A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           FLYKL +YTTPFE TG+  IL+   EF P  +YS  +  LI+ MLA+NP  RPNI+Q++ 
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEF-PVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 TVSKLLNVNCPI 306
            +  +L V  P+
Sbjct: 365 NLCSILKVKNPL 376

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  280 bits (716), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 199/312 (63%), Gaps = 10/312 (3%)

Query: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM---------PADQFLGTNMAV 54
           P + + + G+ V VG+H V I+KYL  GG+A IY  + +         P+        A 
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSR 114
           LKRV+V D++ LN +R EV  MK+L     IV Y DSHA++S+     +EV L+ME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174
             L+D+MN RL  +L+E EIL I   +++ +A MH L  PLIHRD+KIENVL+  D+ +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
           LCDFGS S  +    T +E+A + ++I + TT QYR+PEM+DL +   +++KSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           FLYKL +YTTPFE TG+  IL+   EF P  +YS  +  LI+ MLA+NP  RPNI+QI+ 
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEF-PINNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 TVSKLLNVNCPI 306
            +  ++ V  PI
Sbjct: 323 NLCSIMKVENPI 334

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  278 bits (710), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTN---------MAVLK 56
           I  Y PG  V VG H V I+KYL  GG+A+IY A+ +   + +  N         +  LK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGG 116
           RV+V D + LN +R EV  MK+L     IV   DS+A++       YEV L+ME CS   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLC 176
           L+D+MN RL  +LTE EIL I   ++  VA MH L  PLIHRDIKIENVL+ + + +KLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFL 236
           DFGS S  +    T  ++A +  ++ + TT QYR+PEM+D+ +   +N+KSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           YKL +Y TPFE+TG+  IL+   EFP +  YS  +  LI+ MLA+NP  RPNI+Q++  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SKLLNVNCPIPNIH 310
            K++N+  PI +I+
Sbjct: 395 CKIINIKTPIDDIY 408

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  278 bits (712), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 143/312 (45%), Positives = 200/312 (64%), Gaps = 20/312 (6%)

Query: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT------------NMAVLK 56
           Y PGT V VG H V ++KYL  GG+A+IY  + +   ++L T            +   LK
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFL---EYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT--YEVFLIMEYCSR 114
           RV+V D + LN +R EV+ M++LK    +V Y DS+A  S+ +DG   YEV L+ME CS 
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNA--SRRIDGAPGYEVLLLMELCSN 143

Query: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174
             L+D+MN RL  +L+E EIL I   ++  VA MH L  PLIHRDIKIENVL+ + + +K
Sbjct: 144 NSLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFK 203

Query: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
           LCDFGS S  +    + +++A +  +I + TT QYR+PEM+DL +   VN+KSDIWALGV
Sbjct: 204 LCDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGV 263

Query: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           FLYKL +YTTPFE+TG+  IL+   EF P  +YS  +  LI+ MLA+NP  RPNI+Q++ 
Sbjct: 264 FLYKLMFYTTPFERTGQFAILHSKYEF-PLNNYSSKLINLIIVMLAENPNLRPNIYQVLN 322

Query: 295 TVSKLLNVNCPI 306
            +  +  +  P+
Sbjct: 323 QICYISGIKNPM 334

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  277 bits (708), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 195/308 (63%), Gaps = 15/308 (4%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT----------NMAVLKRVIV 60
           P T V VG+H   IL++L  GG+A IY  + +     +            ++A LKRVIV
Sbjct: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT--YEVFLIMEYCSRGGLI 118
           PD++ LN LR EV+ MK+L+    IV Y DS+A  S++ DG+  +E+ L+ME C +  L+
Sbjct: 91  PDENGLNELRNEVETMKQLRGSPNIVQYYDSNA--SRHPDGSPGFEILLLMELCPKKSLL 148

Query: 119 DFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDF 178
           D+MN +L  +LTE EIL I   +S  +A MH L  PLIHRDIKIENVL+  D  +KLCDF
Sbjct: 149 DYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDF 208

Query: 179 GSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYK 238
           GS S       T +++A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+FLYK
Sbjct: 209 GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 268

Query: 239 LCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSK 298
           L +YTTPFE TG+  IL+   E P    YS  +  LI+ MLA+NP  RPNI+Q++  V  
Sbjct: 269 LLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327

Query: 299 LLNVNCPI 306
           +L  + P 
Sbjct: 328 ILKCDVPF 335

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  278 bits (712), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 208/327 (63%), Gaps = 20/327 (6%)

Query: 2   NTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPA-DQF------------- 47
           N   I K+E G  + VG+H V I+ YLT GG+AQIY  + +   ++F             
Sbjct: 24  NVGTIEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISN 83

Query: 48  ----LGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
               LG ++A LKRV+V D+  LN +R EV+ MK+L+    IV Y DS+A +S   +  Y
Sbjct: 84  YSLKLG-DVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGY 142

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           EV L+ME CS   L+++MN RL  +L+E E+L I   ++ GVA MH L+ PLIHRDIKIE
Sbjct: 143 EVLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIE 202

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
           NVL+ +++ +KLCDFGS +       T +++A +  ++ + TT QYR+PEM+DL +   +
Sbjct: 203 NVLVDSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPI 262

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNP 283
           N+KSDIWALGVFLYKL +YTTPFE TG+  +L+   + P    YS  +  L++ ML++N 
Sbjct: 263 NEKSDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPAN-KYSSKIINLVIIMLSENL 321

Query: 284 LHRPNIFQIIQTVSKLLNVNCPIPNIH 310
             RPNI+Q++  + +L+ V+ PI +I+
Sbjct: 322 NLRPNIYQVMHYICQLIQVDTPILDIY 348

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  280 bits (715), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 199/315 (63%), Gaps = 10/315 (3%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT--------N 51
           M  P + +Y PG  V VG+H V I+ YL  GG+AQIY  + +   ++F           +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           +A LKRV+V D++ LN +R EV+ MK+LK    +V Y DS+A++ +     +EV L+ME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
           C    L+D+MN RL  +LTETEI+ I   ++  ++ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            +KL DFGS S       T +++A +  +I + TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291
           LG+FLYKL ++TTPFE TG+  IL+   EF P   YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 IIQTVSKLLNVNCPI 306
           ++  +  +LNV  PI
Sbjct: 313 VLCHLCDILNVEVPI 327

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  280 bits (715), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 202/315 (64%), Gaps = 10/315 (3%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT--------N 51
           M  P + +Y PG  V VG+H V I+ YL  GG+AQIY+ + +   ++F  T        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           +A LKRV+V D++ LN +R EV+ MK+LK    +V Y DS+A++ +     +EV L+ME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
           C    L+D+MN RL  +L+E+EI+ I   ++  ++ MH L  PLIHRDIKIENVL+  ++
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            +KL DFGS S       T +++A +  +I + TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291
           LG+FLYKL ++TTPFE TG+  IL+   EF P   YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 IIQTVSKLLNVNCPI 306
           ++  +  +LN   PI
Sbjct: 313 VLYHICDILNAEVPI 327

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  278 bits (711), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 144/315 (45%), Positives = 198/315 (62%), Gaps = 18/315 (5%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGTN------------MAV 54
           K+  G  VTVGSH V ++ YL  GG+AQIY  + +   ++F   N             A 
Sbjct: 95  KFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPAC 154

Query: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT----YEVFLIME 110
           LKRV+V D+  LN +R+EV+ MK+L+    IV Y DS+A++ +   G     +EV L+ME
Sbjct: 155 LKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLME 214

Query: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170
            C    L+D+MN RL  +LTE EI  I   I+  VA MH L  PLIHRDIKIENVL+  +
Sbjct: 215 LCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDAN 274

Query: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230
           + +KLCDFGS S       + +++A +  D+ M TT QYR+PEM+DL K   +N+KSDIW
Sbjct: 275 NNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIW 334

Query: 231 ALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF 290
           ALGVFLYKL ++TTPFE+TG+  +L+   EFPP   YS  +  LI+ MLA+NP  RPNI+
Sbjct: 335 ALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIY 393

Query: 291 QIIQTVSKLLNVNCP 305
           Q++  +S++ N   P
Sbjct: 394 QVLYYLSEVTNREVP 408

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  279 bits (714), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 198/315 (62%), Gaps = 16/315 (5%)

Query: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT------------N 51
           P +  Y PGT V VG+  V I+ ++  GG+AQIYS + +   +FLG             +
Sbjct: 17  PVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYI---KFLGEFNNGSKAPLQPGD 73

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           +A LKRV+VPD++ L+ +R EV+ MK+L+  K I+ Y DS+A++       YEV L+ME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
           C    L+D+MN RL  RLTE EIL +    +  ++ MH L  PLIHRDIKIENVL+   +
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            +KLCDFGS S       T +++A +  +I ++TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291
           LG+FLYKL ++ TPFE TG+  IL+   EFP    YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 IIQTVSKLLNVNCPI 306
           ++  +  ++    PI
Sbjct: 313 VMHHICSVIGCEVPI 327

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  280 bits (715), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 205/327 (62%), Gaps = 25/327 (7%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPA-DQFLGTN--------------- 51
           K+  GT V VGSH V I+KY+  GG+AQIY+ + + + ++F  +N               
Sbjct: 23  KFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPN 82

Query: 52  --------MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
                   +A LKRV+V D++ LN +R EV+ MK+LK    +V Y DS+A++       +
Sbjct: 83  PMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGF 142

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           EV L+ME C    L+D+MN RL  +LTE EIL I   I+  V+ MH L+ PL+HRDIKIE
Sbjct: 143 EVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIE 202

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
           NVL+   + +KLCDFGS S  +    T +++A +  +I + TT QYR+PEM+DL +   +
Sbjct: 203 NVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 262

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNP 283
           ++KSDIWALG+FLYKL ++ TPFE TG+  IL+   EFP   +YS  +  LI+ MLA+NP
Sbjct: 263 DEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENP 321

Query: 284 LHRPNIFQIIQTVSKLLNVNCPIPNIH 310
             RPNI+Q++  +  ++NV  PI +I+
Sbjct: 322 NLRPNIYQVLDNICSMMNVEVPIEDIY 348

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  278 bits (711), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 200/315 (63%), Gaps = 10/315 (3%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT--------N 51
           M  P + +Y PG  V VG+H V ++ YL  GG+AQIY  + +   ++F  T        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           +A LKRV+V D++ LN +R EV+ MK+LK    IV Y DS+A++ +     +EV L+ME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
           C    L+D+MN RL  +LTE EI+ I   ++  ++ MH L   LIHRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            +KL DFGS S       T +++A +  +I + TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291
           LGVFLYKL ++TTPFE TG+  IL+   EF P   YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 IIQTVSKLLNVNCPI 306
           ++  + ++LNV  PI
Sbjct: 313 VLYHLCEILNVEVPI 327

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  275 bits (703), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 141/309 (45%), Positives = 202/309 (65%), Gaps = 13/309 (4%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT--------NMAVLKRVI 59
           K   G+ + VG H V I++YL  GG+A IY    +     L          ++A LKRV 
Sbjct: 27  KLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQ 86

Query: 60  VPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT--YEVFLIMEYCSRGGL 117
           V D++ LN LR EV+ MK+LK    +V Y DS+A  S++ DGT  +EV L+ME CS G L
Sbjct: 87  VNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNA--SRHTDGTPGFEVLLLMELCSNGSL 144

Query: 118 IDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177
           +D+MN RL  +L+E E+L I   I++G++ MH L+ PLIHRDIKIENVL+ + + +KLCD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 178 FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLY 237
           FGS S  +    T +E+A + ++I + TT QYR+PEM+DL +  ++N+KSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297
           KL +YTTPFE TG+  IL+   + P   ++S  +  LI+ MLA+NP  RPNI+QI+  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 298 KLLNVNCPI 306
            ++  + PI
Sbjct: 324 SIMECDVPI 332

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  278 bits (711), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 139/316 (43%), Positives = 200/316 (63%), Gaps = 17/316 (5%)

Query: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT------------- 50
           P+  +Y PGT V VG+H V I+KY+  GG+AQIY+ + +   +FL               
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFI---EFLNEFENNRMKPKLQMG 73

Query: 51  NMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIME 110
           ++A LKRV+V D++ LN +R EV+ MK+L+    IV Y DS+A++       +EV L+ME
Sbjct: 74  DVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133

Query: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170
            C    L+D+MN RL  +LTE EIL I   ++  V+ MH L  PL+HRDIKIENVL+   
Sbjct: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193

Query: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230
           + +KLCDFGS S       T +++A +  +I + TT QYR+PEM+DL +   +++KSDIW
Sbjct: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253

Query: 231 ALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF 290
           ALG+FLYKL ++TTPFE TG+  IL+   EFP   +YS  +  LI+ MLA+NP  RPNI+
Sbjct: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIY 312

Query: 291 QIIQTVSKLLNVNCPI 306
           Q++  +  +  +  PI
Sbjct: 313 QVLHNICSISGMKVPI 328

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  276 bits (706), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 149/333 (44%), Positives = 205/333 (61%), Gaps = 38/333 (11%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT-------------- 50
           I KY+ GT +TVG   + ILKYLT GG+AQIY+ + +   ++F                 
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  NMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT-------- 102
           ++A LKRV+VPD++ L+ +R EVD MK+L +   IV Y DS+A+K +  D +        
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIK--DNSNIDTTNNN 154

Query: 103 ---------YEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQP 153
                    +E+ L+MEYC    L+DFMN RL  +LTE EIL     I+  V  MH L  
Sbjct: 155 DNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQ 214

Query: 154 PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPE 213
           PLIHRDIKIENVL+ +++ +KL DFGS +    P  T +++A +  DI M+TT QYR+PE
Sbjct: 215 PLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPE 274

Query: 214 MLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQ 273
           M+DL K   +++KSDIWALGV LYKL +YTTPFE TG+  IL+   EFP   +YS     
Sbjct: 275 MIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFIN 333

Query: 274 LIMSMLAKNPLHRPNIFQI---IQTVSKLLNVN 303
           LI+ MLA+NP  RPNIFQ+   ++++S  +N N
Sbjct: 334 LIIIMLAENPNLRPNIFQVLYYLKSISNTMNSN 366

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  276 bits (707), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 201/315 (63%), Gaps = 10/315 (3%)

Query: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGT--------N 51
           M  P + ++ PG  V VG+H V ++ YL  GG+AQIY  + +   ++F           +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           +A LKRV+V D++ LN +R EV+ MK+LK    +V Y DS+A++ +     +EV L+ME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
           C    L+D+MN RL  +LTE+EI+ I   +   ++ MH L  PLIHRDIKIENVL+  ++
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            +KL DFGS S       T +++A +  +I + TT QYR+PEM+DL +   +N+KSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQ 291
           LG+FLYKL ++TTPFE TG+  IL+   EF P   YS  +  LI+ MLA+NP  RPNI+Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEF-PVNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 IIQTVSKLLNVNCPI 306
           ++  + ++LN+  PI
Sbjct: 313 VLYHLCEILNIEVPI 327

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  267 bits (683), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 137/312 (43%), Positives = 197/312 (63%), Gaps = 15/312 (4%)

Query: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFL---GTN----------MAV 54
           Y  GT V VGSH V ++KY+  GG+AQIY+ + +   ++F    G N          +A 
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSR 114
           LKRV+V D + LN +R EV+ M++L+    +V Y DS+A+        YEV L+ME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174
             L+D+MN RL  RL+E EI+ I    + G+A +H L+ PLIHRDIKIENVL+  ++ +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
           LCDFGS S          ++A    +I ++TT QYR+PEM+DL +   +++KSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           FLYKL ++TTPFE+TG+  IL+   EFP   +YS  +  LI+ MLA+NP  RPNI+Q++Q
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 TVSKLLNVNCPI 306
            +  +     P+
Sbjct: 398 YLCSINGWKVPL 409

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  263 bits (672), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 195/307 (63%), Gaps = 9/307 (2%)

Query: 12  GTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-------ADQFLGT-NMAVLKRVIVPDK 63
           G+TV VG H V +++YL  GG+A IY    +         D+ L   +   LKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  SHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNT 123
           + LN LR EV+ MK+L++   IV Y DS+A++       YEV L+ME C  G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSG 183
           RL  +L+E E+L I   I+ G++ MH  + PLIHRDIKIENVL+  D+ +KLCDFGS S 
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 YIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYT 243
            +    + +E+A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+FLYKL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVN 303
           TPFE TG+  IL+   E  P   +S  +  L++ MLA+NP  RPN++Q++  +  ++   
Sbjct: 272 TPFELTGQFAILHSKYEI-PRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPIPNIH 310
             I +++
Sbjct: 331 VKIDDLY 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  258 bits (659), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 131/312 (41%), Positives = 191/312 (61%), Gaps = 12/312 (3%)

Query: 6   IPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIM--------PADQF---LGTNMAV 54
           I KY+PG  ++VG+H V I  YL  GG+AQIY  + +          DQ       ++A 
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSR 114
           LKRV+V D++ LN +R EV+ MK L+    IV Y DS+A +       YE+ L+ME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYK 174
             L+D+MN RL+ +L ETEI+ I    +  V+ MH L  PLIH+DIK+EN+L+ +++ +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
           LCDFGS S       +  ++A +  +I M TT QYR+PEM+DL +   +N+ SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           FLYKL ++ TPFE+TG+  IL+   +  P  +Y   +  LI+ ML++N   RPNI+Q++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDI-PVNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 TVSKLLNVNCPI 306
            +  + N   PI
Sbjct: 331 EICSITNTPLPI 342

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 143/334 (42%), Gaps = 61/334 (18%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVD 74
           V++      I K L  GG + +Y  +    + F       LK+   P      ++ +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVESKEGELF------ALKKTRCP----FGSIGSISP 68

Query: 75  AMKRLKHHK-----YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN-- 127
           AMK + +++     YI   +DS   + +  DG+  V++++ Y ++G L D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQEK--DGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLTETEILTIQLHISQGVAAMHTLQP---------------------------------- 153
           +++E +IL + L I++G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAP 212
               HRD+K  N++IS +    + D GS S       + + L   +     + T  Y AP
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAP 246

Query: 213 EMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GILNGGVEFPPYP 265
           E+LD+     + +K DIW+ G  +Y +C+  +PFE+  +         I  G    P   
Sbjct: 247 EILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGT 306

Query: 266 HYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
            YS ++ +LI   L+ NP  RP++ ++I  + +L
Sbjct: 307 SYSSSLIELIGKCLSVNPEQRPSVNELIALLMEL 340

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 128/265 (48%), Gaps = 24/265 (9%)

Query: 66  LNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRL 125
           ++ L  E+  +  LK   YI++YI      +  M+    ++++M+YC  G   D +    
Sbjct: 56  IDLLAQEIFFLAELKSD-YIINYI------TTIMEDV-SMWIVMDYCGGGSCSDLIKIVY 107

Query: 126 QNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYI 185
            N + E ++  I  ++  G+  +H  +   IHRDIK  N+L+++D + KL DFG VSG I
Sbjct: 108 PNGIVEEKVSFIVKNVLLGLQYLH--EQKKIHRDIKAANILLTDDGQVKLGDFG-VSGQI 164

Query: 186 RPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTP 245
           +        A ++ D  +  T  + APE+++       ++K DIW+LG+  Y+L     P
Sbjct: 165 K--------ATLKRDTFVG-TPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPP 215

Query: 246 FEQTGEAGILNGGVEF-PPYPH--YSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNV 302
             +     ++   V+  PP  H  Y+D  K  I   L K+P  RPN+  +++T   +   
Sbjct: 216 LSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLKT-DFIFKF 274

Query: 303 NCPIPNIHVPTDISIAVSNNNTGNM 327
           N  I N+    D+   + N   GN 
Sbjct: 275 NGKIKNLQKDVDLCKKIKNKENGNF 299

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 134/276 (48%), Gaps = 30/276 (10%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           I + +  G +  +Y A     ++  G  +AV    +      +N L  E+  +  LK   
Sbjct: 19  IKQCVGRGNFGDVYKA----CEKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELKS-P 73

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           YI +YI +       M     +++IMEYC  G   D +       L E++   I   + +
Sbjct: 74  YITNYITT-------MTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLK 126

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
           G+  +H  +   IHRDIK  N+L++++ K KL DFG VSG IR        A ++    +
Sbjct: 127 GLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIR--------ATLKRGTFV 175

Query: 204 STTAQYRAPEMLDL-TKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEF 261
            T   + APE++   + G+  ++K+DIW+LG+ +Y+L   + P  +     ++ N     
Sbjct: 176 GTPF-WMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRK 232

Query: 262 PP--YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
           PP  + HYS A K  + S L KNP +RP+  +++ +
Sbjct: 233 PPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNS 268

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 117/259 (45%), Gaps = 39/259 (15%)

Query: 56  KRVIVPDKSHLNTLRAEVDAMKRL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCS 113
           K+V  P+K +   +  E++  K +   HH +IV+  D+     +       +++I++YCS
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQWGKESC-----IYMILDYCS 124

Query: 114 RGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKY 173
              L   +  R    L E E   + + +  G+  +H     +IH D+K+ N+L     + 
Sbjct: 125 NNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQL 180

Query: 174 KLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS------ 227
           K+CDFGS       P+ P E+           T  Y APE +   K  + +  +      
Sbjct: 181 KICDFGSSFIATSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 228 --DIWALGVFLYKLCYYTTPFEQTGEA-----------GILNGGVEFPPYPHYSDAVKQL 274
             DIW++G+ LY L Y   PF ++ +             I +G +EFP         +QL
Sbjct: 232 PIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQL 291

Query: 275 IMSMLAKNPLHRPNIFQII 293
           I+ ML++NPL R  + +I+
Sbjct: 292 ILKMLSQNPLERITLVEIV 310

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 130/277 (46%), Gaps = 35/277 (12%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           H+ + +  G Y  +Y A     DQ     +  +K ++  +   LN + AE+  +K L HH
Sbjct: 26  HLKQVIGRGSYGVVYKAINKHTDQ-----VVAIKEIVYENDEELNDIMAEISLLKNLNHH 80

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
             IV Y   H     ++  +YE+++++EYC+ G L   + +R    L+E E  T      
Sbjct: 81  N-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTL 131

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H     +IHRDIK  N+L+S D+  KL DFG VS  +               + 
Sbjct: 132 LGLKYLH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LT 177

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI---LNGGV 259
           ++ T  + APE+L   +G S    SDIW+LG  + ++     P+    +A I   +    
Sbjct: 178 LAGTLNWMAPEILG-NRGAST--LSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT 234

Query: 260 EFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
            +PP   +S+++K  +     KN   RP   Q+++ V
Sbjct: 235 YYPP-SSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 146/348 (41%), Gaps = 68/348 (19%)

Query: 13  TTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAV-----LKRVIVPDKSHLN 67
           TT+ V      I + L  GG + +Y  Q++     +   +A      LK++I P+   ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRL-- 125
               E++  KR +   Y++  IDS   + +  DG+  +++I+ + + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLTETEILTIQLHISQGVAAMHT---------------------------------LQ 152
              ++E E + I L + +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDI 201
             ++           HRDI   N+L S+D    + D GS S          +L  ++  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GI 254
             + T  Y APE+L L    +++ K DIW+LG   Y L +  +PFE+  +         I
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNV 302
             G   FP    +S+ +  +I   +  +P+ RP       T S+LLN+
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRP-------TTSQLLNI 358

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A L    +  +     L 
Sbjct: 71  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLL 127

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   +V +ID       + D T  V++++E C  G L+D +  R    LT
Sbjct: 128 SEIQIHKSMKHQN-VVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KLLT 177

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+    ++  K+ DFG  +        
Sbjct: 178 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----AN 231

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ-- 248
             E  Y      +  T  Y APE+L + K    + + DIW++GV LY L     PF+   
Sbjct: 232 DRERKYT-----VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKD 285

Query: 249 --TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP   H S+  K LI  +L+ +PL RP+I +I+  V
Sbjct: 286 VNTIYERIKCCDFSFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 123/271 (45%), Gaps = 28/271 (10%)

Query: 27  YLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIV 86
           +L  GG+A+ +  +      F    +A   ++ +  +   N L +E+   K ++H   IV
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVA 146
            +ID         +    V++++E C  G L+D +  R    LTE E+      I   + 
Sbjct: 159 HFIDC-------FEDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTT 206
            MH+    +IHRD+K+ N+    D   K+ DFG ++  I       E  Y      +  T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN---NENERKYT-----ICGT 258

Query: 207 AQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILN----GGVEFP 262
             Y APE++   K    + + DIW+LGV ++ +     PF+    + I +        FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 PYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
              + S  VK+LI  +L+ NP+ RP I +I+
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 126/296 (42%), Gaps = 59/296 (19%)

Query: 50  TNMAVLKRVIVP--DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFL 107
           TN+  LKR+  P  +   ++    EVD  KR +   YI+  +DS  A  Q  DG+  V++
Sbjct: 64  TNLYALKRIRCPFGNIESISGAMKEVDNYKRFQS-PYIIHLVDSQVA--QQRDGSKTVYI 120

Query: 108 IMEYCSRGGLIDFMNTRLQNR--LTETEILTIQLHISQGVAAMHT--------------- 150
           ++ Y   G L D  +  L N   ++E E + I + I++G+  +H                
Sbjct: 121 LLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHD 180

Query: 151 ------------------LQPPLI------------HRDIKIENVLISNDHKYKLCDFGS 180
                             L+  ++            HRDIK  N+L S+D    + + GS
Sbjct: 181 AVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGS 240

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
            S       T  +L  ++  +    T  Y APE+L +T   SV+ K DIW+LG   Y + 
Sbjct: 241 CSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFML 300

Query: 241 YYTTPFEQTGEA-------GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNI 289
           +  +PFE+  +         I  G   FP    YS+ + +LI   L  NP  RP+I
Sbjct: 301 FGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 140/331 (42%), Gaps = 55/331 (16%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKS--HLNTLRAE 72
           V+V  H  HI + L  GG++ +Y  +           +  LK++  P  S   ++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESRE------NGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN--RLT 130
           VD  ++ K   YI   IDS   + +  DG+  V++++ Y S+G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 ETEILTIQLHISQGVAAMHTLQPP-----------------------------------L 155
           E E++ + L +++G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML 215
            H DIK  N++IS++    + D GS S       + + L   +       T  + APE+L
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GILNGGVEFPPYPHYS 268
           D+     + +K D+W+ G  +Y +C+  +PFE+  +         +  G    P   +YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
             +  ++   L  +P  RP++ ++I  +  L
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDL 340

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 131/276 (47%), Gaps = 30/276 (10%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
            + + +  G +  +Y A     D+  G  +A+    +      ++ L  E+  +  L H 
Sbjct: 35  EVQECVGKGNFGDVYKA----IDKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAEL-HS 89

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
            YI +Y  +             ++++MEYC  G   D +    +  LTE ++  I   I 
Sbjct: 90  PYITNYFSTFVED-------VSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREIL 142

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
           +G+  +H+ +   IHRDIK  N+L+++D K KL DFG VSG +        +A  R D  
Sbjct: 143 RGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQM--------MATRRRDTF 191

Query: 203 MSTTAQYRAPEMLDLT-KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG-GVE 260
           + T   + APE++  + +G+  N+K+DIW+LG+ +++L     P  Q     +L      
Sbjct: 192 VGTPF-WMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSR 248

Query: 261 FPPY--PHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            PP     YS A+++ +   L K+P  RP   ++++
Sbjct: 249 RPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 38/240 (15%)

Query: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN 127
           T+  E++  K +  HK I+S ID        +D T  +++++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFE-----IDAT--MYMVLELCGAGSLYDII-CRSKR 146

Query: 128 RLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRP 187
            L E E   + + +   V  +H  +  ++H D+K+ N+LI + +  +LCDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 188 PKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGFSVNDK--------SDIWALGVFLY 237
                  ++V  DI  ++  ++  P  L  ++   F ++DK        SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 238 KLCYYTTPFEQTGEAGILNGGVE----FPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
            + +  TPFE T         VE    F      S+ VK+LI ++L   PL R  I +I+
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/275 (27%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIV 86
           +L  GG+A+ +  +      F    +A   ++ +  +     L +E+   K +KH   IV
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVA 146
            ++D       + D T  V++++E CS G L+D M  R    LTE E+      I   V 
Sbjct: 153 HFVDC------FEDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTT 206
            MH+ +  +IHRD+K+ N+    D+  K+ DFG  +          E  Y      +  T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----ANNRERKYT-----VCGT 252

Query: 207 AQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVE-----F 261
             Y APE+L + K    + + DIW++GV +Y L     PF Q  +  ++   ++     +
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPF-QAKDVNVIYDRIKACQYGY 310

Query: 262 PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           P   + S   K LI  +L  +P+ RP+I +II  V
Sbjct: 311 PKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 142/333 (42%), Gaps = 61/333 (18%)

Query: 13  TTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMA-----VLKRVIVPDKSHLN 67
           TT+ V      I + L  GG + +Y  Q++     +  + A      LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRL-- 125
               E++  KR +   Y++  IDS   + +  DG+  +++I+ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEK--DGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLTETEILTIQLHISQGVAAMHT---------------------------------LQ 152
              ++E E + I L +++G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDI 201
             ++           HRDI   N+L S+D    + D GS S          +L+ ++  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GI 254
             + T  Y APE+L+L    +++ K DIW++G   Y L +  +PFE+  +         I
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRP 287
             G   FP    +S+ +  +I   +  +P+ RP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 92.8 bits (229), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 123/275 (44%), Gaps = 31/275 (11%)

Query: 27  YLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIV 86
           +L  GG+A+ +  +      F    +A   ++ +  +     L +E+   K +KH   IV
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVA 146
            +ID         +    V++++E C  G L+D +  R    LTE E+      I   + 
Sbjct: 156 QFIDC-------FEDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTT 206
            +H+ +  +IHRD+K+ N+    D+  K+ DFG  +          E  Y      +  T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----ANDRERKYT-----VCGT 255

Query: 207 AQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVE-----F 261
             Y APE+L + K    + + DIW++GV +Y L     PF Q  +  ++   ++     +
Sbjct: 256 PNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPF-QAKDVNVIYERIKLCKYGY 313

Query: 262 PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           P   + S   + LI  +L+ NPL RP I  II  V
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 92.4 bits (228), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 132/291 (45%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 80  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLL 136

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K ++H   +V +ID       + D T  V++++E C  G L++ +  R    +T
Sbjct: 137 SEIQIHKSMRHFN-VVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKR--RTVT 186

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+    ++  K+ DFG  +        
Sbjct: 187 EPEVRYFMTQICGAIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----AN 240

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L + K    + + DIW++GV +Y L     PF Q+ 
Sbjct: 241 DRERKYT-----VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPF-QSK 293

Query: 251 EAGIL-----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           +  ++     N    FP   + S+  K LI  +L+ +PL RP+I +II  V
Sbjct: 294 DVNMIYERIKNRDFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 90.1 bits (222), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 142/333 (42%), Gaps = 61/333 (18%)

Query: 13  TTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-----ADQFLGTNMAVLKRVIVPDKSHLN 67
           TT+ V      I + L  GG + +Y  Q++       +  +   M  LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN 127
               E++  KR +   Y++  IDS    +Q  +G+  +++I+ Y S G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQV--TQEKNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 R--LTETEILTIQLHISQGVAAMH-------TLQP----------------------PL- 155
              ++E E + I L +++G+  +H        + P                      PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDI 201
                          HRDI   N+L S++    + D GS S       +  +L+ ++  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 MMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GI 254
             + T  Y APE+L+L     ++ K DIW++G   Y L +  +PFE+  +         I
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRP 287
             G   FP    +S+A+  +I   +  +P+ RP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 129/277 (46%), Gaps = 35/277 (12%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           H+ + +  G Y  +Y A     DQ     +  +K V+  +   LN + AE+  +K L H+
Sbjct: 26  HLKQVIGRGSYGVVYKAINKHTDQ-----VVAIKEVVYENDEELNDIMAEISLLKNLNHN 80

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
             IV Y   H     ++  +YE+++++EYC+ G L   + +R    L+E E  T      
Sbjct: 81  N-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTL 131

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H     +IHRDIK  N+L+S D+  KL DFG VS  +               + 
Sbjct: 132 LGLKYLH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LT 177

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI---LNGGV 259
           ++ T  + APE+L   +G S    SDIW+LG  + ++     P+    +A I   +    
Sbjct: 178 LAGTLNWMAPEILG-NRGAST--LSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT 234

Query: 260 EFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
            +PP   +S+ +K  +     KN   RP   Q+++ V
Sbjct: 235 YYPP-SSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 130/271 (47%), Gaps = 36/271 (13%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVP---DKSHLNTLRAEVDAMKRLK 80
           I + +  G +  +Y A       F  TN A++   +V     +  ++ L  E+  +  L+
Sbjct: 17  IQECVGRGNFGDVYKA-------FDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELR 69

Query: 81  HHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLH 140
              YI +YI +       M     ++++MEYC  G   D + T   N L E ++  I   
Sbjct: 70  S-PYITNYITT-------MIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITRE 121

Query: 141 ISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHD 200
           + +G+  +H  +   IHRDIK  N+L++++ K KL DFG VSG IR        A ++  
Sbjct: 122 VLKGLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIR--------ATMKRG 170

Query: 201 IMMSTTAQYRAPEMLDL-TKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG-G 258
             +  T  + APE+++  + G+  N+K+DIW+LG+ +Y+L     P  +     ++    
Sbjct: 171 TFVG-TPYWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLP 227

Query: 259 VEFPPYPH--YSDAVKQLIMSMLAKNPLHRP 287
              PP  H  YSD  K  + + L K+P  RP
Sbjct: 228 RRKPPKLHGQYSDVAKGFVAACLVKDPNLRP 258

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/347 (22%), Positives = 150/347 (43%), Gaps = 65/347 (18%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGT-------NMAVLKRVIVP--DKSH 65
           V++      I + L  G  + +Y  Q + +    G+        +  LKR+  P  +   
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRL 125
           ++    EVD  KR +   YI++ +DS   + +  DG+  + +++ Y   G L D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQS-PYIITLVDSQVVQEK--DGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 126 --QNRLTETEILTIQLHISQGVAAMH-----------TLQ-----------------PPL 155
                ++E E + I + I++G+  +H           T++                  PL
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 156 ----------------IHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRH 199
                           +HRDI++ N+L S++    + D GS         T  +L  ++ 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 200 DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA------- 252
            +  + +  Y APE+L++    +++ K+DIW++G   Y + +  +PFE+  +        
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 253 GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
            I  G   FP    YS+++  +I S L  +P  RP+I +++ T+  L
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 138/332 (41%), Gaps = 61/332 (18%)

Query: 14  TVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMA-----VLKRVIVPDKSHLNT 68
           T+ V      I + L  GG + +Y  Q+      +   +A      LK++I P    ++ 
Sbjct: 22  TIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISN 81

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
              E++  KR +   Y++  IDS   + +  DG+  +++++ Y S G L D +N RL   
Sbjct: 82  GMREIENYKRFQS-PYVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEG 138

Query: 129 --LTETEILTIQLHISQGVAAMHT---------------------------------LQP 153
             ++E E + I L +++G+  +H                                  L+ 
Sbjct: 139 TFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEM 198

Query: 154 PLI-----------HRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            ++           HRDI   N+L S+D    + D GS S      +   +L+ ++  + 
Sbjct: 199 DMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVN 258

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-------GIL 255
            + T  Y  PE+L+L     ++ K DIW+LG   Y L +  +PFE+  +         I 
Sbjct: 259 DNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 256 NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRP 287
            G   FP    +S+ +  +I   +  +P+ RP
Sbjct: 319 TGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 126/290 (43%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +         F    +A L    +  +     L 
Sbjct: 72  PPSLIKTRGRDYHRGHFLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLL 128

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +K+   IV +ID       + D T  V++++E C  G L+D +  R    LT
Sbjct: 129 SEIQIHKSMKNVN-IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLT 178

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+    D+  K+ DFG  +        
Sbjct: 179 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVL----AN 232

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ-- 248
             E  Y      +  T  Y APE+L + K    + + DIW++GV LY L     PF+   
Sbjct: 233 DRERKYT-----VCGTPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKD 286

Query: 249 --TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP   + S   K LI  +L+ +PL RP++ +II  V
Sbjct: 287 VNTIYERIKCCDFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 89.4 bits (220), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 135/279 (48%), Gaps = 28/279 (10%)

Query: 19  SHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKR 78
           S++  I + +  G +  +Y A     D+  G  +AV    +   +  ++ L  E+  +  
Sbjct: 12  SNTYIIQQCVGRGNFGDVYKA----CDKVEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAE 67

Query: 79  LKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQ 138
           L+   +I +YI +       +     ++++MEYC  G   D +     N + E ++  I 
Sbjct: 68  LRS-PFITNYITT-------LTEDVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFIT 119

Query: 139 LHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVR 198
             + +G+  +H  +   IHRDIK  N+L++++   KL DFG VSG IR        A ++
Sbjct: 120 SQVLRGLVYLHEQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIR--------ATLK 168

Query: 199 HDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NG 257
               +  T  + APE++   +    ++K+DIW+LG+ +Y+L     P  +     ++ N 
Sbjct: 169 RGTFVG-TPYWMAPEVVS-KENDGYDEKADIWSLGITVYELLKGAPPLSKCDPMKVMINL 226

Query: 258 GVEFPP--YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
               PP  + HYS + K  + S L KNP+ R + +++++
Sbjct: 227 PKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 123/271 (45%), Gaps = 29/271 (10%)

Query: 28  LTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVS 87
           L  GG+A+ +  +      F      V K+ I  +++    L +E+   + L++  +IV 
Sbjct: 99  LGEGGFARCFHIKDDVGISFACK--IVSKKSIKTERTKFKLL-SEIQIHQNLRY-SHIVK 154

Query: 88  YIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAA 147
           ++D         +    V++++E C  G L+D +  R    LTE E+  +   +   +  
Sbjct: 155 FMDC-------FEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINY 205

Query: 148 MHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTA 207
           MH+    +IHRD+K+ NV    +   K+ DFG  +          E  Y      M  T 
Sbjct: 206 MHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYT-----MCGTP 254

Query: 208 QYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILN----GGVEFPP 263
            Y APE++ L+K    + ++DIW+LG+ +Y +     PF+      I         EFPP
Sbjct: 255 NYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPP 313

Query: 264 YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             + ++ VK LI  +L  +P  RP I  I++
Sbjct: 314 DKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 130/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A L   I  +K+    L 
Sbjct: 90  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKTEKTR-KKLL 146

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K ++H   IV +ID       + D T  V++++E C  G L++ +  R    LT
Sbjct: 147 SEIQIHKSMRHAN-IVQFIDC------FEDET-NVYILLEICPNGSLMELLKKR--KTLT 196

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I  G+  MH+ +  +IHRD+K+ N+    ++  K+ DFG  +        
Sbjct: 197 EPEVRFFTTQICGGIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----AN 250

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
             E  Y      +  T  Y APE+L + K    + + DIW++GV +Y L     PF+   
Sbjct: 251 DRERKYT-----VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKD 304

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP   + S   + L+  +L+ +PL RP+I +++  V
Sbjct: 305 VNTIYERIKCCDFVFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 127/275 (46%), Gaps = 35/275 (12%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           H+ + +  G Y  +Y A     DQ +      +K ++      LN + AE+  +K L H 
Sbjct: 26  HLKQVIGRGSYGVVYKAINKHTDQVVA-----IKEIVYESDEELNDIMAEISLLKNLNHD 80

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
             IV Y   H     ++  +YE+++++EYC+ G L   + +R    L+E E  +      
Sbjct: 81  N-IVKY---HG----FIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTL 131

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H     +IHRDIK  N+L+S D+  KL DFG VS  +               + 
Sbjct: 132 LGLKYLH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LT 177

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI---LNGGV 259
           ++ T  + APE+L   +G S    SDIW+LG  + ++     P+    +A I   +    
Sbjct: 178 LAGTLNWMAPEILG-NRGAST--LSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDT 234

Query: 260 EFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            +PP   +S+++K  +     KN   RP   Q+++
Sbjct: 235 YYPP-SSFSESLKDFLSKCFVKNMYKRPTADQLLK 268

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 98/197 (49%), Gaps = 27/197 (13%)

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           +V++ +EYC    L +++   +Q+R++  E   +   I   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTK--GF 221
           N+L+    + K+ DFG    + R   T   L  V        T  Y APE+++     GF
Sbjct: 158 NILLDKKGRAKITDFG----FTRECATKTMLETV------CGTTVYMAPELIERKSYDGF 207

Query: 222 SVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAV-----KQLIM 276
            +    DIW+LGV LY + + T PF++  E       +   P+  Y+D V     K LI 
Sbjct: 208 KI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPF--YNDDVVSKDAKDLIS 261

Query: 277 SMLAKNPLHRPNIFQII 293
            +L K+P  RP + Q++
Sbjct: 262 QLLCKDPSQRPQLSQVL 278

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 128/276 (46%), Gaps = 42/276 (15%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +       VLK     DK+  N +R E+       H +
Sbjct: 41  ILKQIGEGSFGKVYLALHKPTHK-----KVVLKS---SDKTDPNVVR-EI-----FYHRQ 86

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++++EYC    L D++ ++   R++  E   I   I  
Sbjct: 87  FDFPYI---TKLYEVIITETKVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVG 141

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H+L    +HRD+K+EN+L+  D+  KL DFG    + +  +             +
Sbjct: 142 AVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLE----------TI 189

Query: 204 STTAQYRAPEMLDLTK--GFSVNDKSDIWALGVFLYKLCYYTTPFEQTG----EAGILNG 257
             T  Y APE+L   K  G+ +    DIWALG+ LY +   T PF++      E  I++ 
Sbjct: 190 CGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISA 245

Query: 258 GVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
             ++    +++D    L+  +L+K+P  RP I QI+
Sbjct: 246 SPDY-DNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 130/291 (44%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  QI      L     V K  I  +K+    L 
Sbjct: 134 PPSLIKTRGRDYHRGHFLGEGGFARCF--QIRDDSGKLFAAKTVAKLSIKTEKTR-KKLL 190

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   IV +ID       + D T  V++++E C  G L++ +  R Q  LT
Sbjct: 191 SEIQIHKSMKHQN-IVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKRKQ--LT 240

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+    ++  K+ DFG  +        
Sbjct: 241 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAA-------- 290

Query: 191 PEELAYVRH-DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE-- 247
              LA  R     +  T  Y APE+L + K    + + D+W++GV +Y L     PF+  
Sbjct: 291 --VLANDRERKFTVCGTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAK 347

Query: 248 --QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
              T    I      FP     S   K L+  +L+ +PL RP+I +I+  V
Sbjct: 348 DVNTIYERIKCCDFIFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 123/275 (44%), Gaps = 55/275 (20%)

Query: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG--TYEVFLIMEYCSRGGLI 118
           P K+  + ++ E+  MK+  HHK++V  I       + +D   + +++L++EYCSRG + 
Sbjct: 188 PGKTENDKIKREIAIMKKC-HHKHVVKLI-------EVLDDLKSRKIYLVLEYCSRGEVK 239

Query: 119 DFMNTRLQNRLTETEILTIQL--HISQGVA-AMHTLQ-PPLIHRDIKIENVLISNDHKYK 174
                 L+        L+ Q    I +GV   +  L    +IHRDIK  N+L+S     K
Sbjct: 240 WCPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVK 299

Query: 175 LCDFG-----SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML-------------- 215
           + DFG     S S      +T +EL   +     + T  + APE+               
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAK----TAGTPAFFAPEICLGEDAFEKYQLDRE 355

Query: 216 DLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFP-PYPHYSD----- 269
           +L KG  ++ K DIWALGV LY L +   PF  + E  +    V  P  +P YSD     
Sbjct: 356 ELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNN 415

Query: 270 ------------AVKQLIMSMLAKNPLHRPNIFQI 292
                       A K L+  +L KNP+ R NI +I
Sbjct: 416 QVLQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEI 450

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 119/250 (47%), Gaps = 26/250 (10%)

Query: 50  TNMAVLKRVIVPDKSHLNTLR--AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFL 107
           T   V  ++I  D S   T     E+  M  LK   YI  YI +       ++  Y +++
Sbjct: 38  TKEVVAIKIINLDDSEEETFEIIKEMRLMSLLKS-PYIARYITT-------INEDYLMWI 89

Query: 108 IMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLI 167
           +MEYC  G   D + T  +  L E ++  +   +  G+  +H      IHRDIK  N+L+
Sbjct: 90  VMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILL 147

Query: 168 SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS 227
           ++    K+ DFG VS  +R   T +   +V        T  + APE++ + +G   N+KS
Sbjct: 148 TDSGLVKVADFG-VSAEMR--STMKAKTFV-------GTPYWMAPEVV-MNEGMGYNEKS 196

Query: 228 DIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH--YSDAVKQLIMSMLAKNPL 284
           DIW+LG+  Y+L     P  +     ++ N     PP  H  Y++ VK  I + L K+P 
Sbjct: 197 DIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPE 256

Query: 285 HRPNIFQIIQ 294
            RP+  ++++
Sbjct: 257 KRPSASELLE 266

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 124/275 (45%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           ++L  GG+A+ +  +      F    +A   ++ +  +     L +E+   K +KH   I
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGV 145
           V ++D         +    V++++  C  G L++ +  R    LTE E+    + I   +
Sbjct: 202 VQFVDC-------FEDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMST 205
             MH+ +  +IHRD+K+ N+    ++  K+ DFG  +          E  Y      +  
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVL----ANDRERKYT-----VCG 301

Query: 206 TAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE----QTGEAGILNGGVEF 261
           T  Y APE+L L K    + + DIW++GV ++ L     PF+     T  + I N    F
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           P     S   K LI  +L  +P+ RP+I +I++ V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 126/290 (43%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 84  PPSLIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLL 140

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   IV +ID       + D T  V++++E C  G L+D +  R    LT
Sbjct: 141 SEIQIHKSMKHVN-IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLT 190

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+     +  K+ DFG  +        
Sbjct: 191 EPEVRFFTTQICGAIKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----AN 244

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ-- 248
             E  Y      +  T  Y APE+L + K    + + DIW++GV +Y L     PF+   
Sbjct: 245 DRERKYT-----VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKD 298

Query: 249 --TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP     S   K LI  +L+ +PL RP++ +I+  +
Sbjct: 299 VNTIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +    D F    +A  K  I  +K+    L 
Sbjct: 71  PPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGDIFAAKTVA--KASIKSEKTR-KKLL 127

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K + H   IV +ID     S        V++++E C  G L++ +  R    L+
Sbjct: 128 SEIQIHKSMAHPN-IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLS 177

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+   +++  K+ DFG  +        
Sbjct: 178 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----AN 231

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
             E  Y      +  T  Y APE+L + K    + + DIW+LGV LY L     PF+   
Sbjct: 232 ESERKYT-----ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARD 285

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP     SD  K LI  +L+ +P+ RP++ +I+  V
Sbjct: 286 VNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 129/291 (44%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 66  PPSLIKTRGRDYHRGHFLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLL 122

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   IV +ID       + D T  V++++E C  G L+D +  R    LT
Sbjct: 123 SEIQIHKSMKHPN-IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KVLT 172

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH  +  +IHRD+K+ N+   +++  K+ DFG  +        
Sbjct: 173 EPEVRYFTTQIVGAIKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----AN 226

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L   K    + + DIW++GV +Y L     PF Q  
Sbjct: 227 DRERKYT-----VCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPF-QAK 279

Query: 251 EAGIL-----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           E  I+     +G   FP     S  V  LI  +L+ +P+ RP++ +I+  V
Sbjct: 280 EVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +    + F    +A  K  I  +K+    L 
Sbjct: 71  PPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLL 127

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K + H   IV +ID     S        V++++E C  G L++ +  R    LT
Sbjct: 128 SEIQIHKSMSHPN-IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLT 177

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+   +++  K+ DFG  +        
Sbjct: 178 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----AN 231

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
             E  Y      +  T  Y APE+L + K    + + DIW+LGV LY L     PF+   
Sbjct: 232 ESERKYT-----ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARD 285

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP     SD  K LI  +L+ +P+ RP++ +I+  V
Sbjct: 286 VNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +    + F    +A  K  I  +K+    L 
Sbjct: 71  PPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLL 127

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K + H   IV ++D     S        V++++E C  G L++ +  R    LT
Sbjct: 128 SEIQIHKSMAHPN-IVQFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLT 177

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+   +++  K+ DFG  +        
Sbjct: 178 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----AN 231

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
             E  Y      +  T  Y APE+L + K    + + DIW+LGV LY L     PF+   
Sbjct: 232 ESERKYT-----ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARD 285

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP     SD  K LI  +L+ +P+ RP++ +I+  V
Sbjct: 286 VNTIYERIKCRDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 127/291 (43%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 62  PPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   IV + D       + D T  V++++E C  G L+D +  R Q  LT
Sbjct: 119 SEIQIHKSMKHPN-IVQFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LT 168

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+        K+ DFG  +        
Sbjct: 169 EPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----AN 222

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L   K    + + DIW++GV +Y L     PF Q  
Sbjct: 223 DRERKYT-----ICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPF-QAK 275

Query: 251 EAGILNGGVE-----FPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           E   +   ++     FP     S   K LI  +L+ +PL RP++ +I++ V
Sbjct: 276 EVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 128/290 (44%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +    + F    +A  K  I  +K+    L 
Sbjct: 71  PPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLL 127

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K + H   IV +ID     S        V++++E C  G L++ +  R    LT
Sbjct: 128 SEIQIHKSMSHPN-IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLT 177

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+   +++  K+ DFG  +        
Sbjct: 178 EPEVRFFTTQICGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----AN 231

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
             E  Y      +  T  Y APE+L + K    + + DIW+LGV LY L     PF+   
Sbjct: 232 ESERKYT-----ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARD 285

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
             T    I      FP     SD  K LI  +L+ +P+ RP++ +I+  V
Sbjct: 286 VNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 125/291 (42%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 68  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLL 124

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K ++H   IV +ID       + D T  V++++E C  G L+D +  R    LT
Sbjct: 125 SEIQIHKSMRHFN-IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKRR--KVLT 174

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   V  MH+ +  +IHRD+K+ N+     +  K+ DFG  +        
Sbjct: 175 EPEVRFFTTQIVGAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVL----AN 228

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L   K    + + DIW+ GV +Y L     PF Q  
Sbjct: 229 DRERKYT-----VCGTPNYIAPEVL-TGKHTGHSYEVDIWSCGVMIYALLIGKPPF-QAK 281

Query: 251 EAGIL-----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           E  I+      G   FP     S     LI  +L+ +PL RP++ +II  V
Sbjct: 282 EVNIIYERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 126/291 (43%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H  ++L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 70  PPSLIKTRGRDYHRGQFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLL 126

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K + H   IV +ID         +    V++++E C  G L++ +  R    +T
Sbjct: 127 SEIQIHKSMSHTN-IVQFIDC-------FEDNVNVYILLEICPNGSLMELIKKR--KTIT 176

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I  G+  MH+ +  +IHRD+K+ N+     +  K+ DFG  +        
Sbjct: 177 EPEVRFFMTQICGGIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAA-------- 226

Query: 191 PEELAYVRH-DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE-- 247
              LA  R     +  T  Y APE+L + K    + + DIW++GV LY L     PF+  
Sbjct: 227 --VLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAK 283

Query: 248 --QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
              T    I      +P     S   K LI  +L+ NP+ RP+I +I+  V
Sbjct: 284 DVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 85.9 bits (211), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 126/271 (46%), Gaps = 36/271 (13%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYID 90
           G +  +Y A     D+  G  +A+    +      +  +  E+  +  LK   YI +YI 
Sbjct: 30  GNFGDVYKA----IDKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKS-PYITNYIT 84

Query: 91  SHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHT 150
           +       M     ++++MEYC  G   D +       L E ++  I  ++ +G+  +H 
Sbjct: 85  T-------MLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 151 LQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYR 210
            +   IHRD+K  NVL+++D   KL DFG VSG +R   T +   +V        T  + 
Sbjct: 138 QRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLR--STAKRNTFV-------GTPYWM 185

Query: 211 APEML-DLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPP------ 263
           APE++ + + G+  N+K+DIW+LG+ +Y+L     P+ +     ++      P       
Sbjct: 186 APEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRN---IPKKNLQDC 240

Query: 264 YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
              +SDA K  I + L K+P  RP   +++Q
Sbjct: 241 MVSFSDAAKLFISACLIKDPDERPTATELLQ 271

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 85.5 bits (210), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 112/224 (50%), Gaps = 23/224 (10%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +       + E+++  I     +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLD-LTKGFSV 223
           +L+++  K KL DFG VSG IR        A ++    +  T  + APE+++   KG+  
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIR--------ATMKRGTFVG-TPYWMAPEVINKQCKGY-- 191

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGI-LNGGVEFPPYPH--YSDAVKQLIMSMLA 280
           N+K+DIW+LG+  Y+L     P  +     + LN     PP  H  YS+  K  +   L 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 281 KNPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDI--SIAVSNN 322
           K+P  RP+I  +++T   L N    + N+    D+  SI + NN
Sbjct: 252 KDPKQRPSIEALLETDFLLPNT---VLNLKEDVDLIKSIKLKNN 292

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 120/267 (44%), Gaps = 20/267 (7%)

Query: 28  LTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVS 87
           L  G Y+ +  A  + + +     + VL +  +  +  +  +  E +A++R+ + K IV 
Sbjct: 185 LGDGAYSTVMLATSIDSKKQYA--VKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAA 147
              +   +S        ++ ++EYC  G  +  M  +    L ET        +   +  
Sbjct: 243 LFFTFQDESS-------LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTA 207
           +HT    +IHRDIK EN+L+  + K KL DFG+    I    T  +   +        TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAK--ILDSSTNNKFDLLTRSKSFVGTA 349

Query: 208 QYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVEFPPYP 265
           +Y APE+L+    F V+ + D+WA G  LY++     PF+ T E         V++    
Sbjct: 350 EYVAPELLN--DSF-VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 266 HYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            +   ++ L+  +L K+   RP+I QI
Sbjct: 407 GFPLIIRDLVKKILVKDLNQRPSISQI 433

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 127/290 (43%), Gaps = 29/290 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A L    +  +     L 
Sbjct: 79  PPSLIKTRGRDYHRGHFLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLL 135

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K +KH   IV + D       + D T  V++++E C  G +++ +  R +  LT
Sbjct: 136 SEIQIHKSMKHPN-IVQFTDC------FEDDT-NVYILLEICPNGSVMELL--RQRKHLT 185

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+    + I   +  MH+ +  +IHRD+K+ N+    ++  K+ DFG  +        
Sbjct: 186 EPEVRFCMIQIIGAIRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVL----AN 239

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE--- 247
            +E  Y      +  T  Y APE+L   K    + + DIW++GV LY L +   PF+   
Sbjct: 240 DKERKYT-----ICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE 293

Query: 248 -QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
            +T    I      FP     S   K LI  +L  NP  RP++++I   V
Sbjct: 294 VETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/255 (28%), Positives = 121/255 (47%), Gaps = 29/255 (11%)

Query: 47  FLGTNMAVLKRVIVPDKS--HLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYE 104
           ++ TN     +V+  D +   +  ++ EV  +  LK    I  Y  S      Y++ T E
Sbjct: 38  YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHYYGS------YLNNT-E 90

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           +++IMEYC+ G L   +      ++ E  I  I   +   +A MH  +  +IHRDIK  N
Sbjct: 91  LWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAAN 145

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVN 224
           VLI+ND   KLCDFG V+  +   K       +R    M+ T  + APE+  + +G   +
Sbjct: 146 VLITNDGHIKLCDFG-VAAQLSQTK-------IRRQT-MAGTPYWMAPEV--IMEGVYYD 194

Query: 225 DKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPP----YPHYSDAVKQLIMSMLA 280
            K DIW+LG+  Y++     P+        +    +  P       +S A+K+ I   L 
Sbjct: 195 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLD 254

Query: 281 KNPLHRPNIFQIIQT 295
           ++P  RP+  ++++T
Sbjct: 255 EDPKERPSAEELLKT 269

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 125/278 (44%), Gaps = 46/278 (16%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +        LK     DK+  N +R EV       H +
Sbjct: 43  ILKQVGEGSFGKVYLALHRPTHR-----KVCLK---TSDKNDPNIVR-EV-----FYHRQ 88

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L D + +   +R++  E   +   IS 
Sbjct: 89  FDFPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISG 143

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H++    +HRD+K+EN+L+  +   KL DF    G+ R   T   L  V      
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GFTRECMTKTTLETV------ 191

Query: 204 STTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
             T  Y APE+++     GF +    DIW+LGV LY L   + PF+   E      I+N 
Sbjct: 192 CGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDEVKTKWKIVN- 246

Query: 258 GVEFPPYPH--YSDAVKQLIMSMLAKNPLHRPNIFQII 293
             E P Y      D  K LI  +LAKNP  RP++ Q++
Sbjct: 247 --EEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 101/205 (49%), Gaps = 26/205 (12%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +    +  L E +   I   + +G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVN 224
           +L+++D   KL DFG VSG I+        A ++ D  +  T  + APE++   +    N
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIK--------ATLKKDTFVG-TPYWMAPEVVKKDES-GYN 192

Query: 225 DKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPP------YPHYSDAVKQLIMSM 278
           +K+DIW+LG+ +Y+L     P  +     ++   +  P       + HYS+  K  I   
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVM---ISVPKRRAPKLHGHYSEDAKSFISHC 249

Query: 279 LAKNPLHRPNIFQIIQTVSKLLNVN 303
           L K+P  RPN     +T+SK   VN
Sbjct: 250 LIKDPNARPN----AKTLSKFPFVN 270

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 125/277 (45%), Gaps = 42/277 (15%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           IL  +  G + ++Y AQ  P          VLK     DK+  N +R EV       H +
Sbjct: 40  ILDQIGEGSFGKVYLAQHRPTH-----TKVVLKS---SDKNDPNIVR-EV-----FYHRQ 85

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L D + +   +R+   E + +   I  
Sbjct: 86  FDYPYI---TKLYEVIITETKVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVG 140

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
           GV   H+L    +HRD+K+EN+L+      KL DF    G+ R   T   L  +      
Sbjct: 141 GVHYAHSLN--CVHRDLKLENILLDKSGDAKLTDF----GFTRECMTKTTLETI------ 188

Query: 204 STTAQYRAPEMLDLTK--GFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEF 261
             T  Y APE+++     GF +    DIW+LGV LY +   + PF++  E       V  
Sbjct: 189 CGTTVYMAPELIERKSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQ 244

Query: 262 PPYPH----YSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            P  +     +DA K LI+ +LAKNP  RP + QI++
Sbjct: 245 TPQLNENIVTADA-KDLILRLLAKNPNDRPTVEQILK 280

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/321 (25%), Positives = 138/321 (42%), Gaps = 63/321 (19%)

Query: 14  TVTVGSHSVHILKYLTSGGYAQIYSAQIMPA---DQF----LGTNMAVLKRVIVPDKSHL 66
           ++T+G  +  I K +  G +A ++ A ++     D      L   + ++ R  + +K  L
Sbjct: 29  SITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLL 88

Query: 67  NTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ 126
             L  E+  +K++ +H +IV  ID           T + +LIMEYC+ G L   +  R +
Sbjct: 89  ENLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCALGDLTFLIKKRHE 140

Query: 127 ----------------------NRLTETEILTIQLHISQGVAAMHTLQPP-LIHRDIKIE 163
                                 N L    IL    ++ Q  +A+  L+   L+HRDIK +
Sbjct: 141 LIKNHPLLEKIFEKYPSPNENYNGLHRAFILN---YLQQLASALKFLRSKNLVHRDIKPQ 197

Query: 164 NVLI------SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRH--DIMMSTTAQ----YRA 211
           N+L+       ND K      G +  Y  P     +  + R   +  M+ T      Y A
Sbjct: 198 NLLLLTPLINYNDSK-AFKKLGFIGIYELPILKIADFGFARFLPNTSMAETLCGSPLYMA 256

Query: 212 PEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYP 265
           PE+L+  K    N K+D+W++G  LY++CY T PF+ +    +       N  + FP Y 
Sbjct: 257 PEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYI 313

Query: 266 HYSDAVKQLIMSMLAKNPLHR 286
              + +K LI  +L  +P  R
Sbjct: 314 QIQNDMKILISKLLTFDPQRR 334

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 125/291 (42%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 68  PPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLL 124

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K ++H   IV ++D       + D T  V++++E C  G L+D +  R    LT
Sbjct: 125 SEIQIHKSMRHTN-IVQFVDC------FEDDT-NVYILLEICPNGSLMDLLKRR--KMLT 174

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   V  MH+ +  +IHRD+K+ N+     +  K+ DFG  +        
Sbjct: 175 EPEVRFFTTQIVGAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVL----AN 228

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L   K    + + DIW+ GV +Y L     PF Q  
Sbjct: 229 DRERKYT-----VCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPF-QAK 281

Query: 251 EAGIL-----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           E  I+      G   FP     S     LI  +L+ +PL RP++ +II  V
Sbjct: 282 EVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 18/193 (9%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I   ++ G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDL-TKGFSV 223
           +L++ +   KL DFG VSG+IR        + ++ D  +  T  + APE++     G+  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH--YSDAVKQLIMSMLA 280
           N+K+DIW+LG+  Y+L     P  +     ++ N     PP     +SDA K  +   L 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLV 254

Query: 281 KNPLHRPNIFQII 293
           K P  RP+ + ++
Sbjct: 255 KTPADRPSAYNLL 267

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 124/289 (42%), Gaps = 56/289 (19%)

Query: 17  VGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM 76
           VG++ +   K +  G + ++Y A   P  Q       VLK     DKS  N +R EV   
Sbjct: 39  VGNYKIQ--KQIGEGSFGKVYLATHRPTKQ-----KVVLK---TGDKSDPNVVR-EV--- 84

Query: 77  KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILT 136
               H ++   YI       + +    +V++ +EYC    L D + ++  +RL   E   
Sbjct: 85  --FYHRQFDYPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLSK--SRLPTLECAE 137

Query: 137 IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
           +   I+  V   HTL    +HRD+K+ENVL+  +   KL DF    G+ R   T   L  
Sbjct: 138 LFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDF----GFTRESMTKAVLET 191

Query: 197 VRHDIMMSTTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQ------ 248
           V        T  Y APEM+      GF V    DIW+LGV LY L     PF++      
Sbjct: 192 V------CGTTVYMAPEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPFDEDDDLLT 241

Query: 249 ----TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
                 +  +++  +  P         + LI  +L+K+P  RPN   I+
Sbjct: 242 KQKIINDTPVIDERITIP-------EAQNLIEQLLSKDPTERPNTSAIL 283

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/329 (26%), Positives = 137/329 (41%), Gaps = 69/329 (20%)

Query: 13  TTVTVGSHSVHILKYLTSGGYAQIYSAQ-IMPADQFLGTNMA--------------VLKR 57
           TT+ VGS    + K +  G +A ++ A  I P    L  ++               ++ R
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 58  VIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117
             + +K  L  L  E+  +K++ H  +IV  ID       +   + + +LIMEYCS G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKISH-PHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLTETEILTIQLHISQGVAAMHTLQPPL 155
              +  R Q                      N L +  IL     +S  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 IHRDIKIENVLIS------NDHKYKLCDFGSVSGYIRPPKTPEELAYVRH--DIMMSTT- 206
           +HRDIK +N+L+S      ND K    D G V  Y  P     +  + R   +  M+ T 
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPK-SFHDLGFVGIYNLPILKIADFGFARFLPNTSMAETL 257

Query: 207 ---AQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL------NG 257
                Y APE+L+  K    N K+D+W++G  LY++CY   PF+ +    +       N 
Sbjct: 258 CGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAND 314

Query: 258 GVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
            + FP Y    + +K LI  +L  +P  R
Sbjct: 315 LIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 122/279 (43%), Gaps = 38/279 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRLK 80
            ILK +  G Y ++           +   M   +R++V        L T+ +E+  M  L 
Sbjct: 1004 ILKKMGEGAYGKVDLCYHKKEKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMSTLN 1063

Query: 81   H--HKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILTI 137
               +K I+S +D       Y       ++      + G ID  +    +  +TE E   I
Sbjct: 1064 KTSNKNILSILDFFEDDDYY-------YVEQPVHGKTGCIDLFDLIEFKTNMTEFEAKLI 1116

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               I  G++ +H  +  ++HRDIK ENV++      KL DFGS              AYV
Sbjct: 1117 FKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSA-------------AYV 1161

Query: 198  RH---DIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAG 253
            ++   D+ + T   Y +PE+L   +G     K  DIWALG+ LY + +   PF    E  
Sbjct: 1162 KNGPFDVFVGTI-DYASPEVL---RGEKYEGKPQDIWALGILLYTIVFKENPFYNIDE-- 1215

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            IL G ++FP   + S     LI  +L ++ L RP+I  I
Sbjct: 1216 ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDI 1254

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 137/313 (43%), Gaps = 59/313 (18%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVD 74
           ++ G+++    K +  G +A +Y   ++ +D+     +  + R  + +K  L  L  E+ 
Sbjct: 19  ISAGNYTAE--KEIGKGSFATVYRGHLI-SDKSQHIAIKEVSRAKLKNKKLLENLEIEIA 75

Query: 75  AMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ-------- 126
            +K++KH  +IV  ID     + +       +LIMEYC+ G L   +  R +        
Sbjct: 76  ILKKIKH-PHIVGLIDCERTSTDF-------YLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 127 --------------NRLTETEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLIS--- 168
                         N L    +L+   ++ Q  +A+  L+   L+HRDIK +N+L+S   
Sbjct: 128 RTVFEKYPPPSESHNGLHRAFVLS---YLQQLASALKFLRSKNLVHRDIKPQNLLLSTPL 184

Query: 169 ---NDHKYKLCDFGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTK 219
              +D K    + G V  Y  P     +  + R          +  +  Y APE+L+  K
Sbjct: 185 IGYHDSK-TFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK 243

Query: 220 GFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQ 273
               N K+D+W++G  ++++C  T PF  +    +       N  + FP Y +    +K+
Sbjct: 244 ---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAITFPSYCNIEPELKK 300

Query: 274 LIMSMLAKNPLHR 286
           LI S+L  +P  R
Sbjct: 301 LICSLLTFDPAKR 313

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 117/243 (48%), Gaps = 29/243 (11%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           ++ E+  +  LK    I  Y  S      Y++ T ++++IMEYC+ G L   +      +
Sbjct: 62  VQKEIQFLSSLKQVPNITHYYGS------YLNDT-KLWVIMEYCAGGSLRTLLRP---GK 111

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  I  I   +    A MH  +  +IHRDIK  NVLI+ND   KLCDFG V+  +   
Sbjct: 112 IGEQYIGVIMRELL--TALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFG-VAAQLSQT 168

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
           K       +R    M+ T  + APE+  + +G   + K DIW+LG+  Y++     P+ +
Sbjct: 169 K-------IRRQT-MAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCE 218

Query: 249 TGEAGILNGGVEFPPYP-----HYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVN 303
                 +    +  P P      +S A+K++I   L ++P  RP+   +++T    L+ N
Sbjct: 219 VEALRAMQLITKSKP-PRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKN 277

Query: 304 CPI 306
            P+
Sbjct: 278 VPV 280

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 125/279 (44%), Gaps = 46/279 (16%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +        LK     DK+  N +R EV       H +
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTHR-----KVCLK---TSDKNDPNIVR-EV-----FYHRQ 88

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L D + +  +  L E   L  Q  IS 
Sbjct: 89  FDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQ--ISG 143

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H++    +HRD+K+EN+L+  +   KL DF    G+ R   T   L  V      
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GFTRECMTKTTLETV------ 191

Query: 204 STTAQYRAPEMLD--LTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
             T  Y APE+++     GF +    DIW+LGV LY L     PF+   EA     I+N 
Sbjct: 192 CGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEAKTKWKIVN- 246

Query: 258 GVEFPPYPH--YSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             E P Y      D  + LI  +LAKNP  RP++ Q+++
Sbjct: 247 --EEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVLR 283

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 127/291 (43%), Gaps = 31/291 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P + +       H   +L  GG+A+ +  +      F    +A   ++ +  +     L 
Sbjct: 62  PPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
           +E+   K ++H   IV + D       + D T  V++++E C  G L+D +  R Q  LT
Sbjct: 119 SEIQIHKSMRHPN-IVQFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LT 168

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E E+      I   +  MH+ +  +IHRD+K+ N+        K+ DFG  +        
Sbjct: 169 EPEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----AN 222

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
             E  Y      +  T  Y APE+L   K    + + D+W++GV +Y L     PF Q  
Sbjct: 223 DRERKYT-----ICGTPNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPF-QAK 275

Query: 251 EAGILNGGVE-----FPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
           E   +   ++     FP     S   K LI  +L+ +PL RP++ +I++ V
Sbjct: 276 EVNTIYERIKVCDFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/351 (22%), Positives = 145/351 (41%), Gaps = 67/351 (19%)

Query: 12  GTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRA 71
           G  +++   S  +   L  G    +Y  +  P     G   A LK+V  P        RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVKC-PKRSHSGGVYA-LKKVTCPIGRADFVTRA 78

Query: 72  --EVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRL--QN 127
             E+   +R  +  YI + +D   A  Q+ +GT  +++++ Y   G L D +N  +   +
Sbjct: 79  MTEISNYQRF-NSPYITNILDFQVA--QHDNGTKIIYMLLPYFPAGSLQDLINNMIIRGD 135

Query: 128 RLTETEILTIQLHISQGVAAMH-------------------------------------T 150
            L+E+ ++ + L I +GV  MH                                      
Sbjct: 136 SLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDL 195

Query: 151 LQPPL--------IHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP---KTPEELAYVRH 199
           L PPL        +H  +  EN+++S++    + +  S    +R P    +  +L  ++ 
Sbjct: 196 LSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQE 252

Query: 200 DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA------- 252
            +  ++   Y  PE+LDL    S+ ++ DIW+LG   Y L Y  + F +  +        
Sbjct: 253 WLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKH 312

Query: 253 GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVN 303
            I  G   FP  P YS ++K+++   L  +P  RP+I++ +    +LL+ +
Sbjct: 313 SISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQELLDTS 363

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 126/277 (45%), Gaps = 42/277 (15%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +        LK     DK+  N +R EV       H +
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTHR-----KVCLK---TSDKNDPNIVR-EV-----FYHRQ 88

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L D + +   +R++  E   +   IS 
Sbjct: 89  FDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISG 143

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H++    +HRD+K+EN+L+  +   KL DF    G+ R   T   L  V      
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GFTRECMTKTTLETV------ 191

Query: 204 STTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
             T  Y APE++      GF +    D W+LGV LY L   + PF+   EA     I+N 
Sbjct: 192 CGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNE 247

Query: 258 GVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             ++ P     DA K LI  +LAKNP  RP++ Q+++
Sbjct: 248 EPKYDPKLIPDDA-KDLISRLLAKNPGERPSLPQVLR 283

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 129/275 (46%), Gaps = 35/275 (12%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           H+ + +  G Y  +Y A     DQ +      +K ++  +   LN + AE+ ++ +  ++
Sbjct: 26  HLKQVIGRGSYGVVYKAINKHTDQVVA-----IKEIVYENDEELNDIMAEI-SLLKNLNN 79

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
             IV Y   H     ++  +YE+++++EYC+ G L   + +R    L+E E  T      
Sbjct: 80  NNIVKY---HG----FIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTL 131

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H     +IHRDIK  N+L+S D+  KL DFG VS  +               + 
Sbjct: 132 WGLKYLH--GEGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA-----------LT 177

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI---LNGGV 259
           ++ T  + APE+L   +G S    SDIW+LG  + +L     P+    +A I   +    
Sbjct: 178 LAGTLNWMAPEILG-NRGAST--LSDIWSLGATVVELLTKNPPYHNLTDANIYYAVENDT 234

Query: 260 EFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            +PP   +S+++K  +     KN   RP   Q+++
Sbjct: 235 YYPP-TAFSESLKDFLSKCFVKNMYKRPTADQLLK 268

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 97/193 (50%), Gaps = 18/193 (9%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I   ++ G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDL-TKGFSV 223
           +L++ +   KL DFG VSG+IR        +  + D  +  T  + APE++     G+  
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STFKRDTFVG-TPYWMAPEVVCCEVDGY-- 194

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH--YSDAVKQLIMSMLA 280
           N+K+DIW+LG+  Y+L     P  +     ++ N     PP     +S+A K+ +   L 
Sbjct: 195 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSEAAKEFVAGCLV 254

Query: 281 KNPLHRPNIFQII 293
           K P  RP+ + ++
Sbjct: 255 KTPADRPSAYDLL 267

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 98/193 (50%), Gaps = 18/193 (9%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I   ++ G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDL-TKGFSV 223
           +L++ +   KL DFG VSG++R        + ++ D  +  T  + APE++     G+  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH--YSDAVKQLIMSMLA 280
           N+K+DIW+LG+  Y+L     P  +     ++ N     PP     +SDA K+ +   L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGCLV 249

Query: 281 KNPLHRPNIFQII 293
           K P  RP+ + ++
Sbjct: 250 KVPADRPSAYDLL 262

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 122/303 (40%), Gaps = 39/303 (12%)

Query: 3    TPHIPKYEPGTTVTVGSHSVHI-----LKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKR 57
            TP    Y+P   +    HS+       L+ +  G Y ++           +   M   +R
Sbjct: 1156 TPTTFLYKPVHNIGALKHSIKFSDFTNLQKMGEGAYGKVNLCMHKKEKYIVVIKMIFKER 1215

Query: 58   VIVPD---KSHLNTLRAEVDAMKRLKH--HKYIVSYIDSHAAKSQYMDGTYEVFLIMEYC 112
            ++V        L T+ +E+  M  L    H+ I+  +D       Y       ++     
Sbjct: 1216 ILVDTWVRDRKLGTIPSEIQIMATLNKQPHENILRLLDFFEDDDYY-------YIETPIH 1268

Query: 113  SRGGLIDFMN-TRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
               G ID  +   L+N +TE E+  I   I  G+  +H     +IHRDIK ENV++    
Sbjct: 1269 GETGCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATG 1326

Query: 172  KYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGFSVNDKSDI 229
              KL DFGS +     P           D+ + T   Y APE+L  D  +G       DI
Sbjct: 1327 FVKLIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEG----KPQDI 1371

Query: 230  WALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNI 289
            WA+G+ LY + +   PF    E  IL G + F      S   K LI  +L +N   RP I
Sbjct: 1372 WAIGILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

Query: 290  FQI 292
              I
Sbjct: 1430 DDI 1432

>YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}
           TOS3Protein kinase, related to and functionally
           redundant with Elm1p and Sak1p for the phosphorylation
           and activation of Snf1p; functionally orthologous to
           LKB1, a mammalian kinase associated with Peutz-Jeghers
           cancer-susceptibility syndrome
          Length = 560

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 99/207 (47%), Gaps = 26/207 (12%)

Query: 72  EVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTE 131
           E++ MKR  H   +  Y   +  +S       +V+L++EYCSRG +      +++ +   
Sbjct: 104 EIEVMKRCHHENVVELYEILNDPEST------KVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 132 TEILTIQ------LHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG----SV 181
             ILT Q      L +  G+  +H+    + HRDIK  N+LIS++   K+ DFG    + 
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLHSQG--ITHRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +G      + E+L   R    + T A + APE+    K +S +   DIW+LGV +Y L +
Sbjct: 216 TGSTNIQSSHEQLLKSR---ALGTPA-FFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLF 271

Query: 242 YTTPFEQTGEA----GILNGGVEFPPY 264
              PF           I+N  +EFP Y
Sbjct: 272 GKLPFNANSGLELFDSIINKPLEFPSY 298

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 82.4 bits (202), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 98/193 (50%), Gaps = 18/193 (9%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I   ++ G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDL-TKGFSV 223
           +L++ +   KL DFG VSG+IR        + ++ D  +  T  + APE++     G+  
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIR--------STMKRDTFVG-TPYWMAPEVVCCEVDGY-- 189

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH--YSDAVKQLIMSMLA 280
           N+K+DIW+LG+  Y+L     P  +     ++ N     PP     +S+A K+ +   L 
Sbjct: 190 NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGCLV 249

Query: 281 KNPLHRPNIFQII 293
           K P  RP+ + ++
Sbjct: 250 KAPADRPSAYDLL 262

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 77/352 (21%), Positives = 143/352 (40%), Gaps = 74/352 (21%)

Query: 13  TTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAE 72
           ++V +      I + L  GG++ +Y  Q    +     ++  LK++  P       + + 
Sbjct: 19  SSVLINGQHYAIQRLLGEGGFSFVYLVQSRENN-----DLFALKKIHCP----FGNIESV 69

Query: 73  VDAMKRLKHHKYIVSYIDSHAAKSQYM---DGTYEVFLIMEYCSRGGLID---------- 119
            +AM+ +  +K   S   +H   SQ +   DG+  VF+++ Y   G L+D          
Sbjct: 70  SEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 120 -----------------------------------FMNTRLQNR----LTETEIL----- 135
                                               +NT LQ R    +T  E L     
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 136 TIQLHISQG-VAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
           +++L +  G  ++         H+DIK  N++ S+D    +CD GS S       +  +L
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA-- 252
              +       T  +R+PE+L++T    +++K DIW+LG  LY +C+  +PFE+  +   
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 253 -----GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
                 I  G    PP  +YS  + ++I   +  +   RP+I +++  +  L
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDL 361

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 25/197 (12%)

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           +V++ +EYC    L D++   +  R+   E   +   I   V   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGF 221
           N+L+      KL DF    G+ R   T  +L  +        T  Y APE+L  D   GF
Sbjct: 158 NILLDMQGNAKLADF----GFTRECATKNQLETI------CGTTVYMAPELLRRDTYDGF 207

Query: 222 SVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNGGVEFPPYPHYSDAVKQLIMS 277
            +    DIW+LGV LY L   + PF++  E      I+N   ++      ++++ +LI S
Sbjct: 208 KI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDYNEKIFNANSI-ELIKS 262

Query: 278 MLAKNPLHRPNIFQIIQ 294
           +L K+P  RP++ +I++
Sbjct: 263 LLIKDPKKRPSMTEILK 279

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 125/279 (44%), Gaps = 38/279 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRL- 79
            +L+ L  G Y ++           +   M   +R++V        L T+ +E+  M  L 
Sbjct: 824  VLQQLGEGAYGKVKLCIHKEKRTIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLN 883

Query: 80   -KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRG--GLIDFMN-TRLQNRLTETEIL 135
             K HK IV+ +D    +  Y          ME  + G  G ID  +   L+  +TE E  
Sbjct: 884  KKPHKNIVALLDFFEDEEYYY---------METPAHGETGSIDLFDLIELKKNMTEYEEK 934

Query: 136  TIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELA 195
             I   +  G+  +H     ++HRDIK ENV++ +    KL D+GS +     P       
Sbjct: 935  LIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGSAAYTKSGP------- 985

Query: 196  YVRHDIMMSTTAQYRAPEMLDLTKGFSVNDK--SDIWALGVFLYKLCYYTTPFEQTGEAG 253
                D+ + T   Y APE+L    G SV D    DIWA+G+ LY + +   PF    E  
Sbjct: 986  ---FDVFVGTI-DYAAPEVL----GGSVYDGKPQDIWAIGILLYTIIFKENPFYNIDE-- 1035

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            I++G + F    + S+A  +LI  +L ++ + RP + +I
Sbjct: 1036 IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1130

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 128/274 (46%), Gaps = 56/274 (20%)

Query: 64  SHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG--TYEVFLIMEYCSRGGLIDFM 121
           +H + ++ E+  MK+  H+K++V  I       + +D   + +++L++EYCS+G +    
Sbjct: 164 THSDKIKREIAIMKKC-HYKHVVELI-------EVLDDFKSRKIYLVLEYCSKGEVKWCP 215

Query: 122 NTRLQNRLTETEILTIQL--HISQGVA-AMHTLQ-PPLIHRDIKIENVLISNDHKYKLCD 177
             +++       +LT Q    I +GV   +  L    +IHRDIK  N+LIS D+  K+ D
Sbjct: 216 GDQMETEARGPPLLTFQRTREILRGVVLGLEYLHYQGVIHRDIKPANLLISEDNTVKISD 275

Query: 178 FG---SVSGYIRPP--KTPEELAYVRHDIMMSTTAQYRAPEML--------------DLT 218
           FG   + +G       ++ +EL   +     + T  + APE+               DL 
Sbjct: 276 FGVSLAATGAEDADNIESDDELELAK----TAGTPAFFAPEICLGNEAFEKYQLKREDLF 331

Query: 219 KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGE----AGILNGGVEFPPY---------- 264
           KG S++   DIWALGV LY L +   PF    E      I+N  V+FP Y          
Sbjct: 332 KGSSISFMIDIWALGVTLYCLLFGMLPFISDYELELFEKIVNDPVKFPSYEEVKGNRVSM 391

Query: 265 ----PHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
                 Y+ A+  L+  +L KNP+ R  I +I Q
Sbjct: 392 LSSEEEYNMAL-DLVNRLLEKNPMKRITIAEIKQ 424

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 126/281 (44%), Gaps = 52/281 (18%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +       VLK     DKS  N +R EV       H +
Sbjct: 39  ILKQIGEGSFGKVYLASHKPTHR-----KVVLK---TSDKSDPNLVR-EV-----FYHRQ 84

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L + +   + +R+   E   +   I  
Sbjct: 85  FDFPYI---TKLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVS 139

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H+L    +HRD+K+EN+L+  +   KL DFG          T E ++    + + 
Sbjct: 140 AVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGF---------TRECVSKSSLETIC 188

Query: 204 STTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
            TT  Y APE++      GF +    DIW+LGV LY +   T PF++  E      I+N 
Sbjct: 189 GTTV-YMAPELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVND 243

Query: 258 GVEFPPYPHYSD-----AVKQLIMSMLAKNPLHRPNIFQII 293
                 +P+++D       K LI  +LAK P  RP + QI+
Sbjct: 244 ------FPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 97/195 (49%), Gaps = 25/195 (12%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           V++++EYCS   L + +    +  L E++ L  Q  I+  V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQ--IASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLD--LTKGFS 222
           VL+  +   KL DF    G+ R   T  +L  +        T  Y APE+++     GF 
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETI------CGTTVYMAPELIERKCYDGFK 208

Query: 223 VNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNGGVEFPPYPHYSDAVKQLIMSM 278
           V    DIW+LG+ LY +     PF++  +      I+N  ++F       DA+  LI  M
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAI-DLIQGM 263

Query: 279 LAKNPLHRPNIFQII 293
           L KNP  R ++ Q++
Sbjct: 264 LRKNPNERISLAQVL 278

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 133/282 (47%), Gaps = 34/282 (12%)

Query: 19  SHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSH--LNTLRAEVDAM 76
           +H+  + + +  G +  +Y A     D+   TN  V  +V+  + ++  L  L  E+  +
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDR--TTNKVVAIKVVDLENTNERLEVLAQEIFFL 72

Query: 77  KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILT 136
             LK   YI++YI +    +        ++++MEYC  G   D +     N L E ++  
Sbjct: 73  AELKS-PYIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAY 124

Query: 137 IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
           I   I +G+  +H  +   IHRDIK  N+L++ +   KL DFG VSG ++        + 
Sbjct: 125 ITREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------ST 173

Query: 197 VRHDIMMSTTAQYRAPEMLDL-TKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL 255
           +R   ++  T  + APE+     +G+  ++K DIW+LG+ +++L     P  +     +L
Sbjct: 174 LRRGTIVG-TPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL 230

Query: 256 -NGGVEFPPYPH--YSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            N   +  P     YSDA K  +   L KNP  RP    +++
Sbjct: 231 ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 124/279 (44%), Gaps = 46/279 (16%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           ILK +  G + ++Y A   P  +        LK     DK+  N +R EV       H +
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTHR-----KVCLK---TSDKNDPNIVR-EV-----FYHRQ 88

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L D + +  +  L E   L  Q  IS 
Sbjct: 89  FDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFAQ--ISG 143

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            V   H++    +HRD+K+EN+L+  +   KL DF    G+ R   T   L  V      
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDF----GFTRECMTKTTLETV------ 191

Query: 204 STTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
             T  Y APE+++     GF +    DIW+LGV LY L     PF+   E      I+N 
Sbjct: 192 CGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEVKTKWKIVN- 246

Query: 258 GVEFPPY--PHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             E P Y      D  K LI  +LAKNP  RP++ Q+++
Sbjct: 247 --EEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVLR 283

>YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protein
           ser/thr kinase required for vesicle formation in
           autophagy and the cytoplasm-to-vacuole targeting (Cvt)
           pathway; structurally required for phagophore assembly
           site formation; during autophagy forms a complex with
           Atg13p and Atg17p
          Length = 897

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 130/302 (43%), Gaps = 57/302 (18%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K +  G +A +Y    + +D+     +  + R  + +K  L  L  E+  +K++KH  +I
Sbjct: 28  KEIGKGSFATVYRGH-LTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIKH-PHI 85

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ------------------- 126
           V  ID     + +       +LIMEYC+ G L   +  R +                   
Sbjct: 86  VGLIDCERTSTDF-------YLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPS 138

Query: 127 ---NRLTETEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLIS------NDHKYKLC 176
              N L    +L+   ++ Q  +A+  L+   L+HRDIK +N+L+S      +D K    
Sbjct: 139 ENHNGLHRAFVLS---YLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSK-SFH 194

Query: 177 DFGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230
           + G V  Y  P     +  + R          +  +  Y APE+L+  K    N K+D+W
Sbjct: 195 ELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLW 251

Query: 231 ALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAKNPL 284
           ++G  ++++C  T PF  +    +       N  + FP Y +    +K+LI S+L  +P 
Sbjct: 252 SVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPA 311

Query: 285 HR 286
            R
Sbjct: 312 QR 313

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 130/301 (43%), Gaps = 55/301 (18%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K +  G +A +Y    + +D+     +  + R  + +K  L  L  E+  +K++KH  +I
Sbjct: 28  KEIGKGSFATVYRGH-LTSDKSQHIAIKEVSRTKLKNKKLLENLEIEIAILKKIKH-PHI 85

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ------------------- 126
           V  ID     + +       +LIMEYC+ G L   +  R +                   
Sbjct: 86  VGLIDCERTSTDF-------YLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPS 138

Query: 127 ---NRLTETEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLISND----HKYK-LCD 177
              N L    +L+   ++ Q  +A+  L+   L+HRDIK +N+L+S      H  K   +
Sbjct: 139 ESHNGLHRAFVLS---YLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKTFHE 195

Query: 178 FGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWA 231
            G V  Y  P     +  + R          +  +  Y APE+L+  K    N K+D+W+
Sbjct: 196 LGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWS 252

Query: 232 LGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAKNPLH 285
           +G  ++++C  T PF  +    +       N  + FP Y +    +K+LI S+L  +P+ 
Sbjct: 253 VGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPVK 312

Query: 286 R 286
           R
Sbjct: 313 R 313

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 120/280 (42%), Gaps = 38/280 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRL- 79
            +L+ +  G Y+++           +   M    R++V        L T+ +E+  M  L 
Sbjct: 1041 VLQKMGEGAYSKVNMCYHKTKKYVVVIKMIYKDRILVDSWVRDRKLGTIPSEIQIMYTLN 1100

Query: 80   -KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILTI 137
             K H  I+  ID       + D  Y  +L        G ID  +    +  +TE E   I
Sbjct: 1101 RKPHDNILRMIDF------FEDDQY-YYLETPVHGESGCIDLFDLIEFRTDMTEDEAKLI 1153

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               ++ G+  +H+L   ++HRDIK ENV+I +    K+ DFGS              AYV
Sbjct: 1154 FKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGYVKIIDFGSA-------------AYV 1198

Query: 198  RH---DIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAG 253
            ++   D+ + T   Y APE+L    G     K  DIWALG+ LY + +   PF    E  
Sbjct: 1199 KNGPFDVFVGTI-DYAAPEVL---AGNPYEGKPQDIWALGILLYTIIFKENPFYNIDE-- 1252

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
            I+ G V F      +    QLI  ML K    RP+I ++ 
Sbjct: 1253 IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVF 1292

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 122/270 (45%), Gaps = 47/270 (17%)

Query: 47   FLGTN-----MAVLKRVIVP-----DK---SHLNTLRAEVDAMKRLKHHKYIVSYIDSHA 93
            FLG N     M  +K+V VP     D+   S L  LR+EV  +K L H   IV Y+    
Sbjct: 1161 FLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHTN-IVQYLG--- 1216

Query: 94   AKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQP 153
                + +  Y   L +EY + G +   +  RL  +  E  I  + + + +G++ +H+ + 
Sbjct: 1217 ----FENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK- 1269

Query: 154  PLIHRDIKIENVLISNDHKYKLCDFG--SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRA 211
             ++HRD+K +N+L+  D   K+ DFG    S  I          Y   D+ M  T  + A
Sbjct: 1270 -ILHRDMKADNLLLDVDGICKISDFGISKKSNNI----------YSNSDMTMRGTVFWMA 1318

Query: 212  PEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEF---PPYPHYS 268
            PEM+D  +G+S   K DIW+LG  + ++     P+        +    +F   PP P  +
Sbjct: 1319 PEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDT 1376

Query: 269  DAV-----KQLIMSMLAKNPLHRPNIFQII 293
              +     K+ + +    NP  RP   +++
Sbjct: 1377 QKIISAEGKEFLDACFEINPEKRPTADELL 1406

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 128/296 (43%), Gaps = 33/296 (11%)

Query: 5    HIPKYEPGTTVTVGSHS-VHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD- 62
            H+P+ E G    V   S   +L+ +  G Y ++    +   ++++     + K  I+ D 
Sbjct: 1047 HVPETEIGALKHVKKFSDFTVLQNMGKGAYGKV-DLCLHKKEKYVVVIKLIFKERILVDT 1105

Query: 63   ---KSHLNTLRAEVDAMKRL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117
                  L T+ +E+  M  L  K H+ I+  +D       + D  Y       +   G +
Sbjct: 1106 WVRDRKLGTIPSEIQIMATLQKKPHENIMKLLDF------FEDDQYYYIESPMHGETGSI 1159

Query: 118  IDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177
              F    L+  +TE E   +   I+ GV  +H     ++HRDIK ENV++ N    KL D
Sbjct: 1160 DLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVKLID 1217

Query: 178  FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFL 236
            FGS +   R P           D+ + T   Y APE+L+   G     K  DIWA+GV L
Sbjct: 1218 FGSAAYVKRGP----------FDVFVGTI-DYAAPEVLE---GDPYEGKPQDIWAIGVLL 1263

Query: 237  YKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            Y + Y   PF    E  IL+G +   P    S+    LI  +L ++   RP +  I
Sbjct: 1264 YTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 115/251 (45%), Gaps = 31/251 (12%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D+  +  ++ E+  +  LK    I  Y  S      Y+  T  +++IMEYC  G L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGS------YLKNT-SLWIIMEYCGGGSLRSLL 123

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
                 ++ E  I  I   I   +  +H  +  +IHRDIK  NVLI+ND   KLCDFG V
Sbjct: 124 R---PGKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFG-V 177

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +  +   K+  +         M+ T  + APE+  + +G   + K+DIW+ G+  Y++  
Sbjct: 178 AAQLNQTKSRRQ--------TMAGTPYWMAPEV--IMEGVYYDTKADIWSTGITAYEVTT 227

Query: 242 YTTPFEQTGEAGILNGGVEFPPYP-----HYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
              P+        +    +  P P     +YS  +K+ I + L ++P  RP   ++++T 
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKP-PRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTA 286

Query: 297 SKLLNVNCPIP 307
              +    P+P
Sbjct: 287 --FIKTYKPLP 295

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 124/268 (46%), Gaps = 43/268 (16%)

Query: 47   FLGTN-----MAVLKRVIVP-----DKSHLNT---LRAEVDAMKRLKHHKYIVSYIDSHA 93
            FL  N     M  +K+V VP     +++ +NT   LR EV  +K L H   IV Y+   A
Sbjct: 1155 FLAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKDLDHLN-IVQYLGFEA 1213

Query: 94   AKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQP 153
                  +G Y +FL  EY + G +   +  R+  R  +  I  + + + QG++ +H+   
Sbjct: 1214 K-----NGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQGLSYLHSRG- 1263

Query: 154  PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPE 213
             ++HRD+K +N+L+  D   K+ DFG +S      +   ++ Y   ++ M  T  + APE
Sbjct: 1264 -ILHRDMKADNLLLDQDGVCKISDFG-IS------RKSNDI-YSNSEMTMKGTVFWMAPE 1314

Query: 214  MLDLTKGFSVNDKSDIWALGVFLYKLCYYTTP---FEQTGEAGILNGGVEFPPYPH---- 266
            M+D  +G+S   K DIW+LG  + ++     P   FE       +      PP P     
Sbjct: 1315 MVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKSAPPIPEDTLP 1372

Query: 267  -YSDAVKQLIMSMLAKNPLHRPNIFQII 293
              S+  K+ +      +P  RP   +++
Sbjct: 1373 LISENAKEFLDCCFEIDPEKRPTADKLL 1400

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 130/302 (43%), Gaps = 57/302 (18%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K +  G +A +Y    + +D+     +  + R  + +K  L  L  E+  +K++KH  +I
Sbjct: 34  KEIGKGSFATVYRGH-LTSDKSQHIAIKEVSRAKLKNKKLLENLEIEIAILKKIKH-PHI 91

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ------------------- 126
           V  ID     + +       +LIMEYC+ G L   +  R +                   
Sbjct: 92  VGLIDCERTSTDF-------YLIMEYCALGDLTFLLKRRKELMENHPLLKTVFEKYPPPS 144

Query: 127 ---NRLTETEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLIS------NDHKYKLC 176
              N L    +L+   ++ Q  +A+  L+   L+HRDIK +N+L+S      +D K    
Sbjct: 145 ENHNGLHRAFVLS---YLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSK-TFH 200

Query: 177 DFGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230
           + G V  Y  P     +  + R          +  +  Y APE+L+  K    N K+D+W
Sbjct: 201 ELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLW 257

Query: 231 ALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAKNPL 284
           ++G  ++++C  T PF  +    +       N  + FP Y +    +K+LI S+L  +P 
Sbjct: 258 SVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPA 317

Query: 285 HR 286
            R
Sbjct: 318 KR 319

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 109/243 (44%), Gaps = 42/243 (17%)

Query: 72  EVDAMKRLKHHKYIVSYI---DSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           EV+ MKR  H   +  Y    D  +AK         V+L++EYCSRG +      +L+ +
Sbjct: 104 EVEVMKRCHHENVVELYEILNDPESAK---------VYLVLEYCSRGPVKWCPENQLEIK 154

Query: 129 LTETEILTIQLH---ISQGVAAMHTLQPP-LIHRDIKIENVLISNDHKYKLCDFGSVSGY 184
                IL+ Q     +S  V+ +  L    +IHRDIK  N+LIS++   K+ DFG VS  
Sbjct: 155 AVGPPILSFQQARNIVSDVVSGLEYLHSQGIIHRDIKPSNLLISSNGTVKISDFG-VSIL 213

Query: 185 IRPPKTPEELAYVRHDIMMST----TAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
                T  + +   H+ ++ +    T  + APE+         +   DIW+LGV LY L 
Sbjct: 214 TAAESTNIQSS---HEPILKSKTFGTPAFFAPELCSTETYCCRSSAIDIWSLGVTLYCLL 270

Query: 241 YYTTPFEQTGEA----GILNGGVEFPPY-------------PHYSDAVKQLIMSMLAKNP 283
           + T PF           I+N  ++FP Y               Y DA K L+  +L KNP
Sbjct: 271 FGTLPFNANSGLELFDNIINKPLDFPSYEEILKHDSSNVTIEEYRDA-KDLLYKLLEKNP 329

Query: 284 LHR 286
             R
Sbjct: 330 SRR 332

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 113/243 (46%), Gaps = 36/243 (14%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           +R E++ MKR  HH+ +V   D           + +V+L++EYCSRG +      +L+ +
Sbjct: 101 IREEIEIMKRC-HHENVVKLYDILNDPE-----STKVYLVLEYCSRGPVKWCPENQLEIK 154

Query: 129 LTETEILTIQLH---ISQGVAAMHTLQPPLI-HRDIKIENVLISNDHKYKLCDFG----S 180
                ILT +     +S  V+ +  L    I HRDIK  N+LIS++   K+ DFG    +
Sbjct: 155 AVGPSILTFEQARKIVSDVVSGLEYLHSQGITHRDIKPSNLLISSNGAVKISDFGVSILT 214

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240
            +G      + E+++  +    + T A + APE+      +  +   DIW+LGV LY + 
Sbjct: 215 TTGSTNIQSSQEQISKSK---TLGTPA-FFAPELCTADGDYRCSSAIDIWSLGVTLYCML 270

Query: 241 YYTTPFEQTGEA----GILNGGVEFPPYPH-------------YSDAVKQLIMSMLAKNP 283
           + T PF           I++  + FP Y               Y+DA K ++  +L KNP
Sbjct: 271 FGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDA-KDILNRLLKKNP 329

Query: 284 LHR 286
             R
Sbjct: 330 SER 332

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 131/280 (46%), Gaps = 29/280 (10%)

Query: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLR 70
           P T V   S    I + +  G +  +Y A     D+  G  +AV    +   +  ++ L 
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETGEMVAVKIINLEETQDDIDVLA 80

Query: 71  AEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
            E+  +  L+   ++ +Y  ++            ++++ME+C  G   D +    ++RL 
Sbjct: 81  QEIYFLSELRA-PFVTTYYKTYVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLP 132

Query: 131 ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
           E ++  I   +  G+  +H+ +   IHRD+K  N+L++++ + KL DFG VSG I     
Sbjct: 133 ENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQI----- 184

Query: 191 PEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTG 250
              +A ++ +  +  T  + APE++    G+  ++K+DIW+LG+   +L     P+ +  
Sbjct: 185 ---MATLKRNTFVG-TPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYD 238

Query: 251 EAGIL-NGGVEFPP--YPHYSDAVKQLIMSMLAKNPLHRP 287
              +L N  +  PP     ++ + +  I   L K+P  RP
Sbjct: 239 PMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRP 278

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 113/251 (45%), Gaps = 44/251 (17%)

Query: 71  AEVDAMKRLKHHKYIVSYI----DSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ 126
            E++AMKR  HHK +V       D  ++K         V+L++EYCSRG +      +++
Sbjct: 103 GEIEAMKRC-HHKNVVELYEILNDPESSK---------VYLVLEYCSRGPVRWCPENQME 152

Query: 127 NRLTETEILTIQLH---ISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFG--- 179
            +     ILT +     +S  V+ +  L    + HRDIK  N+LIS++   K+ DFG   
Sbjct: 153 IKAVGPSILTFEQSRKILSDVVSGLEHLHSRGITHRDIKPSNLLISSNGTVKISDFGVAI 212

Query: 180 -SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYK 238
            S +G      + E++   +    + T A + APE+             DIW+LGV LY 
Sbjct: 213 LSTTGSTNIQSSHEQILKSK---TLGTPA-FLAPELCSTDSEHCCTFAIDIWSLGVTLYC 268

Query: 239 LCYYTTPFEQTGEA----GILNGGVEFPPY-------------PHYSDAVKQLIMSMLAK 281
           L + T PF           I+N  +E P Y               YSDA K L+  +L K
Sbjct: 269 LLFGTLPFNANSVLELFDKIINKSLEVPSYEEMLNRGTSDITIEEYSDA-KNLLYKLLQK 327

Query: 282 NPLHRPNIFQI 292
           NP  R  + +I
Sbjct: 328 NPDKRIALAEI 338

>KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} similar
           to uniprot|P53104 Saccharomyces cerevisiae YGL180W ATG1
           Protein serine/threonine kinase required for autophagy
           and for the cytoplasm-to-vacuole targeting (Cvt) pathway
          Length = 873

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 130/305 (42%), Gaps = 56/305 (18%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLK---RVIVPDKSHLNTLRAEVDAMKRLK 80
           + K +  G +A +Y  + + A+Q    +   +K   R  + +K  L  L  E+  +K++K
Sbjct: 22  VEKEIGKGSFATVYKGR-LAANQDHNNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKIK 80

Query: 81  HHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCS----------RGGLID---FMNTRLQ- 126
           H  +IV  +D     S +       FLIMEYC+          RGGLI+    + T  + 
Sbjct: 81  H-PHIVGLMDCERTGSDF-------FLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEK 132

Query: 127 --------NRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISN-----DHKY 173
                   N L    +++    +S   A M      L+HRDIK +N+L+S      D + 
Sbjct: 133 YPPPSESHNGLNRVVVVSYLQQLSS--ALMFLRSKNLVHRDIKPQNLLLSTPLVGYDDRE 190

Query: 174 KLCDFGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDKS 227
                G V  Y  P     +  + R          +  +  Y APE+L+  K    N K+
Sbjct: 191 TFHKMGYVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAKA 247

Query: 228 DIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAK 281
           D+W++G  LY++C    PF+ +    +       N  + FP + +    +++LI  +L  
Sbjct: 248 DLWSVGTVLYEMCCGRPPFKASNHLELFKKIKRANDVISFPSHCNIEPKMRELICGLLTF 307

Query: 282 NPLHR 286
           +P  R
Sbjct: 308 DPSQR 312

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 124/291 (42%), Gaps = 54/291 (18%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            +L+ +  G Y ++ +  I    +++     + K  I+ D       L T+ +E+  +  +
Sbjct: 948  VLQKMGEGAYGKV-NLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQILATI 1006

Query: 80   --KHHKYIVSYIDSHAAKSQY--------MDGTYEVFLIMEYCSRGGLIDFMNTRLQNRL 129
              + H+ I+  +D       Y          G+ ++F I+E+              ++ +
Sbjct: 1007 NKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEF--------------KSNM 1052

Query: 130  TETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPK 189
            TE E   I   I  G+  +H     ++HRDIK ENV++ +    KL DFGS         
Sbjct: 1053 TEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSA-------- 1102

Query: 190  TPEELAYVR---HDIMMSTTAQYRAPEMLDLTKGFSVNDKS-DIWALGVFLYKLCYYTTP 245
                 AYV+    D+ + T   Y APE+L    G     KS DIWA+G+ LY L Y   P
Sbjct: 1103 -----AYVKSGPFDVFVGTI-DYAAPEVL---GGNPYEGKSQDIWAIGILLYTLIYKENP 1153

Query: 246  FEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
            F    E  IL G + F      S   K LI  +L +    RP I +I Q V
Sbjct: 1154 FYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 130/280 (46%), Gaps = 48/280 (17%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           IL+ +  G + ++Y A   P  +       V+K  +   K+  N +R EV   ++ ++H 
Sbjct: 48  ILEQIGEGSFGKVYLAMHRPTHR-----KVVIKSSV---KNDPNIVR-EVFYHRQFEYH- 97

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ-NRLTETEILTIQLHIS 142
           YI    +    +S+       V++ +EYC    L D +   LQ  R+   E + +   I 
Sbjct: 98  YITKLYEIIVTESK-------VWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIV 147

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
             V   H+L    +HRD+K+EN+L+  D   KL DFG          T E +  V  + +
Sbjct: 148 GAVYYAHSLN--CVHRDLKLENILLDKDGNAKLTDFGF---------TRECMEKVNLETI 196

Query: 203 MSTTAQYRAPEMLDLT--KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILN 256
             TT  Y APE+ +     GF +    DIW+LGV LY +   + PF++  EA     I+N
Sbjct: 197 CGTTV-YMAPELTERKPYDGFKI----DIWSLGVILYTMLSGSMPFDEDDEAKTKWKIIN 251

Query: 257 GGVEFPPY--PHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
              E P Y     +   + L+  +L K+   RP++ +I+Q
Sbjct: 252 ---EEPEYNSKFMTAEGEDLVRKLLQKDSNLRPSVREILQ 288

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 116/267 (43%), Gaps = 38/267 (14%)

Query: 52   MAVLKRVIVPDKSHLN--------TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S  N         LR+EV  +K L H   IV Y+       +  D  Y
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLN-IVQYLGF-----ENKDNIY 1253

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E  I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1254 SLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDMKAD 1307

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1308 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1359

Query: 224  NDKSDIWALGVFLYKLCYYTTPF---EQTGEAGILNGGVEFPPYPH-----YSDAVKQLI 275
              K DIW+LG  + ++     P+   E       +      PP P       S   +  +
Sbjct: 1360 --KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRGFL 1417

Query: 276  MSMLAKNPLHRPNIFQIIQTVSKLLNV 302
             +    NP  RP   +++     ++NV
Sbjct: 1418 DACFEINPEKRPTATELLSHRFSVVNV 1444

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 120/281 (42%), Gaps = 36/281 (12%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRLK 80
            +L+ L  G Y  ++          +     + +R+++          T+ +E+  M +  
Sbjct: 797  VLQKLGDGAYGHVHLCMNKKTKHLVIIKAIIKERILIDTWVRDREFGTIPSEIYIMSKFN 856

Query: 81   HHKYIVSYIDSHAAKSQYMDGTYE---VFLIMEYCSRGGLIDFMN-TRLQNRLTETEILT 136
             H         H   +Q MD   +    ++ +E     G ID  +   L+  +TE E   
Sbjct: 857  AH--------PHDNITQIMDFFEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKL 908

Query: 137  IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
            I   I  G+  +H     ++HRDIK ENV++ ++   KL DFGS + Y +    P E   
Sbjct: 909  IFKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGS-AAYTK--TGPFE--- 960

Query: 197  VRHDIMMSTTAQYRAPEML--DLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI 254
                 +   T  Y APE+L  +  KG       DIWALGV LY L Y   PF    E  I
Sbjct: 961  -----VFVGTIDYAAPEILGGNPYKG----KPQDIWALGVLLYTLIYKENPFYNVDE--I 1009

Query: 255  LNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
            L G + F    + +     LI  +L K+   RP+I +I+ +
Sbjct: 1010 LEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIVNS 1050

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 125/278 (44%), Gaps = 46/278 (16%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           I+K +  G + ++Y A   P  +       VLK     DK+  N +R EV       H +
Sbjct: 39  IMKQIGEGSFGKVYLASHKPTHR-----KVVLK---TSDKNDPNVVR-EV-----FYHRQ 84

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L + +    +  L E   L  Q  I  
Sbjct: 85  FDYLYI---TRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLFAQ--IVG 139

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            +   H+L    +HRD+K+EN+L+      KL DFG          T E ++  + D + 
Sbjct: 140 AIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGF---------TRECVSKSQLDTIC 188

Query: 204 STTAQYRAPEMLDLTK--GFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
            TT  Y APE+ +     GF +    DIWALGV LY +   + PF++  EA     I+N 
Sbjct: 189 GTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDEDDEAKTKWKIVN- 242

Query: 258 GVEFPPYPH--YSDAVKQLIMSMLAKNPLHRPNIFQII 293
             E P       S   K LI  +LAK+P  RP+I +I+
Sbjct: 243 --EMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 23/195 (11%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           V++ +EYC    L D++  + +  L ET  L  Q  I   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQ--IVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGFS 222
           +L+  +    L DF    G+ R   T  +L  V        T  Y APE++  +   G+ 
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 VNDKSDIWALGVFLYKLCYYTTPFEQ--TGEAGILNGGVEFPPYPHY-SDAVKQLIMSML 279
           V    D W+LG+ LY + +   PF++  T   G+     E      Y S   K LI+ +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 AKNPLHRPNIFQIIQ 294
            KN   RPN+ +++Q
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 103/230 (44%), Gaps = 31/230 (13%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
            R EV+    L H      Y   H  K         V+L+MEY   G L   +  R +  
Sbjct: 154 FRREVEIQSSLNHQNLTKLYGYFHDDK--------RVYLLMEYLVNGELYKLL--RAKGP 203

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           L +         ++  +  MH  Q  +IHRD+K EN+LI  D+  KL DFG     I P 
Sbjct: 204 LDDIFASHYVYQMADALDYMH--QRNIIHRDVKPENILIGFDNTVKLTDFG--WSIINPR 259

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
            T  +         M  T  Y +PE++  +K +  +DK D+WALGV  ++L   + PFE+
Sbjct: 260 GTKRK--------TMCGTLDYLSPELI-ASKEY--DDKVDVWALGVLTFELVVNSPPFEE 308

Query: 249 TGE----AGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             +      I+ G ++FP   H S   + LI  +L  N   R ++ ++ Q
Sbjct: 309 DSKELTSKRIVRGDLKFP--NHISSDAQDLITKLLRHNSKDRISLREVKQ 356

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 126/275 (45%), Gaps = 28/275 (10%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
            IL+ +  G +  +Y A+ +  ++ +   +  L+    P    ++ L  E+  +  L+  
Sbjct: 21  EILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELRS- 75

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
            YI +Y      K+ ++     ++++MEYC  G   + +    +++LTE +   I   + 
Sbjct: 76  PYITNY------KTAFLVDV-SMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H+ +   IHRDIK  N+L++++   KL DFG VSG         ++   R    
Sbjct: 129 VGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG---------QMMVTRKRDT 176

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFP 262
              T  + APE++D  K    N+ +DIW+LG+ + +L     P ++      L    +  
Sbjct: 177 FVGTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 263 P---YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           P      +S   K  +   L K+P  RP   ++++
Sbjct: 236 PPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 108/237 (45%), Gaps = 40/237 (16%)

Query: 52   MAVLKRVIVPDKSH--------LNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP+ S         +  L++EV  +K L +H  IV Y+       +  +G Y
Sbjct: 1063 MLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NHVNIVQYLGF-----EEKNGIY 1116

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  +  I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1117 SLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLEGLAYLHSKG--ILHRDMKAD 1170

Query: 164  NVLISNDHKYKLCDFG--SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGF 221
            N+L+ ND   K+ DFG    S  I          Y   D+ M  T  + APEM+D   G+
Sbjct: 1171 NLLLDNDGVCKISDFGISRKSNNI----------YSNSDMTMRGTVFWMAPEMVDTAHGY 1220

Query: 222  SVNDKSDIWALGVFLYKLCYYTTP---FEQTGEAGILNGGVEFPPYPHYSDAVKQLI 275
            S   K DIW+LG  + ++     P   FE       +      PP P   D  K L+
Sbjct: 1221 SA--KVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIP---DDTKDLV 1272

>Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON}
           similar to Ashbya gossypii ACL054W
          Length = 1066

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 153/365 (41%), Gaps = 68/365 (18%)

Query: 26  KYLTSGGYAQIYSAQIMP-ADQFLGTNMAV--LKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           K +  G +A +Y   ++   DQ    N+AV  + R  + +K  L  L  E+  +K++KH 
Sbjct: 30  KEIGRGSFAIVYKGHLLTNRDQ----NVAVKAVSRSKLKNKKLLENLEIEIAILKKIKH- 84

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTR--------LQNRLTE--- 131
            +IV  ++     + +       +L+MEYC+ G L  F+  R        L   L E   
Sbjct: 85  SHIVGLLECERTATDF-------YLMMEYCALGDLTFFIKKRKSLVDKHPLLRTLFEKYP 137

Query: 132 ---------TEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLISNDHKYKLCDF--- 178
                      +L +  ++ Q  +A+  L+   L+HRDIK +N+L+S      L D+   
Sbjct: 138 SPSEQHNGLNRVLVVN-YLQQLSSALKFLRSRNLVHRDIKPQNLLLST----PLVDYNDP 192

Query: 179 ------GSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDK 226
                 G V  Y  P     +  + R          +  +  Y APE+L+  K    N K
Sbjct: 193 QVFHERGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQK---YNAK 249

Query: 227 SDIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLA 280
           +D+W++G  LY++C    PF+ +    +       N  + FP +     A+ +LI  +L 
Sbjct: 250 ADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVISFPKHVELEPAMVELICGLLT 309

Query: 281 KNPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNS 340
             P  R    +      +L+N +  I  I    D++    N    NM I+ Y   + + S
Sbjct: 310 FEPAKRMGFSEFFG--DELVNEDLSIYEIESEPDLATKSKNVTESNMFISEYLS-IAERS 366

Query: 341 GISTP 345
             STP
Sbjct: 367 RKSTP 371

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 113/258 (43%), Gaps = 38/258 (14%)

Query: 52   MAVLKRVIVPDKSHLN--------TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S  N         LR+EV  +K L H   IV Y+       +  +  Y
Sbjct: 1203 MMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDLDHLN-IVQYLGF-----ENKNNIY 1256

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E+ I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1257 SLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHSKG--ILHRDMKAD 1310

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1311 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1362

Query: 224  NDKSDIWALGVFLYKLCYYTTPF---EQTGEAGILNGGVEFPPYPH-----YSDAVKQLI 275
              K DIW+LG  + ++     P+   E       +      PP P       S   +  +
Sbjct: 1363 --KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRSFL 1420

Query: 276  MSMLAKNPLHRPNIFQII 293
             +    NP  RP   +++
Sbjct: 1421 DACFEINPEERPTATELL 1438

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 120/286 (41%), Gaps = 52/286 (18%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRL- 79
            IL+ +  G Y ++           +   M   +R++V        L T+ +E+  M  L 
Sbjct: 1123 ILQKMGEGAYGKVNLCMHKMKKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLN 1182

Query: 80   -KHHKYIVSYIDSHAAKSQYM--------DGTYEVFLIMEYCSRGGLIDFMNTRLQNRLT 130
             K H+ I+  +D       Y          G+ ++F ++E+ S               +T
Sbjct: 1183 KKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSN--------------MT 1228

Query: 131  ETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKT 190
            E EI  +   +  GV  +H     ++HRDIK EN+++ N    K+ DFGS          
Sbjct: 1229 EFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGFIKIIDFGSA--------- 1277

Query: 191  PEELAYVR---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPF 246
                AYV+    D+ + T   Y APE+L    G     K  DIWALG+ LY + +   PF
Sbjct: 1278 ----AYVKSGPFDVFVGTI-DYAAPEVL---GGNPYEGKPQDIWALGILLYTIVFKENPF 1329

Query: 247  EQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
                E  IL G ++F    + S    +LI  +L +N   RP I  I
Sbjct: 1330 YNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTIDDI 1373

>Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)
           [2274 nt, 758 aa]
          Length = 757

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E D + 
Sbjct: 344 GPSDFEVLRLLGKGTFGQVY--QVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERDILV 401

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    +       +++L+ ++ S G L  F + + + R TE    
Sbjct: 402 RTASKSCPFIVGLKFSFQTPA-------DLYLVTDFMSGGEL--FWHLQKEGRFTEDRA- 451

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 452 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 502

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 503 ---RTNTFCGTT-EYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 556

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 557 YQKIAFGKVKF-PRDILSPEGRSFVKGLLNRNPNHR 591

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           V++ +EYC    L +++  +    L E   L  Q  I   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSELFSQ--IVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLT--KGFS 222
           +L+      KL DF    G+ R   T   L  +        T  Y APE+++    +G+ 
Sbjct: 159 ILLDKKGHAKLTDF----GFTRECATKGILETI------CGTTVYMAPELIERKPYEGYK 208

Query: 223 VNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEF-PPYPH-YSDA-VKQLIMSML 279
           +    D W+LG+ LY + + T PF++  E       V + P Y + Y D+  K+LI  +L
Sbjct: 209 I----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLL 264

Query: 280 AKNPLHRPNIFQIIQ 294
            K+P  RP++ Q++Q
Sbjct: 265 EKDPNQRPSLTQVLQ 279

>ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129W PAK1 Upstream kinase for the SNF1 complex
           partially redundant function with Elm1p and Tos3p
           members of this family of kinases have functional
           orthology with LKB1 a mammalian kinase associated with
           Peutz-Jeghers cancer-susceptibility syndrome and some
           similarities with YGL179C uniprot|P43637 Saccharomyces
           cerevisiae YGL179C TOS3 Putative protein kinase, related
           to and redundant with Elm1p and Pak1p in activating the
           SNF1 complex
          Length = 1131

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 142/333 (42%), Gaps = 58/333 (17%)

Query: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVL-----KRVIVPD 62
           KY+P +   V  ++  +++ L  G + ++  A+ +   Q +   +        +R +V D
Sbjct: 102 KYDPVSKRKV-LNTYELIQELGHGQHGKVKLARELLTGQLVAIKIVDRHEKKGRRFLVLD 160

Query: 63  KSHLNT----LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG--TYEVFLIMEYCSRGG 116
           K +  T    +R E+  MK+  H+K++V  +       + +D   + +++L++EYCSRG 
Sbjct: 161 KKNSLTQNEKIRREIAIMKKC-HYKHVVKLV-------EVLDDLKSRKIYLVLEYCSRGE 212

Query: 117 LIDFMNTRLQNRLTETEILTIQL--HISQGVA-AMHTLQ-PPLIHRDIKIENVLISNDHK 172
           +       L+       +L  Q    I +GV   +  L    +IHRDIK  N+L++ D  
Sbjct: 213 VKWCPGDVLETEARGPPLLNFQRTREIIRGVVLGLEYLHYQGVIHRDIKPANLLMAEDGT 272

Query: 173 YKLCDFGSVSGYIRPPKTPEELAYVRHDIMMST--TAQYRAPEML--------------D 216
            K+ DFG VS   R P     L  +    +  T  T  + APE+               D
Sbjct: 273 VKISDFG-VSLAARDPNGDANLESLDELELAKTAGTPAFFAPEICLGEEAFEKFSIDRSD 331

Query: 217 LTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-----------------NGGV 259
           L KG SV+   DIWALGV LY L +   PF    E  +                  N GV
Sbjct: 332 LFKGSSVSFMIDIWALGVTLYCLLFGMLPFISDYELELFEKIVNQPLTCPSFQNLNNNGV 391

Query: 260 EFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
                    D    L+  +L K+PL R  I +I
Sbjct: 392 SHISSKEEYDLAVDLLTRLLKKSPLDRIGIQEI 424

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 114/260 (43%), Gaps = 42/260 (16%)

Query: 52   MAVLKRVIVPDKSH--------LNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S         +  LR+EV  +K L H   IV Y+       +  D  Y
Sbjct: 1121 MMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDLDHLN-IVQYLGF-----ENKDNIY 1174

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E  I  + + + +G++ +H+    ++HRD+K +
Sbjct: 1175 SLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVLRGLSYLHSRG--ILHRDMKAD 1228

Query: 164  NVLISNDHKYKLCDFG--SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGF 221
            N+L+  D   K+ DFG    S  I          Y   D+ M  T  + APEM+D  +G+
Sbjct: 1229 NLLLDQDGVCKISDFGISRKSNDI----------YSNSDMTMRGTVFWMAPEMVDTKQGY 1278

Query: 222  SVNDKSDIWALGVFLYKLCYYTTPF---EQTGEAGILNGGVEFPPYPH-----YSDAVKQ 273
            S   K DIW+LG  + ++     P+   E       +      PP P       S   +Q
Sbjct: 1279 SA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQDGRQ 1336

Query: 274  LIMSMLAKNPLHRPNIFQII 293
             + S    +P  RP   +++
Sbjct: 1337 FLDSCFEIDPESRPTADKLL 1356

>KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {ON}
           similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 734

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 321 GPQDFEVLRLLGKGTFGQVY--QVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIGERNILV 378

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    +       +++L+ ++ S G L  F + + + R TE    
Sbjct: 379 RTASKSSPFIVGLKFSFQTPT-------DLYLVTDFMSGGEL--FWHLQKEGRFTEDRA- 428

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 429 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 479

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 480 ---RTNTFCGTT-EYLAPELLMDETGYT--KMVDFWSLGVLIFEMCCGWSPFFASDNQKM 533

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 534 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 568

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 126/269 (46%), Gaps = 41/269 (15%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYID 90
           G Y  +Y A     DQ +      +K +   ++  L+    E+D +K L+H   IV Y  
Sbjct: 28  GAYGVVYKAVNKATDQVIA-----IKAIEYQNEEELHEHMLEIDLLKNLRHEN-IVKY-- 79

Query: 91  SHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHT 150
            H     ++  ++E+++++EYC RG L D +    +  L+E +    ++++ Q V  +  
Sbjct: 80  -HG----FIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKA---KVYVKQTVRGLQY 128

Query: 151 LQPP-LIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQY 209
           L    +IHRDIK  N+L++ +   KL DFG VS  +    T   + Y       + +  +
Sbjct: 129 LHDQGVIHRDIKAANLLLTENGIVKLADFG-VSTRV----TNMAMTY-------AGSPNW 176

Query: 210 RAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE----QTGEAGILNGGVEFPPYP 265
            APE++ L KG S    SDIW+LG  + +L     PF     +     I+N  V +PP  
Sbjct: 177 MAPEVM-LGKGAST--VSDIWSLGATVVELLTGNPPFHNLVNEAACYAIVN-DVYYPP-E 231

Query: 266 HYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           H S   K  I     KN   RP   Q++Q
Sbjct: 232 HLSTQCKNFIERCFQKNMFKRPQAHQLLQ 260

>SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} highly
           similar to uniprot|Q75BF3 Ashbya gossypii ADL389W
           ADL389Wp and similar to YHR205W uniprot|P11792
           Saccharomyces cerevisiae YHR205W SCH9 protein kinase
           involved in growth control may be redundant with cAMP
           pathway cAMP-dependent protein kinase homolog suppressor
           of cdc25ts
          Length = 722

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 309 GPQDFEVLRLLGKGTFGQVY--QVKKKDTRRIYAMKVLSKKVIVKKNEIAHTIGERNILV 366

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    S       +++L+ ++ S G L  F + + + R TE    
Sbjct: 367 RTASKSCPFIVGLKFSFQTPS-------DLYLVTDFMSGGEL--FWHLQKEGRFTEDRA- 416

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 417 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKAELKD------- 467

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 468 ---RTNTFCGTT-EYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 521

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 522 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 556

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 134/288 (46%), Gaps = 45/288 (15%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K L +G +  +  A+ +  D+ +   + +LK+ +  +   L  L  E+  ++RL HH  I
Sbjct: 51  KTLGAGSFGVVRQAKKLSTDENVAVKI-ILKKALKGNDVQLQMLYDELSILQRL-HHPNI 108

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGV 145
           V + D   +K ++       +++ +  + G L D +  R   + TE + + I + + + +
Sbjct: 109 VQFKDWFESKEKF-------YIVTQLATGGELFDRILKR--GKFTEVDAVKIIIQMLKAI 159

Query: 146 AAMHTLQPPLIHRDIKIENVLI---SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
             +H+    ++HRD+K ENVL    S+D +  + DFG      +  K  ++L +      
Sbjct: 160 EYIHSQN--IVHRDLKPENVLYIDPSDDSQLVIADFGIA----KELKDGDDLIF-----K 208

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYK-LCYYTTPFEQTGEAGILNGG--- 258
            + +  Y APE+L  T G       DIW+LGV  Y  LC Y+    +T E G L      
Sbjct: 209 AAGSLGYVAPEVL-TTNGHG--KPCDIWSLGVITYTLLCGYSAFIAETVE-GFLEECTSN 264

Query: 259 ---VEF--PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLN 301
              V+F  P + + S   K+ I+  L  NP  RP       T ++LLN
Sbjct: 265 IYPVKFHEPYWNNVSREAKEFILKALTLNPDERP-------TATELLN 305

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 115/262 (43%), Gaps = 48/262 (18%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           +K  L  L  E+  +K+L +HK+IV+ ID    K+ ++       LIMEYCS G L   +
Sbjct: 171 NKKILENLEIEISILKKL-NHKHIVNLIDCQRNKNDFL-------LIMEYCSLGDLTFLI 222

Query: 122 NTR--------LQNRLTET-----------EILTIQLHISQGVAAMHTLQPP-LIHRDIK 161
             R        L N++ +             I  +  ++ Q  +A+  L+   LIHRDIK
Sbjct: 223 KKRNELIINHPLLNQIFQKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIK 282

Query: 162 IENVLISNDH-----KYKLCDFGSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYR 210
            +N+L+S  +     +      G +     P     +  + R          +  +  Y 
Sbjct: 283 PQNLLLSTPYTDYHDQQTFKKLGYIGISCLPILKIADFGFARFLPNTSLAETLCGSPLYM 342

Query: 211 APEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPY 264
           APE+L+  K    N K+D+W++G  LY++ Y   PF+      +L      N  + FP Y
Sbjct: 343 APEILNYQK---YNAKADLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSY 399

Query: 265 PHYSDAVKQLIMSMLAKNPLHR 286
               D +K LI  +L  +P+ R
Sbjct: 400 IEIDDDMKFLISRLLKFDPIKR 421

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 126/290 (43%), Gaps = 42/290 (14%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            IL+ +  G Y ++ +  I   ++++     + K  I+ D       L T+ +E+  M  L
Sbjct: 1153 ILQKMGEGAYGKV-NLCIHKKEKYIVCIKMIFKERILVDTWVRDRKLGTIPSEIQIMATL 1211

Query: 80   --KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILT 136
              K H+ I+  +D     + Y       ++        G ID  +    +  +TE E   
Sbjct: 1212 NKKPHENILRLLDFFEDDNYY-------YIETPIHGETGCIDLFDLIEFKTNMTEFEAKL 1264

Query: 137  IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
            I   +  G+  +H     ++HRDIK ENV++ +    K+ DFGS              AY
Sbjct: 1265 IFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVKIIDFGSA-------------AY 1309

Query: 197  VR---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEA 252
            V+    D+ + T   Y APE+L    G     K  DIWALG+ LY + +   PF    E 
Sbjct: 1310 VKSGPFDVFVGTI-DYAAPEVL---SGEPYEGKPQDIWALGILLYTIVFKENPFYNIDE- 1364

Query: 253  GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNV 302
             IL G ++F      ++   +LI  +L +   +RP I +I     K L+V
Sbjct: 1365 -ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFD--DKWLDV 1411

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 122/279 (43%), Gaps = 38/279 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            +L+ +  G Y ++    +   D+++     + K  I+ D       L T+ +E+  M  L
Sbjct: 955  VLQKMGEGAYGKV-DLCMHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATL 1013

Query: 80   --KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTI 137
              K H+ I+  +D       + D  Y       + + G +  F    ++  +TE E + I
Sbjct: 1014 NAKPHENILMLLDF------FEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLI 1067

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               I+ G+  +H     ++HRDIK ENV++  +   K+ DFGS              AYV
Sbjct: 1068 FKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSA-------------AYV 1112

Query: 198  R---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAG 253
            +    D+ + T   Y APE+L    G     K  DIWA+GV LY + Y   PF    E  
Sbjct: 1113 KSGPFDVFVGTI-DYAAPEVL---GGEPYEGKPQDIWAIGVLLYTIIYKENPFYNIDE-- 1166

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            IL+  +        SD    LI  +L ++   RP+I +I
Sbjct: 1167 ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 112/260 (43%), Gaps = 18/260 (6%)

Query: 37  YSAQIMPADQFLGTNMAV--LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAA 94
           YS  ++   +  G   AV  L +  +  +  +  +  E +A++RL + + IV    +   
Sbjct: 178 YSTVMLATSKESGKKYAVKVLSKEYLIRQKKVKYVNIEKNALQRLNNSRGIVKLYFTFQD 237

Query: 95  KSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPP 154
           +S        ++ ++EY   G  +  M  +    L E         I   +  +H+    
Sbjct: 238 ESS-------LYFLLEYAPNGDFLSIM--KKYGSLNEDCACYYSAQIIDAIDFLHSKG-- 286

Query: 155 LIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEM 214
           ++HRDIK EN+L+  D K KL DFG+       P T +    +        TA+Y +PE+
Sbjct: 287 IVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPEL 346

Query: 215 LDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVEFPPYPHYSDAVK 272
           L+      V+ + DIWA G  L+++     PF+ T E         V++     +   V+
Sbjct: 347 LNDN---YVDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVVR 403

Query: 273 QLIMSMLAKNPLHRPNIFQI 292
            L+  +L K P  R  I QI
Sbjct: 404 DLVKGILIKQPAQRLTIPQI 423

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 136/299 (45%), Gaps = 43/299 (14%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K L +G +  +  A+    D+ +   + +LKR +  D+  LN L  E+  +++L  H +I
Sbjct: 58  KTLGAGAFGVVRQARNSNNDEDVAVKI-LLKRALKGDE--LNMLYDELMILQKL-DHPHI 113

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGV 145
           V + D   +K ++       +++ +  + G L D +  +   R TET+ + I + + + +
Sbjct: 114 VKFKDWFESKDKF-------YIVTQLATGGELFDRILKK--GRFTETDAVKIVVQMLEAI 164

Query: 146 AAMHTLQPPLIHRDIKIENVLI---SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
             MH+    ++HRD+K ENVL    S+D +  + DFG            ++L+   H I 
Sbjct: 165 EYMHS--KNVVHRDLKPENVLYLNPSDDSELVISDFG----------IAKQLSSEDHLIH 212

Query: 203 MSTTAQ-YRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG---- 257
            +  +  Y APE+L  T G       DIW+LGV  Y L    +PF      G L      
Sbjct: 213 RAAGSMGYVAPEVL-TTSGH--GKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRS 269

Query: 258 --GVEF--PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ---TVSKLLNVNCPIPNI 309
              V F  P +   S   K+ I+  L  +P  RP   +++Q    +SK  N    +P I
Sbjct: 270 KYPVTFHKPYWNSISVEAKEFILKALTLDPSERPTATELLQDTWIISKQQNTEDLLPTI 328

>Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180W
           (APG1) - Protein kinase [contig 211] FULL
          Length = 872

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 127/297 (42%), Gaps = 55/297 (18%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAV--LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSY 88
           G +A +Y  +I  +++ L   +A+  + R  + +K  L  L  E+  +K++KH  +IV  
Sbjct: 29  GSFATVYKGRIA-SNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKKIKH-PHIVGL 86

Query: 89  IDSHAAKSQYMDGTYEVFLIMEYCS----------RGGLID---FMNTRLQ--------- 126
           +D     + +       FLIMEYC+          RGGLI+    + T  +         
Sbjct: 87  MDCERTGADF-------FLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSESH 139

Query: 127 NRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISN-----DHKYKLCDFGSV 181
           N L    +++    +S   A M      L+HRDIK +N+L+S        +      G V
Sbjct: 140 NGLNRVVVVSYLQQLSS--ALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFV 197

Query: 182 SGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVF 235
             Y  P     +  + R          +  +  Y APE+LD  K    N K+D+W++G  
Sbjct: 198 GIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILDYQK---YNAKADLWSVGTV 254

Query: 236 LYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
           LY++C    PF+ +    +       N  + FP +      +++LI  +L  +P  R
Sbjct: 255 LYEMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPSQR 311

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 121/282 (42%), Gaps = 40/282 (14%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            +L+ +  G Y ++    +   D+++     + K  I+ D       L T+ +E+  M  L
Sbjct: 971  VLQKMGEGAYGKV-DLCMHKKDKYIVVIKRIYKERILVDTWVRDRTLGTIPSEIQIMVTL 1029

Query: 80   --KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILT 136
              K H+ I+  +D       Y       +L  E     G ID  +   L+  +TE E   
Sbjct: 1030 NRKPHENILRILDFFEDDDYY-------YLETEMHGETGSIDLFDLIELKTNMTEFEAKL 1082

Query: 137  IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
            +   ++ G+  +H     ++HRDIK ENV++ N    KL DFGS              AY
Sbjct: 1083 LFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSA-------------AY 1127

Query: 197  VR---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEA 252
            V+    D+ + T   Y APE+L    G     K  DIWA+GV LY + Y   PF    E 
Sbjct: 1128 VKSGPFDVFVGTI-DYAAPEVL---GGEPYEGKPQDIWAIGVLLYTIIYKENPFYNIDE- 1182

Query: 253  GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             IL+G +        S     LI  +L ++   RP I  I++
Sbjct: 1183 -ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIME 1223

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 101/204 (49%), Gaps = 32/204 (15%)

Query: 52   MAVLKRVIVP-----DKSHLNT---LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP     D++ L+T   LR+EV  +K L H   IV Y+          +  +
Sbjct: 1300 MMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDLDHLN-IVQYLG--------FENDH 1350

Query: 104  EVF-LIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKI 162
            +++ L +EY   G +   +  RL  R  E  I  + + + +G+A +H+    ++HRD+K 
Sbjct: 1351 DIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAYLHSKG--ILHRDMKA 1406

Query: 163  ENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFS 222
            +N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S
Sbjct: 1407 DNLLLDLDGVCKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYS 1458

Query: 223  VNDKSDIWALGVFLYKLCYYTTPF 246
               K DIW+LG  + ++     P+
Sbjct: 1459 A--KVDIWSLGCVVLEMFAGKRPW 1480

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 97/198 (48%), Gaps = 29/198 (14%)

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           +V++  EYC    L D +   LQ R+  +  + +   I   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGF 221
           N+L+  +   KL DF    G+ R   T   L  +        T  Y APE++  +   GF
Sbjct: 159 NILLDKNGNAKLTDF----GFTRECMTKTSLETI------CGTTVYMAPELIKRESYDGF 208

Query: 222 SVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNGGVEFPPYPH--YSDAVKQLI 275
            +    DIW+LGV LY +   + PF++  E      I+N   E P +     S+  K L+
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMN---EMPVFNDTILSEDAKDLL 261

Query: 276 MSMLAKNPLHRPNIFQII 293
           + +L+K+P  RP++ +I+
Sbjct: 262 IKLLSKDPNERPSMQEIL 279

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 121/295 (41%), Gaps = 47/295 (15%)

Query: 5   HIPKYEPGTTVTVGSHSVHILKY-LTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDK 63
            I  ++ G T+ +GS     L Y  T+G  A I   +++    F  +N+  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI---KVISKTIFQDSNVTSMVDNTTPDA 70

Query: 64  SHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNT 123
                 R E+  MK L H   +  Y           +    +++++EY  +G L + +  
Sbjct: 71  LPYGIER-EIVIMKLLNHANVLRLY--------DVWETNSNLYMVLEYAEKGELFNLLVE 121

Query: 124 RLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSG 183
           R    L E E +     I  G++  H L   ++HRD+K EN+L+   +  K+ DFG    
Sbjct: 122 R--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDTKYNIKIADFGMA-- 175

Query: 184 YIRPPKTPEELAYVRHDIMMSTTA---QYRAPEMLDLT--KGFSVNDKSDIWALGVFLYK 238
                      A    D ++ T+     Y APE++      GF+    SD+W+ GV LY 
Sbjct: 176 -----------ALETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----SDVWSCGVILYA 220

Query: 239 LCYYTTPFEQTGEAGILN-------GGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
           L     PF++  +  I N       G  E P     S   + LI  +L  NP  R
Sbjct: 221 LLTGRLPFDEE-DGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 97/195 (49%), Gaps = 23/195 (11%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           V++ +EYC    L +++  + +  L E   L  Q  I   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLIKKRIPLDECSHLFSQ--IVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLT--KGFS 222
           +L+    + KL DF    G+ R   T   L  V        T  Y APE+++    +G+ 
Sbjct: 159 ILLDKKGQAKLTDF----GFTRECATKGILETV------CGTTVYMAPELIERKPYEGYK 208

Query: 223 VNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPY--PHYSDA-VKQLIMSML 279
           +    D W+LG+ LY + +   PF++  +       V   P+   ++ DA  K LIM +L
Sbjct: 209 I----DTWSLGIILYTMIHGAMPFDEEDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQLL 264

Query: 280 AKNPLHRPNIFQIIQ 294
            K+P  RP++ Q++Q
Sbjct: 265 QKDPSQRPSLTQVLQ 279

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 100/203 (49%), Gaps = 30/203 (14%)

Query: 52   MAVLKRVIVP-----DKSHLNT---LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP     D++ ++T   LR+EV  +K L H   IV Y+       +  D  Y
Sbjct: 1239 MMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHLN-IVQYLGF-----ENKDNIY 1292

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E  I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1293 SLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLRGLAYLHSRG--ILHRDMKAD 1346

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1347 NLLLDQDGVCKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1398

Query: 224  NDKSDIWALGVFLYKLCYYTTPF 246
              K DIW+LG  + ++     P+
Sbjct: 1399 --KVDIWSLGCIVLEMFAGKRPW 1419

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 110/236 (46%), Gaps = 39/236 (16%)

Query: 72  EVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTE 131
           E++A+K L H   +   ++     S+Y      + +++EY S G    ++  + + RL E
Sbjct: 99  EINALKHLTHPNIV--KLEEVLQNSKY------IGIVLEYASGGEFYRYI--QRKRRLKE 148

Query: 132 TEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTP 191
           T    +   +  GV  MH+    L+HRD+K+EN+L+       + DFG V+ +++     
Sbjct: 149 TAGCRLFTQLVSGVNYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKD---- 202

Query: 192 EELAYVRHDIMMSTTAQ--YRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE-- 247
                  +D+M ++     Y APE++  TK +    K+DIW+ G+ LY +     P++  
Sbjct: 203 -------NDLMKTSCGSPCYAAPELVISTKPYEAR-KADIWSCGIILYAMLAGYLPWDDD 254

Query: 248 -QTGEAG--------ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            Q  E          I    ++FP Y   S   + L+  +L  +P  R NI QI Q
Sbjct: 255 PQNPEGDDIARLYYFITRTSLKFPEY--ISPIPRDLLRRLLVSDPRKRLNIRQIQQ 308

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 135/308 (43%), Gaps = 52/308 (16%)

Query: 23  HILKYLTSGGYAQIYSAQIM-----PADQFLGTNMAVLKRVIVPDKSH--LNTLRAEVDA 75
            +L+ +  G +  +Y A  +     P D  +  N+ +  + I  + S+  ++ L  E+  
Sbjct: 8   QLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEHSNEPIDLLLKEIYF 67

Query: 76  MKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           +  L H  YI  Y  +         G   ++++MEYCS G L++ +  R  +RLTE    
Sbjct: 68  LSTL-HCPYITHYYGTFT-------GDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQTTC 117

Query: 136 TIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELA 195
            I L +   +  +H  +  LIHRD+K  N+L+++D + +L D G V+G ++   T     
Sbjct: 118 FIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLG-VTGQLKFNST----- 169

Query: 196 YVRHDI----MMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGE 251
             RH          T  + APE++   K  S + K DIW+LG+   +L     P      
Sbjct: 170 --RHGGKNLNTFVGTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPMSHLDS 224

Query: 252 AGILNGGVEFPPYPHYSDAV----------KQLIMSMLAKNPLHRPNIFQIIQTVSKLLN 301
              L   +  P     +D++          K  I S L ++P  RP   Q++Q   K L 
Sbjct: 225 MKAL---MRIPKL--NADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQ--HKWLK 277

Query: 302 VNCPIPNI 309
             C I NI
Sbjct: 278 -KCSITNI 284

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 122/280 (43%), Gaps = 40/280 (14%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            IL+ +  G Y ++    +   +Q++     + K  I+ D       L T+ +E+  M  L
Sbjct: 1016 ILQKMGEGAYGKV-DLCMHKVEQYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATL 1074

Query: 80   --KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTI 137
              K H+ I++ +D       + D  Y       +   G +  F    L+  +TE E   I
Sbjct: 1075 NKKPHENILTLLDF------FEDDDYYYIETPMHGETGSIDLFDLIELKTNMTEHEAKLI 1128

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               ++ G+  +H     ++HRDIK EN+++ N    KL DFGS              AYV
Sbjct: 1129 FKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSA-------------AYV 1173

Query: 198  R---HDIMMSTTAQYRAPEML--DLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA 252
            +    D+ + T   Y APE+L  D  +G       DIWA+GV LY + +   PF    E 
Sbjct: 1174 KSGPFDVFVGTI-DYAAPEVLGGDPYEG----KPQDIWAIGVLLYTIIFKENPFYNIDE- 1227

Query: 253  GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
             IL+G +        S+    LI  +L ++   RP I +I
Sbjct: 1228 -ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 114/258 (44%), Gaps = 38/258 (14%)

Query: 52   MAVLKRVIVPDKSH--------LNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S         ++ +++EV  +K L H   IV Y+       +  D  Y
Sbjct: 1279 MMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDLDHLN-IVQYLGF-----ENKDNIY 1332

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E  I  + + + +G+A +H     ++HRD+K +
Sbjct: 1333 SLFL--EYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLRGLAYLHARG--ILHRDMKAD 1386

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1387 NLLLDQDGVCKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1438

Query: 224  NDKSDIWALGVFLYKLCYYTTP---FEQTGEAGILNGGVEFPPYPH-----YSDAVKQLI 275
              K DIW+LG  + ++     P   FE       +      PP P       S   ++ +
Sbjct: 1439 --KVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTLPLISAEGREFL 1496

Query: 276  MSMLAKNPLHRPNIFQII 293
             +    +P  RP   +++
Sbjct: 1497 DACFEIDPDKRPTADELL 1514

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 95/203 (46%), Gaps = 30/203 (14%)

Query: 52   MAVLKRVIVPDKSHLN--------TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S  N         LR+EV  +K L H   IV Y+      S Y     
Sbjct: 1206 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLN-IVQYLGFENKNSIYS---- 1260

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
               L +EY + G +   +  R+  R  E+ I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1261 ---LFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHSKG--ILHRDMKAD 1313

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1314 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1365

Query: 224  NDKSDIWALGVFLYKLCYYTTPF 246
              K DIW+LG  + ++     P+
Sbjct: 1366 --KVDIWSLGCIVLEMFAGKRPW 1386

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 128/286 (44%), Gaps = 44/286 (15%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVD 74
           + VG++   ILK +  G + ++Y A   P  +       VLK     DK+  N +R EV 
Sbjct: 36  IEVGNY--RILKQIGEGSFGKVYLALHRPTHR-----KVVLK---TSDKNDPNIVR-EV- 83

Query: 75  AMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEI 134
                 H ++   YI       + +    +V++ +EYC    L D +      R+   E 
Sbjct: 84  ----FYHRQFDYPYI---TKVYEIIVTETKVWMALEYCPGKELYDHL--LFSKRIPIAEC 134

Query: 135 LTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             +   I   V   H+L    +HRD+K+EN+L+    + KL DFG    + R   T   L
Sbjct: 135 TELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFG----FTRECMTRSTL 188

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTK--GFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA 252
             V        T  Y APE+++     GF +    DIWALGV LY + Y   PF++  E 
Sbjct: 189 ETV------CGTTVYMAPELIERKSYDGFKI----DIWALGVILYTMIYGAMPFDEDDEV 238

Query: 253 ----GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
                I+N   +F      +D VK LI  +L K+P  RP I +I++
Sbjct: 239 KTKWKIVNEDPDFTNNISSND-VKDLIKKLLKKDPTERPTIREILK 283

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 100/192 (52%), Gaps = 16/192 (8%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++++ME+C  G   D +    ++RL+E ++  I   +  G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVN 224
           +L+++D + KL DFG VSG I        +A ++    +  T  + APE++   K    N
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQI--------MATLKRTTFVG-TPYWMAPEII-AKKDNGYN 216

Query: 225 DKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPP--YPHYSDAVKQLIMSMLAK 281
           +K+DIW+LG+   +L     P+ +     +L N  +  PP     ++ + +  I   L K
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK 276

Query: 282 NPLHRPNIFQII 293
           +P  RP+  +++
Sbjct: 277 DPDLRPSAAELL 288

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 86/190 (45%), Gaps = 10/190 (5%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++ ++EY   G  +  M  +    L E         I  G+  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVN 224
           +L+    K KL DFG+     R   T EE            TA+Y +PE+L+ +    V+
Sbjct: 334 ILLDKSMKVKLTDFGTAKLLNRKDGT-EEYDLTTRSKSFVGTAEYVSPELLNDS---WVD 389

Query: 225 DKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVEFPPYPHYSDAVKQLIMSMLAKN 282
            K DIWA G  L+++     PF+ T E         V++     +   V+ L+  +L K 
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMVVRDLVKQILVKK 449

Query: 283 PLHRPNIFQI 292
           P HR  I QI
Sbjct: 450 PEHRLTIPQI 459

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 105/213 (49%), Gaps = 35/213 (16%)

Query: 47   FLGTN-----MAVLKRVIVP-----DK---SHLNTLRAEVDAMKRLKHHKYIVSYIDSHA 93
            +LG N     M  +K+V VP     D+   S +  LR+EV  +K L H   IV Y+    
Sbjct: 1189 YLGLNVTTGEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKNLDHLN-IVQYLGFEN 1247

Query: 94   AKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQP 153
              S Y        L +EY + G +   +  RL  R  E+ I  + + + +G++ +H+   
Sbjct: 1248 KNSIYS-------LFLEYVAGGSVGSLI--RLYGRFDESLIRFLTVQVLRGLSYLHSRG- 1297

Query: 154  PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPE 213
             ++HRD+K +N+L+  D   K+ DFG +S      +   ++ Y   D+ M  T  + APE
Sbjct: 1298 -ILHRDMKADNLLLDLDGVCKISDFG-IS------RKSNDI-YCNSDMTMRGTVFWMAPE 1348

Query: 214  MLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF 246
            M+D  +G+S   K DIW+LG  + ++     P+
Sbjct: 1349 MVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW 1379

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 124/272 (45%), Gaps = 28/272 (10%)

Query: 28  LTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVS 87
           L  G Y+ +  A  + +++     + +L +  +  +  +  +  E + ++RLK+ K I+S
Sbjct: 161 LGDGSYSTVLLATSIESNKKYA--VKILNKEYLIKQKKVKYVNIEKNTLQRLKNTKGIIS 218

Query: 88  YIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAA 147
              +   +S        ++ ++EY   G L+  M  R    + E         I   +  
Sbjct: 219 LYFTFQDES-------SLYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGF 269

Query: 148 MHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMST-- 205
           MH     +IHRD+K EN+L+  D K KL DFG  +  +    + ++L Y   D++  +  
Sbjct: 270 MH--DKGVIHRDLKPENILLDVDMKVKLTDFG--TARLLDSTSEDDLKY---DLLTRSNS 322

Query: 206 ---TAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVE 260
              TA+Y +PE+L+      V+ + DIWA G  L+++     PF+   E         V+
Sbjct: 323 FVGTAEYVSPELLNDN---YVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQ 379

Query: 261 FPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
           F     +   V+ L+ ++L KNP  R  I QI
Sbjct: 380 FAFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}
           Anc_4.384 YHR205W
          Length = 754

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM- 76
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 342 GPSDFEVLRLLGKGTFGQVY--QVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 399

Query: 77  -KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
               K   +IVS   S    +       +++L+ +Y S G L  F + + + R TE    
Sbjct: 400 HSASKTCPFIVSLKFSFQTPT-------DLYLVTDYMSGGEL--FWHLQKEGRFTEDRA- 449

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I+Q V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 450 --KFYIAQLVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 500

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 501 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 554

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 555 YQKIAFGKVKF-PRDILSPEGRSFVKGLLNRNPNHR 589

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
           +V++ +EYC    L D++  + +  L ET  L  Q  I   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQKQRIPLDETSKLFAQ--IVGAVFYAHSLQ--CVHRDLKLE 157

Query: 164 NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGF 221
           N+L+       L DF    G+ R   T  +L  +        T  Y APE++  +   G+
Sbjct: 158 NILLDKQGYAMLTDF----GFTRECATKTQLETI------CGTTVYMAPELIKRESYDGY 207

Query: 222 SVNDKSDIWALGVFLYKLCYYTTPFEQ-----TGEAGILNGGVEFPP-YPHYSDA-VKQL 274
            V    D W+LG+ LY + +   PF++     TG   I+N   E PP    Y++   K L
Sbjct: 208 KV----DTWSLGIILYTMLHGFMPFDEEDPTLTG-LKIMN---EMPPIVDAYTNVHAKDL 259

Query: 275 IMSMLAKNPLHRPNIFQIIQ 294
           I+ +L K P  RP++ ++++
Sbjct: 260 ILKLLRKTPSERPSLNKVLE 279

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 129/295 (43%), Gaps = 35/295 (11%)

Query: 7    PKYEPGTTVTVGSHS-VHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD--- 62
            P+ E G +  V   S   +L+ +  G Y ++    +   ++++     + K  I+ D   
Sbjct: 983  PEREIGASKHVTKFSDFTVLQKMGEGAYGKV-DLCMHKKEKYVVVIKLIFKERILVDTWV 1041

Query: 63   -KSHLNTLRAEVDAMKRL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLID 119
                L T+ +E+  M  L  K H+ I+  +D       + D  Y       +   G +  
Sbjct: 1042 RDRKLGTIPSEIQIMATLNKKPHENIMRLLDF------FEDDEYYYIESPMHGETGSIDL 1095

Query: 120  FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
            F    L+  +TE E   +   ++ G+  +H  +  ++HRDIK ENV++ N  + K+ DFG
Sbjct: 1096 FDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFG 1153

Query: 180  SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEML--DLTKGFSVNDKSDIWALGVFLY 237
            S +   R P           D+ + T   Y APE+L  D  +G       D+WA+GV LY
Sbjct: 1154 SAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEG----KPQDVWAVGVLLY 1198

Query: 238  KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
             + Y   PF    E  IL+G +   P    S+    LI  +L ++   RP +  I
Sbjct: 1199 TIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 32/217 (14%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAV-LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYI 89
           GG A +Y+A        +GTN++V +K++ +  +     +  E+  MK+   H  IV++I
Sbjct: 622 GGSALVYTAY------EVGTNLSVAIKQINLEKQPRKQLILNEIIVMKK-SQHPNIVNFI 674

Query: 90  DSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMH 149
           DS+      +DG  ++++IMEY   G L D +   +   L E +I  +   + +G+  +H
Sbjct: 675 DSY-----LVDG--KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLH 724

Query: 150 TLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQY 209
           +    +IHRDIK +NVL+S D   KL DFG  +             +++ + M+  T  +
Sbjct: 725 S--KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQL--------NDIHLKRNTMVG-TPYW 773

Query: 210 RAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF 246
            APE+++  K +    K DIW+LGV + ++     P+
Sbjct: 774 MAPEIVE-KKHYC--PKVDIWSLGVMIIEMIEGEPPY 807

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 102/229 (44%), Gaps = 27/229 (11%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D   +  ++ E+  +  LK    I  Y  S      Y+  T  +++IMEYC+ G L   +
Sbjct: 80  DSDEVEDVQREIQFLASLKQVPNITRYYGS------YLQDT-NLWIIMEYCAGGSLRTLL 132

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
              +   + E  I  I   +   +  +H  +  +IHRDIK  NVLI+N+ K KLCDFG  
Sbjct: 133 RPGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVA 187

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +          + +  R    M+ T  + APE+  + +G   + K DIW+LG+  Y++  
Sbjct: 188 AQL-------NQTSLRRQ--TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIAT 236

Query: 242 YTTPFEQTGEAGILNGGVEFPPY----PHYSDAVKQLIMSMLAKNPLHR 286
              P+ +      +    +  P       YS  +K+ I   L ++P  R
Sbjct: 237 GNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 118/279 (42%), Gaps = 38/279 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRLK 80
            +L+ +  G Y ++           +   + + +R++V        L T+ +E+  M  L 
Sbjct: 1004 VLQKMGEGAYGKVNLCLHKKKRYIVVIKLIIKERILVDTWVRDRKLGTIPSEIQIMAALN 1063

Query: 81   HH--KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILTI 137
             H    I++ ID       Y       ++        G ID  +   L+  +TE E   I
Sbjct: 1064 KHPDGNILTLIDFFEDDDYY-------YIETPVHGETGCIDLFDLIELKTNMTEYEAKLI 1116

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               +   +  +H+    ++HRDIK ENV++ +    KL DFGS              AYV
Sbjct: 1117 FRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVKLIDFGSA-------------AYV 1161

Query: 198  R---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAG 253
            +    D+ + T   Y APE+L    G   + K  DIWA+GV LY + +   PF    E  
Sbjct: 1162 KSGPFDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIGVLLYTIVFKENPFYNIDE-- 1215

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            IL   ++F      S+    LI  +L KNP  RP I ++
Sbjct: 1216 ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 120/274 (43%), Gaps = 42/274 (15%)

Query: 19  SHSVHILKYLTS-GGYAQIYSAQIMPADQFLGTNM-AVLKRVIVPDKSHLNTLRAEVDAM 76
           +H  + LK +   G Y  +Y A         GTN    +K++   D+S LN    E+D +
Sbjct: 6   AHGTYALKQVIGRGAYGVVYRAVKR------GTNKPCAIKQIEFEDESELNEHMLEIDLL 59

Query: 77  KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILT 136
           K L+H   IV Y         ++   +E+++I+EYC+RG L D +       L E + + 
Sbjct: 60  KNLRHQN-IVEY-------RGFIQKAHELYIILEYCARGSLRDILK---HGPLLEDDTVN 108

Query: 137 IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
                  G+  +H  +  +IHRDIK  N+L++ +   KL DFG VS  I           
Sbjct: 109 YVTQTLYGLQYLH--EQGVIHRDIKAANLLLTEEGIVKLADFG-VSTRIN---------- 155

Query: 197 VRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE----QTGEA 252
            R  +  + +  + APE++    G   +  SDIW+LG  + +L     PF     ++   
Sbjct: 156 -RMAMTYAGSPNWMAPEVM---TGQGASTVSDIWSLGATVVELLTGNPPFHNLVNESACY 211

Query: 253 GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
            I+N   E+ P    S   K  +     KN   R
Sbjct: 212 AIVNE--EYIPPLTLSAECKDFLSRCFQKNMFKR 243

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 120/260 (46%), Gaps = 38/260 (14%)

Query: 49  GTNMAV---LKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEV 105
           G ++AV   +K+ +  +K  L  L  E+D ++RL HH  IV++ D   +K +        
Sbjct: 60  GEDVAVKILIKKALKGNKIQLEALYDELDILQRL-HHPNIVAFKDWFESKDK-------- 110

Query: 106 FLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENV 165
           F I+   ++GG + F     + + TE + + I + I   V  MH+    ++HRD+K EN+
Sbjct: 111 FYIITQLAKGGEL-FDRILKKGKFTEVDAVRILVEILSAVKYMHSQN--IVHRDLKPENL 167

Query: 166 LI---SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFS 222
           L    S++    + DF    G  +  K+ EEL Y       + +  Y APE+L    G  
Sbjct: 168 LYIDKSDESPLVVADF----GIAKRLKSDEELIY-----KPAGSLGYVAPEVL-TQDGHG 217

Query: 223 VNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGV--EFP-----PY-PHYSDAVKQL 274
                DIW+LGV  Y L    + F+       L+     E+P     PY    SD  KQ 
Sbjct: 218 --KPCDIWSLGVITYTLLCGYSAFKAERVQDFLDECTTGEYPVRFHRPYWDSVSDKAKQF 275

Query: 275 IMSMLAKNPLHRPNIFQIIQ 294
           I+  L  +P  RP   Q+++
Sbjct: 276 ILKALNLDPSKRPTAAQLLE 295

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 126/269 (46%), Gaps = 30/269 (11%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYID 90
           G +  +Y A+    D +L   +AV    +   +  +  L  E+  +  LK   Y+ +YI 
Sbjct: 14  GNFGDVYKAK----DTWLNEVVAVKVVNLENSEEEVELLAQEIFFLAELKS-PYVTNYIA 68

Query: 91  SHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHT 150
           +             +++ MEYC  G + D +     + L E +   I   I +G++ +H+
Sbjct: 69  TVVEDVS-------MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHS 121

Query: 151 LQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYR 210
            +   IHRDIK  N+L++++ K KL DFG VSG +        L+  R D  +  T  + 
Sbjct: 122 QRK--IHRDIKAANILLTDEGKVKLSDFG-VSGKL--------LSSFRRDTFVG-TPYWM 169

Query: 211 APEMLDL-TKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL-NGGVEFPPYPH-- 266
           APE++   ++G+  ++++DIW+LG+ + ++   + P  +     ++ N     PP  H  
Sbjct: 170 APEIVAHDSEGY--DERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGD 227

Query: 267 YSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
           +SD  K  +   L K    RP    ++ T
Sbjct: 228 FSDDAKHFVALCLIKESAIRPTAADLLTT 256

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 120/281 (42%), Gaps = 40/281 (14%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            IL+ +  G Y ++ +  I    +++     + K  I+ D       L T+ +E+  M  L
Sbjct: 1124 ILQKMGEGAYGKV-NMCIHKVKKYIVVIKMIFKERILVDTWVRDRQLGTIPSEIQIMATL 1182

Query: 80   --KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILT 136
              K H  I+S +D       Y       ++        G ID  +    +  +TE E   
Sbjct: 1183 NKKPHDNILSLLDFFEDDDYY-------YIETPVHGETGCIDLFDLIEFKTNMTEFEAKL 1235

Query: 137  IQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAY 196
            I   I  G+  +H     ++HRDIK ENV++ +    K+ DFGS              AY
Sbjct: 1236 IFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSA-------------AY 1280

Query: 197  VR---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEA 252
            V+    D+ + T   Y APE+L    G     K  DIWA+G+ LY + +   PF    E 
Sbjct: 1281 VKSGPFDVFVGTI-DYAAPEVL---SGEPYEGKPQDIWAIGILLYTIVFKENPFYNIDE- 1335

Query: 253  GILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
             IL G ++F      S+   +LI  +L ++   RP I +I 
Sbjct: 1336 -ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIF 1375

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 125/299 (41%), Gaps = 37/299 (12%)

Query: 5    HIPKYEPGTTVTVGSHS-VHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD- 62
            H+P+ + G+       S   IL+ +  G Y ++           +   M   +R++V   
Sbjct: 1089 HVPENQIGSQKRTKKFSDFVILQKMGEGAYGKVNLCLHKKKRYIVVIKMIFKERILVDTW 1148

Query: 63   --KSHLNTLRAEVDAMKRLKH--HKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLI 118
                 L T+ +E+  M  L    H+ I+  +D       + D  Y  ++        G I
Sbjct: 1149 VRDRQLGTIPSEIQIMTTLNKSPHENIMQLLDF------FEDDDY-YYIETPLHGETGCI 1201

Query: 119  DFMN-TRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177
            D  +    ++ +TE+E   I + +  G+  +H     ++HRD+K ENV++      KL D
Sbjct: 1202 DLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVKLID 1259

Query: 178  FGSVSGYIRPPKTPEELAYVR---HDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGV 234
            FGS              AYV     D+ + T   Y APE+  L+    +    DIWA+G+
Sbjct: 1260 FGSA-------------AYVNSGPFDVFVGTI-DYAAPEV--LSGEPYLGKPQDIWAIGI 1303

Query: 235  FLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
             LY + +   PF    E  IL   ++       S     LI  +L KNP  RP I +I+
Sbjct: 1304 LLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIV 1360

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 112/258 (43%), Gaps = 38/258 (14%)

Query: 52   MAVLKRVIVPDKSHLN--------TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP  S  N         LR+EV  +K L H   IV Y+       +  +  Y
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLN-IVQYLGF-----ENKNNIY 1253

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  R  E  I  +   + +G+A +H+    ++HRD+K +
Sbjct: 1254 SLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDMKAD 1307

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1308 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSA 1359

Query: 224  NDKSDIWALGVFLYKLCYYTTPF---EQTGEAGILNGGVEFPPYPH-----YSDAVKQLI 275
              K DIW+LG  + ++     P+   E       +      PP P       S   +  +
Sbjct: 1360 --KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFL 1417

Query: 276  MSMLAKNPLHRPNIFQII 293
             +    NP  RP   +++
Sbjct: 1418 DACFEINPEKRPTANELL 1435

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 125/270 (46%), Gaps = 38/270 (14%)

Query: 52  MAVLKRVIVPDKSHLNT-LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIME 110
           + +++R  VP  S     +  E++A+K L H   +   ++     S+Y+       +++E
Sbjct: 77  IKLIRRDTVPKNSDKEVKIYREINALKHLTHPNIV--RLEEVLQNSKYIG------IVLE 128

Query: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170
           Y S G    ++  +   RL E     +   +  GV  MH+    L+HRD+K+EN+L+  +
Sbjct: 129 YASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLENLLLDKN 184

Query: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQ--YRAPEMLDLTKGFSVNDKSD 228
               + DFG V+ +             ++++M ++     Y APE++  TK +    K+D
Sbjct: 185 ENLLITDFGFVNEFNH-----------KNELMKTSCGSPCYAAPELVVTTKPYEAR-KAD 232

Query: 229 IWALGVFLYKLCYYTTPFEQTGE-------AGILNGGVEFP-PYPHYSDAV-KQLIMSML 279
           IW+ GV +Y +     P++   E       A + +   + P  +P Y + V + L+  +L
Sbjct: 233 IWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRDLLRRIL 292

Query: 280 AKNPLHRPNIFQIIQTVSKLLNVNCPIPNI 309
             NP  R N+ Q+ Q   + L  +CP   I
Sbjct: 293 VSNPKKRLNLRQVEQ--HQWLQPHCPFLTI 320

>KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3.177
           YAR019C
          Length = 980

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 117/285 (41%), Gaps = 34/285 (11%)

Query: 7   PKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHL 66
           P  E  T     S    + + +  G Y  +Y A      Q     +  +K +       L
Sbjct: 16  PHQERTTNGKGNSTKYQLNQVIGKGSYGIVYKAVNKSTKQ-----VVAIKEINYTSDEEL 70

Query: 67  NTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQ 126
           N +  E+D +K L HH  IV Y   H     ++     +++I+EY + G L   +++R+ 
Sbjct: 71  NEIMIEIDLLKNL-HHINIVKY---HG----FIQKMSNLYIILEYAAHGSLKGLLSSRIG 122

Query: 127 NRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIR 186
           + L E E          G+A +H  +  +IHRDIK  N+L+ + +  KL DFG  +    
Sbjct: 123 HLLDEAETKIYVRQTLDGLAYLH--EQGVIHRDIKAANLLLDSTNTVKLADFGVSTKVNN 180

Query: 187 PPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF 246
             KT            ++ +  + APE++   KG S    SDIW+LG  + +L     PF
Sbjct: 181 TAKT------------LAGSLNWMAPEIVT-NKGAST--LSDIWSLGATIVELMTGKPPF 225

Query: 247 EQTGEAGIL----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRP 287
               +  I     N    + P     +  KQ +     KN   RP
Sbjct: 226 HNLLDINIYYAMENDNECYYPPASLPEGAKQFLALCFQKNMFKRP 270

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 13/194 (6%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++ ++EY S G L+  +  +      ET  +     I   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLISNDHKYKLCDFGSV----SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKG 220
           +L++ D K KL DFG+            ++      +        TA+Y +PE+  LT  
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPEL--LTDS 447

Query: 221 FSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVEFPPYPHYSDAVKQLIMSM 278
           ++ + + DIWA G  L++L     PF+ T E         +++     +   ++ LI  +
Sbjct: 448 YT-DSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKKI 506

Query: 279 LAKNPLHRPNIFQI 292
           L KNP +R  I QI
Sbjct: 507 LIKNPNNRLTIHQI 520

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 127/275 (46%), Gaps = 28/275 (10%)

Query: 23  HILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
            IL+ +  G +  +Y A+ + +++ +   +  L+    P    ++ L  E+  +  L+  
Sbjct: 21  EILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELRS- 75

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
            YI +Y      K+ ++     ++++MEYC  G   + +    ++++TE +   I   + 
Sbjct: 76  PYITNY------KTAFLVDV-SMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
            G+  +H+ +   IHRDIK  N+L++++   KL DFG VSG         ++   R    
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSG---------QMMVTRKRDT 176

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFP 262
              T  + APE++D  K    N+ +DIW+LG+ + +L     P ++      L    +  
Sbjct: 177 FVGTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRD 235

Query: 263 P---YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
           P      +S   +  +   L K+P  RP   ++++
Sbjct: 236 PPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL180W (APG1)
          Length = 972

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 152/372 (40%), Gaps = 65/372 (17%)

Query: 12  GTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAV--LKRVIVPDKSHLNTL 69
           G  V + +    + K +  G +A +Y   +  AD   G N+A+  + R  + +K  L  L
Sbjct: 8   GRPVAIVAERYVVEKEIGRGSFAVVYKGHL--ADSSAG-NVAIKAVSRSKLRNKKLLENL 64

Query: 70  RAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTR----- 124
             E+  +K++KH  +IV  ++     + +       +L+MEYC+ G L  F+  R     
Sbjct: 65  EIEIAILKKIKH-PHIVGLLECERTGTDF-------YLMMEYCALGDLTFFIKKRRSLMD 116

Query: 125 ---LQNRLTE------------TEILTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLIS 168
              L   L E              +L +  ++ Q  +A+  L+   L+HRDIK +N+L+S
Sbjct: 117 KHPLVRTLFEKYPPPSEHHNGLNRVLVVN-YLQQLSSALKFLRSKNLVHRDIKPQNLLLS 175

Query: 169 NDHKYKLCDF---------GSVSGYIRPPKTPEELAYVRH------DIMMSTTAQYRAPE 213
                 L D+         G V  Y  P     +  + R          +  +  Y APE
Sbjct: 176 T----PLVDYNDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPE 231

Query: 214 MLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHY 267
           +L+  K    N K+D+W++G  LY++C    PF+ +    +       N  ++FP +   
Sbjct: 232 ILNYQK---YNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAAL 288

Query: 268 SDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNTGNM 327
             A+  LI  +L   P  R    +     + L+N +     +    D+     N    NM
Sbjct: 289 ESAMVDLICGLLTFEPAKRMGFTEFFS--NGLVNEDLSPYEVESEPDLETKSKNVAESNM 346

Query: 328 SINGYYKPMNQN 339
            I+ Y     +N
Sbjct: 347 FISEYLPTAERN 358

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 111/247 (44%), Gaps = 22/247 (8%)

Query: 52  MAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEY 111
           + VL +  +  +  +  +  E +A++RL + + IV    +   +S        ++ ++EY
Sbjct: 210 VKVLNKEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESS-------LYFLLEY 262

Query: 112 CSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDH 171
              G  +  M  +    L+E         I  G+  +H+    +IHRDIK EN+L+  D 
Sbjct: 263 APNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHSKG--IIHRDIKPENILLDKDM 318

Query: 172 KYKLCDFGSVSGYIRPPKTPE----ELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS 227
           K K+ DFG+    I  PK  +    E   +        TA+Y +PE+L+ +    V+ + 
Sbjct: 319 KVKITDFGTAK--ILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDS---YVDARC 373

Query: 228 DIWALGVFLYKLCYYTTPFEQTGEAGILNG--GVEFPPYPHYSDAVKQLIMSMLAKNPLH 285
           DIWA G  ++++     PF+ T E         V++     +   V+ L+  +L K P  
Sbjct: 374 DIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQ 433

Query: 286 RPNIFQI 292
           R  I QI
Sbjct: 434 RLTIPQI 440

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 123/280 (43%), Gaps = 38/280 (13%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
           +L+ +  GG+A++ S  +   D+++     V K  ++ +     +    +  E+  M  L
Sbjct: 672 VLQDMGEGGFAKV-SLCLNKEDKYVVVIKKVFKEKVLEETWTSDNKFGNIPREIQIMSTL 730

Query: 80  KHHKY----IVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
             HKY     +  +D    ++ Y   T    L+        L DF+  +  +++ E E  
Sbjct: 731 --HKYPNKNTLRMLDFFEDENFYYIET----LVHSMKGSIDLFDFIEKK--DKIDEVEQK 782

Query: 136 TIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELA 195
            I   I  G+  +H L   +IHRDIK EN++I ++   ++ DFGS +     P       
Sbjct: 783 LIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVIDFGSAAYATNGPFQ----- 835

Query: 196 YVRHDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAGI 254
                 +   T  Y +PE+L   KG     K  D+WALG+ LY + +  TPF    E  I
Sbjct: 836 ------VFHGTIDYASPEVL---KGEPYEGKPQDVWALGILLYIITFKQTPFNSVAE--I 884

Query: 255 LNGGVEFPPY--PHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
           +   +E  P    + SD  + LI  ML K    RP I +I
Sbjct: 885 IENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 93/193 (48%), Gaps = 16/193 (8%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++ ++EY S G L+  +  RL  RLTE     I   +   V  MH+    +IHRD+K EN
Sbjct: 87  LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVDYMHSKG--VIHRDLKPEN 142

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTK-GFSV 223
           VL+S + +  + DFG+            +    +       TA+Y +PE+L  ++ GFS 
Sbjct: 143 VLLSQEGRVVITDFGAAC-----TAADRKFENTKRTASFVGTAEYVSPELLLHSQCGFS- 196

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDA--VKQLIMSMLAK 281
              SDIWALG  +Y+L     PF    E       V       +S++  V  ++ S+L  
Sbjct: 197 ---SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIVQSILVT 253

Query: 282 NPLHRPNIFQIIQ 294
           +PL RP+  Q+ Q
Sbjct: 254 DPLKRPSAAQLKQ 266

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 105/230 (45%), Gaps = 29/230 (12%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D   +  ++ E+  +  LK    I  Y  S      Y+  T  +++IMEYC+ G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGS------YLKDT-SLWIIMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
                 ++ E  I  I   +   +  +H     +IHRDIK  NVLI+N+   KLCDFG V
Sbjct: 112 R---PGKIDEKYIGVIMREVLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFG-V 165

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +  +       + +  R    M+ T  + APE+  + +G   + K DIW+LG+  Y++  
Sbjct: 166 AAQVN------QTSLRRQ--TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEQTGEAGILNGGVEFPPYPH-----YSDAVKQLIMSMLAKNPLHR 286
              P+ +      +   ++  P P      YS ++K+ I   L ++P  R
Sbjct: 216 GNPPYCEVEALRAMQLIIKSKP-PRLEGRSYSPSLKEFIALCLDEDPKER 264

>ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR205W (SCH9)
          Length = 711

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 124/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 300 GPQDFEVLRLLGKGTFGQVY--QVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 357

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV        K  +   T +++L+ ++ S G L  F + + + R TE    
Sbjct: 358 RTASKSCPFIV------GLKFSFQTPT-DLYLVTDFLSGGEL--FWHLQKEGRFTEERA- 407

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 408 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 458

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 459 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 512

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 513 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 547

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 108/231 (46%), Gaps = 27/231 (11%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           ++ E+  +  LK    I  Y  S      Y+ GT  +++IMEYC+ G L   +      +
Sbjct: 59  VQREIQFLASLKQIPNITRYYGS------YLRGT-SLWIIMEYCAGGSLRSLLRP---GK 108

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  I  I   +   +  +H  +  +IHRDIK  NVLI+N+ + KLCDFG  +      
Sbjct: 109 IDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDFGVAAQL---- 162

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
               + +  R    M+ T  + APE+  + +G   + K DIW+LG+  Y++     P+  
Sbjct: 163 ---NQTSLRRQ--TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCD 215

Query: 249 TGEAGILNGGVEFPP----YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
                 +   ++  P      +Y+  +K+ I   L ++P  R +  ++++T
Sbjct: 216 VEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELLKT 266

>AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAR019C
           (CDC15)
          Length = 902

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 122/271 (45%), Gaps = 45/271 (16%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYID 90
           G Y  +Y A     DQ +      +K +   ++  L+    E+D +K LKH   IV Y  
Sbjct: 28  GAYGVVYKAVNRATDQVIA-----IKAIEYENEEELHEHMLEIDLLKNLKHEN-IVKY-- 79

Query: 91  SHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHT 150
            H     ++  ++E+++++EYC RG L D +    +  L+E +  T      +G+  +H 
Sbjct: 80  -HG----FIQSSHELYILLEYCIRGSLRDLIK---KEALSEAKAKTYVRQTLRGLQYLH- 130

Query: 151 LQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTA--- 207
               +IHRDIK  N+L++ +   KL DFG  +               R + M  T A   
Sbjct: 131 -DQGVIHRDIKAANLLLTENGVVKLADFGVST---------------RVNNMAMTYAGSP 174

Query: 208 QYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTGEAGILNGGVEFPP 263
            + APE++ L KG S    SDIW+LG  + +L     PF     +     I+N  V +PP
Sbjct: 175 NWMAPEVM-LGKGAST--VSDIWSLGATVVELLTGNPPFYNLVNEAACYAIVN-DVYYPP 230

Query: 264 YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             H S   K  +     KN   RP   Q++Q
Sbjct: 231 -EHLSAECKAFMELCFQKNMFKRPQAHQLLQ 260

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 115/264 (43%), Gaps = 47/264 (17%)

Query: 47   FLGTN-----MAVLKRVIVP-----DKSHLNTLRA---EVDAMKRLKHHKYIVSYIDSHA 93
            +LG N     M  +K+V VP     D++ L+ L A   EV  +K L H   IV Y+    
Sbjct: 1161 YLGLNVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVN-IVQYLG--- 1216

Query: 94   AKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQP 153
                + +  +   L +EY + G +   +  RL  R  E  I  + + + +G+A +H+   
Sbjct: 1217 ----FENKNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHSKG- 1269

Query: 154  PLIHRDIKIENVLISNDHKYKLCDFG--SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRA 211
             ++HRD+K +N+L+  D   K+ DFG    S  I          Y   D+ M  T  + A
Sbjct: 1270 -ILHRDMKADNLLLDVDGICKISDFGISKKSNNI----------YSNSDMTMRGTVFWMA 1318

Query: 212  PEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTP---FEQTGEAGILNGGVEFPPYPH-- 266
            PEM+D  +G+S   K DIW+LG  + ++     P   FE       +      PP P   
Sbjct: 1319 PEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDT 1376

Query: 267  ---YSDAVKQLIMSMLAKNPLHRP 287
                S   K  + +    +P  RP
Sbjct: 1377 QKLLSAEAKSFLDACFEIDPEKRP 1400

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 142/321 (44%), Gaps = 51/321 (15%)

Query: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMA--VLKRVIV--PDKS 64
           Y+P +   + +H   I+K L +G + ++  A+ + A+Q +   M     K+     P ++
Sbjct: 81  YDPVSKTQILNH-YEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAGPKRN 139

Query: 65  HLNTLRAEVDAMKRL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF-- 120
             N ++ E+  MK+   KH   ++  +D  +++        +++L++EYC +G ++    
Sbjct: 140 DPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSR--------KIYLVLEYCEKGPILWCPR 191

Query: 121 ----MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLC 176
               +++R   +L+      I   +  G+  +H+    +IHRDIK  N+L+  +   K+ 
Sbjct: 192 DQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVVKIS 249

Query: 177 DFG---SVSGYIRPPKTPEEL-------AYVRHDIMMSTTAQYRAP-EMLDLTKGFSVND 225
           DFG   + +G I       EL        +   +I +   A  R   +  +L  G  ++ 
Sbjct: 250 DFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISF 309

Query: 226 KSDIWALGVFLYKLCYYTTPFEQTGE----AGILNGGVEFPPYPHYSDA----------- 270
           K DIWALG+ LY L +   PF    E      I+N  + FP +    D            
Sbjct: 310 KIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREF 369

Query: 271 --VKQLIMSMLAKNPLHRPNI 289
              K L+  +L KNP  R +I
Sbjct: 370 VHAKDLLNKLLEKNPAKRISI 390

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 121/283 (42%), Gaps = 38/283 (13%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD----KSHLNTLRAEVDAMKRL 79
            IL+ +  G Y ++ +  +   ++++     + K  I+ D       L T+ +E+  M  L
Sbjct: 979  ILQKMGEGAYGKV-NLCLHKKERYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMAVL 1037

Query: 80   KHH--KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTI 137
              H  + I+  +D       + D  Y       +   G +  F    L+  +TE E   I
Sbjct: 1038 NKHPDENILRLLDF------FEDDDYYYIETPVHGETGSIDLFDLIELKTNMTEFEAKLI 1091

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
               +  G+  +H  +  ++HRDIK ENV++ +    KL DFGS              AYV
Sbjct: 1092 FKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFGSA-------------AYV 1136

Query: 198  R---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWALGVFLYKLCYYTTPFEQTGEAG 253
            +    D+ + T   Y APE+L    G     K  DIWA+G+ LY + +   PF    E  
Sbjct: 1137 KSGPFDVFVGTI-DYAAPEVLG---GEPYEGKPQDIWAVGILLYTIVFKENPFYNIDE-- 1190

Query: 254  ILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296
            I+ G ++F      S+    LI  +L KN   RP I  I   V
Sbjct: 1191 IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 97/203 (47%), Gaps = 30/203 (14%)

Query: 52   MAVLKRVIVPDK--------SHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP          S +  LRAEV  +K L H   IV Y+       +  D  Y
Sbjct: 1207 MMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDLDHLN-IVQYLGF-----EVKDSIY 1260

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
             +FL  EY + G +   +  R+  +  E  I  + + + +G++ +H+    ++HRD+K +
Sbjct: 1261 SLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSYLHSRG--ILHRDMKAD 1314

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DF    G  R  K      Y   ++ M  T  + APEM+D  +G+S 
Sbjct: 1315 NLLLDQDGVCKISDF----GISRKSKD----IYSNSEMTMRGTVFWMAPEMVDTKQGYSA 1366

Query: 224  NDKSDIWALGVFLYKLCYYTTPF 246
              K DIW+LG  + ++     P+
Sbjct: 1367 --KVDIWSLGCVVLEMFAGKRPW 1387

>CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa]
           {ON} similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019c CDC15
          Length = 1076

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 117/268 (43%), Gaps = 38/268 (14%)

Query: 31  GGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYID 90
           G Y  +Y A      Q        +K V   D   L  + +E+D +K L H    ++ + 
Sbjct: 31  GSYGVVYKATNKKTAQ-----EVAIKEVNYQDDDELVDIMSEIDLLKNLNH----INIVK 81

Query: 91  SHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR-LTETEILTIQLHISQGVAAMH 149
            H     ++   + +++I+EYC++G L + ++   +NR ++E E          G+  +H
Sbjct: 82  YHG----FIQKQHNLYIILEYCAKGSLKNLIS---RNRPMSEHEAKPYVRQTLNGLNYLH 134

Query: 150 TLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQY 209
             +  +IHRDIK  N+L+ +++  KL DFG  +       T            ++ +  +
Sbjct: 135 --EQGVIHRDIKAANILLDSENVVKLADFGVSTKVNNTAMT------------LAGSLNW 180

Query: 210 RAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI---LNGGVEFPPYPH 266
            APE++   +G S    SDIW+LG  + +L     PF    +  I   +     FPP   
Sbjct: 181 MAPEIIG-NRGAST--LSDIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPP-SS 236

Query: 267 YSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
            S   K  +    AKN   RP   Q++Q
Sbjct: 237 LSSGAKDFLQQCFAKNMYKRPTAVQLLQ 264

>CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} similar
           to uniprot|P11792 Saccharomyces cerevisiae YHR205w SCH9
           serine/threonine protein kinase
          Length = 746

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 122/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM- 76
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 336 GPQDFEVLRLLGKGTFGQVY--QVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 393

Query: 77  -KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
               K   +IV    S    +       +++L+ +Y S G L  F + + + R TE    
Sbjct: 394 TTSSKASPFIVGLKFSFQTPT-------DLYLVTDYMSGGEL--FWHLQREGRFTEDRA- 443

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 444 --KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 494

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 495 ---RTNTFCGTT-EYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFYAEDNQKM 548

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 549 YQKIAFGKVKF-PRDILSPEGRSFVKGLLNRNPKHR 583

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 114/278 (41%), Gaps = 36/278 (12%)

Query: 24   ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD---KSHLNTLRAEVDAMKRL- 79
            IL+ +  G Y ++           +   M   +R++V        L T+ +E+  M  L 
Sbjct: 1039 ILQKMGEGAYGKVNLCLHKKKKYIVVIKMIFKERILVDTWVRDRQLGTILSEIQIMSTLN 1098

Query: 80   KH-HKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN-TRLQNRLTETEILTI 137
            KH H  I+  +D       Y       ++        G ID  +    +  ++E E   I
Sbjct: 1099 KHPHDNILRLLDFFEDDDYY-------YIETPMHGETGCIDLFDLIEFKTNMSEVETKLI 1151

Query: 138  QLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYV 197
             + +   +  +H     ++HRDIK ENV++ +    KL DFGS              AYV
Sbjct: 1152 FMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIKLIDFGSA-------------AYV 1196

Query: 198  R---HDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGI 254
            +    D+ + T   Y APE+L       V    DIWA+G+ LY + +   PF    E  I
Sbjct: 1197 KSGPFDVFVGTI-DYAAPEVLGGEP--YVGKPQDIWAIGILLYTIIFKENPFYNIDE--I 1251

Query: 255  LNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            L   ++F       +    LI  +L +NP  RP I +I
Sbjct: 1252 LEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 aa]
           {ON} (152877..153692,153695..156046) [3168 nt, 1056 aa]
          Length = 1055

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 118/267 (44%), Gaps = 53/267 (19%)

Query: 67  NTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG--TYEVFLIMEYCSRGGLIDFMNTR 124
           N ++ E+  MK+  H+K++V  I       + +D   + +++L++EYC++G +      +
Sbjct: 202 NKIKREIAIMKKC-HNKHVVKLI-------EVLDDLESKKIYLVLEYCAKGEVKWCPGDQ 253

Query: 125 LQNRLTETEILTIQLH-----ISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179
           L+       +LT +       +  G   +H  +  +IHRDIK  N+L S D   K+ DFG
Sbjct: 254 LETEARGPPLLTFKDQEKIRGVILGYGYLHYQE--IIHRDIKPANLLFSEDGTVKISDFG 311

Query: 180 SVSGYIRPPKTPEELAYVRHDIMMST--TAQYRAPEML--------------DLTKGFSV 223
            VS       +      V    +  T  T  + APE+               +L KG  +
Sbjct: 312 -VSMAASGSSSNGSSESVDEVELAKTAGTPAFFAPEICLGNEAITKYNLNKNELFKGSCI 370

Query: 224 NDKSDIWALGVFLYKLCYYTTPFEQTGE----AGILNGGVEFPPYPH------------- 266
           +   DIWA+GV LY L Y   PF    E      I+N  V FPP+ +             
Sbjct: 371 SFMIDIWAIGVSLYCLLYGMLPFISNFELELFEKIVNDPVTFPPFKYIQENNISNVSCEE 430

Query: 267 -YSDAVKQLIMSMLAKNPLHRPNIFQI 292
            Y+ A+  LI  +L K+P  R +I +I
Sbjct: 431 EYNSAI-DLIKKLLTKSPAKRISIKEI 456

>Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205W
           (SCH9) - cAMP-dependent protein kinase homolog,
           suppressor of cdc25ts [contig 376] FULL
          Length = 744

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 330 GPQDFEVLRLLGKGTFGQVY--QVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 387

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    +       +++L+ ++ S G L  F + + + R  E    
Sbjct: 388 RTASKSCPFIVGLKFSFQTPA-------DLYLVTDFMSGGEL--FWHLQKEGRFAEDRA- 437

Query: 136 TIQLHISQGVAAMHTL-QPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L +  +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 438 --RFYIAELVLALEYLHENDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 488

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 489 ---RTNTFCGTT-EYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 542

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 543 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPRHR 577

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 87/178 (48%), Gaps = 23/178 (12%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           ++ E+  +  LK    I  Y  S+   ++       +++IMEYC+ G L   +      +
Sbjct: 69  VQKEIQFLSSLKQVPNITHYYGSYLYDTK-------LWIIMEYCAGGSLRTLLR---PGK 118

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  I  I   +   VA ++  +  +IHRDIK  NVLI+ND + KLCDFG  +   +  
Sbjct: 119 IDEKYIGVIMRELL--VALLYIHKDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQ-- 174

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF 246
                 + VR    M+ T  + APE+  + +G   + K DIW+LG+  Y++     P+
Sbjct: 175 ------SNVRRQT-MAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEITTGNPPY 223

>TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}
           Anc_4.384 YHR205W
          Length = 744

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 329 GPQDFEVLRLLGKGTFGQVY--QVKKKDSKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 386

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    +       +++L+ ++ S G L  F + + + R +E    
Sbjct: 387 RTASKSCPFIVGLKFSFQTPA-------DLYLVTDFMSGGEL--FWHLQKEGRFSEDRA- 436

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 437 --KFYIAELVMALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKAELKD------- 487

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 488 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 541

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 542 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPRHR 576

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 125/277 (45%), Gaps = 42/277 (15%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           IL+ +  G + ++Y A  +P  +       VLK      KS  N +R EV       H +
Sbjct: 39  ILRQIGEGSFGKVYLAHHLPTHR-----KVVLKSSA---KSDPNVVR-EV-----FYHRQ 84

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQ 143
           +   YI       + +    +V++ +EYC    L + +  RL  R+   E   +   IS 
Sbjct: 85  FEFPYI---TKLYEIIVTETKVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISG 139

Query: 144 GVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMM 203
            +   H+L    +HRD+K+EN+L+      KL DF    G+ R   +   L  +      
Sbjct: 140 AMYYAHSLN--CVHRDLKLENILLDKVGNAKLTDF----GFTRECASKNILETI------ 187

Query: 204 STTAQYRAPEMLDLTK--GFSVNDKSDIWALGVFLYKLCYYTTPFEQ----TGEAGILNG 257
             T  Y APE++   +  GF +    D+W+LGV LY L     PF++      E  I+N 
Sbjct: 188 CGTTVYMAPELIKRERYDGFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNE 243

Query: 258 GVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
              F       DAV  L+  +LAK+P+ RP++ ++++
Sbjct: 244 MPSFDSTLLGPDAV-DLLSKLLAKDPIDRPSMKEVLE 279

>NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON}
           Anc_4.384
          Length = 749

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM- 76
           G +   +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 340 GPNDFEVLRLLGKGTFGQVY--QVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILV 397

Query: 77  -KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
               K   +IV    S    +       +++L+ ++ S G L  F + + + R TE    
Sbjct: 398 TTATKASPFIVGLKFSFQTPT-------DLYLVTDFMSGGEL--FWHLQKEGRFTEERA- 447

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 448 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 498

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 499 ---RTNTFCGTT-EYLAPELLLDEAGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 552

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 553 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 587

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 135/304 (44%), Gaps = 50/304 (16%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAV---LKRVIVPDKSHLNTLRAEVDAMKRLKHH 82
           K L +G +  +  A+ +      G N+AV   LK+ +  +   +  L  E+  +++L HH
Sbjct: 42  KTLGAGSFGVVRQARRIST----GENVAVKILLKKALKGNCVQIEMLYDELSILQKL-HH 96

Query: 83  KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHIS 142
             IV +     +K ++       ++  +  + G L D +  R   + TE + + I + + 
Sbjct: 97  PNIVDFKAWFESKDKF-------YIATQLATGGELFDRILAR--GKFTEVDAVRIIVQLL 147

Query: 143 QGVAAMHTLQPPLIHRDIKIENVLI---SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRH 199
           QG+  +H+    ++HRD+K ENVL    S+D    + DFG      +  K+ ++L +   
Sbjct: 148 QGIKYIHS--KDIVHRDLKPENVLYIDKSDDSPLVIADFGIA----KQLKSGDDLIF--- 198

Query: 200 DIMMSTTAQYRAPEMLDLTKGFSVNDK---SDIWALGVFLYKLCYYTTPFEQTGEAGILN 256
               + +  Y APE+L      +VN      DIW+LGV  Y L    +PF      G L+
Sbjct: 199 --KAAGSLGYVAPEVL------TVNGHGKPCDIWSLGVITYTLLCGYSPFIAESVEGFLD 250

Query: 257 GG------VEF--PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPN 308
                   V+F  P +   SD  K+ I+  L   P  RP   ++++     +   C + N
Sbjct: 251 ECTSGKYPVKFHRPYWDTISDEAKEFILRALILEPSKRPTASELLE--DPWIATKCALQN 308

Query: 309 IHVP 312
             +P
Sbjct: 309 DLLP 312

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 116/262 (44%), Gaps = 44/262 (16%)

Query: 52   MAVLKRVIVPD--------KSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K+V VP         K  +  L++EV  +K L H   IV Y+ S    + Y     
Sbjct: 1176 MMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHLN-IVQYLGSEIRGNIYS---- 1230

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
               L +EY + G +   +  RL  R  E  I  +   +  G+  +H+    ++HRD+K +
Sbjct: 1231 ---LFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLHS--KGILHRDMKAD 1283

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DFG +S      K  + + Y   D+ M  T  + APEM+D  +G+S 
Sbjct: 1284 NLLLDEDGICKISDFG-IS------KKSKNI-YSNSDMTMRGTVFWMAPEMVDTKQGYSA 1335

Query: 224  NDKSDIWALGVFLYKLCYYTTPF---EQTGEAGILNGGVEFPPYPHYSDAVKQLIMS--- 277
              K DIW+LG  + ++     P+   E       +      PP P   D   QLI S   
Sbjct: 1336 --KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIP---DDTIQLISSKGK 1390

Query: 278  -MLAK----NPLHRPNIFQIIQ 294
              L+K    +P  RP    +++
Sbjct: 1391 DFLSKCFEIDPEKRPTADDLLE 1412

>KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]
           {ON} similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 755

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 341 GPQDFEVLRLLGKGTFGQVY--QVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 398

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R   K   +IV    S    +       +++L+ ++ S G L  F + + + R  E    
Sbjct: 399 RTASKSCPFIVGLKFSFQTPA-------DLYLVTDFMSGGEL--FWHLQKEGRFAEDRA- 448

Query: 136 TIQLHISQGVAAMHTL-QPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L +  +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 449 --KFYIAELVLALEYLHENDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 499

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 500 ---RTNTFCGTT-EYLAPELLLDESGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 553

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 554 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPRHR 588

>Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii ADL389W
          Length = 739

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 122/277 (44%), Gaps = 35/277 (12%)

Query: 17  VGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM 76
            G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + +
Sbjct: 326 CGPQDFEVLRLLGKGTFGQVY--QVRKKDTKRIYAMKVLSKKVIIKKNEIAHTIGERNIL 383

Query: 77  KRL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEI 134
            R   K   +IV    S    +       +++L+ ++   G L  F + + + R TE   
Sbjct: 384 VRTASKSCPFIVGLKFSFQTPA-------DLYLVTDFMGGGEL--FWHLQKEGRFTEDRA 434

Query: 135 LTIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEE 193
              + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++       
Sbjct: 435 ---KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------ 485

Query: 194 LAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQT 249
               R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q 
Sbjct: 486 ----RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFADDNQK 538

Query: 250 GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
               I  G V+F P    S   +  +  +L +NP HR
Sbjct: 539 MYQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 574

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 117/269 (43%), Gaps = 41/269 (15%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K L  G + ++Y  + +P+  F+    A+ K+ I+         R EV+    L+H    
Sbjct: 112 KILGKGKFGKVYCVRHIPSG-FICALKAMEKKEIIQYNIE-KQFRREVEIQSSLRHPNLT 169

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGV 145
             Y   H  K         V+L+MEY   G L   +  R  N  ++         ++  +
Sbjct: 170 QLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYVYQMAGAL 219

Query: 146 AAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG----SVSGYIRPPKTPEELAYVRHDI 201
             MH  +  ++HRDIK EN++I  ++  KL DFG    +  G+ R  KT           
Sbjct: 220 DYMH--ERNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKR--KT----------- 264

Query: 202 MMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEA----GILNG 257
            +  T  Y +PE++   K    ++K D+WALGV  Y+L   + PFE+  +      IL  
Sbjct: 265 -LCGTVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKR 320

Query: 258 GVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
            + FP   H     + LI  +L  +P +R
Sbjct: 321 NLVFP--DHIDPDARHLISRLLEYDPANR 347

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 104/230 (45%), Gaps = 29/230 (12%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D   +  ++ E+  +  LK    I  Y  S      Y+  T  +++IMEYC+ G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGS------YLKDT-SLWIIMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
                 ++ E  I  I   +   +  +H     +IHRDIK  NVLI+N+   KLCDFG V
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFG-V 165

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +  +       + +  R    M+ T  + APE+  + +G   + K DIW+LG+  Y++  
Sbjct: 166 AAQVN------QTSLRRQ--TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEQTGEAGILNGGVEFPPYPH-----YSDAVKQLIMSMLAKNPLHR 286
              P+        +   ++  P P      YS ++K+ I   L ++P  R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKP-PRLEGRSYSPSLKEFIALCLDEDPKER 264

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 106/232 (45%), Gaps = 29/232 (12%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           ++ EV  +  LK    I  Y  S   +++       +++IMEYC+ G L   +      +
Sbjct: 66  VQKEVQFLSSLKQVPNITQYYGSFLYETK-------LWVIMEYCAGGSLRTLLR---PGK 115

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  +  I  ++   VA ++  +  +IHRDIK  NVLI+N    KLCDFG  +      
Sbjct: 116 IDEKYLGVIVRNLL--VALLYIHKDNVIHRDIKAANVLITNGGHVKLCDFGVAA------ 167

Query: 189 KTPEELAYVRHD-IMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE 247
               +L    H    M+ T  + APE+  + +G   N K+DIW+LG+  Y++     P+ 
Sbjct: 168 ----QLTTANHKRQTMAGTPYWMAPEV--IMEGVYYNTKADIWSLGITTYEIATGNPPYC 221

Query: 248 QTGEAGILNGGVEFPP----YPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQT 295
                  +    +  P      +YS  +K+ I   L ++P  RP   +++ T
Sbjct: 222 DVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEARPTAEELLTT 273

>TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON}
           Anc_4.384 YHR205W
          Length = 969

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 122/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVL-KRVIVPDKSHLNTL-RAEVDA 75
           G     +L+ L  G + Q+Y  Q+   D      M VL K+VIV      +TL    + A
Sbjct: 550 GPEDFEVLRLLGKGTFGQVY--QVKKKDTQRIYAMKVLSKKVIVRKNEVAHTLGERNILA 607

Query: 76  MKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
                   +IVS   S            +++L+ +Y S G L  F + + + R +E    
Sbjct: 608 HTATNSCPFIVSLKFSFQTP-------IDLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 657

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 658 --KFYIAELVVALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 708

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 709 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 762

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 763 YQKIAFGKVKF-PRDILSAEGRSFVKGLLNRNPNHR 797

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 104/222 (46%), Gaps = 27/222 (12%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           ++ EV  +  LK    I+ Y  S      Y+  T  +++IM+YC+ G +   +      +
Sbjct: 89  VQREVQFLSSLKQFPNIIRYFGS------YLKDT-NLWIIMDYCAGGSIRTLLR---PGK 138

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  I  I   I   +  +H  +  +IHRDIK  NVL++N+ K KLCDFG V+  +   
Sbjct: 139 IDEKYIGIIMREILIALQYIH--KDNVIHRDIKAANVLVTNEGKVKLCDFG-VAAQLNQT 195

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
           K   +         M+ T  + APE+  + +G   + K+DIW+LG+  Y++     P+ +
Sbjct: 196 KLRRQ--------TMAGTPYWMAPEV--IMEGAYYDTKADIWSLGITAYEIATGNPPYCE 245

Query: 249 TGEAGILNGGVEFPPY----PHYSDAVKQLIMSMLAKNPLHR 286
                 +    +  P       YS ++K+ I   L ++P  R
Sbjct: 246 IEALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKER 287

>CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa]
           {ON} similar to uniprot|P53104 Saccharomyces cerevisiae
           YGL180w APG1 essential for autophagocytosis
          Length = 942

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 129/303 (42%), Gaps = 55/303 (18%)

Query: 24  ILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHK 83
           + K +  G +A +Y   +   D      +  + R  + +K  L  L  E+  +K++KH  
Sbjct: 13  VEKEIGKGSFATVYRGHVT-TDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKH-P 70

Query: 84  YIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTR--LQNR--LTETEI----- 134
           +IV  ID           T + +L+M+YC+ G L   +  R  L+N   L +T       
Sbjct: 71  HIVGLIDCERT-------TTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPP 123

Query: 135 ----------LTIQLHISQGVAAMHTLQPP-LIHRDIKIENVLISN------DHKYKLCD 177
                       +  ++ Q  +A+  L+   L+HRDIK +N+L++       D K    +
Sbjct: 124 PSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSK-TFHE 182

Query: 178 FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQ--------YRAPEMLDLTKGFSVNDKSDI 229
            G V  Y  P     +  + R   + ST+          Y APE+L+  K    N K+D+
Sbjct: 183 LGYVGIYNLPILKIADFGFAR--FLPSTSLAETLCGSPLYMAPEILNYQK---YNAKADL 237

Query: 230 WALGVFLYKLCYYTTPFEQTGEAGIL------NGGVEFPPYPHYSDAVKQLIMSMLAKNP 283
           W++G  L+++C    PF  +    +       +  + FP      D +K+LI S+L  +P
Sbjct: 238 WSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDP 297

Query: 284 LHR 286
             R
Sbjct: 298 AKR 300

>ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON}
           similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 788

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 122/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 370 GPSDFEVLRLLGKGTFGQVY--QVKKKDSQRIYAMKVLSKKVIIKKNEIAHTIGERNILV 427

Query: 78  RLKHH--KYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           R       +IV    S    +       +++L+ +Y S G L  F + + + R +E    
Sbjct: 428 RTASQLCPFIVGLKFSFQTPA-------DLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 477

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 478 --KFYIAELVMALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKAELKD------- 528

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 529 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 582

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 583 YQKIAFGKVKF-PRDVLSPEGRSFVKGLLNRNPKHR 617

>Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205W
           (REAL)
          Length = 815

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 122/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAM- 76
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 399 GPQDFEVLRLLGKGTFGQVY--QVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 456

Query: 77  -KRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
               K   +IV    S    +       +++L+ +Y S G L  F + + + R +E    
Sbjct: 457 TTASKSSPFIVGLKFSFQTPA-------DLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 506

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 507 --KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 557

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 558 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAENNQKM 611

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 612 YQKIAFGKVKF-PRDVLSQEGRSFVKGLLNRNPKHR 646

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 91/201 (45%), Gaps = 34/201 (16%)

Query: 105 VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIEN 164
           ++LI+EY  +G L + +  R    L E E +     I   V+  H L   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 165 VLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTA----QYRAPEMLDLT-- 218
           +L+ +D+  K+ DFG              +A ++ D  +  T+     Y APE++     
Sbjct: 158 LLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEIVSGLPY 203

Query: 219 KGFSVNDKSDIWALGVFLYKLCYYTTPF-EQTGEAGIL-----NGGVEFPPYPHYSDAVK 272
           +GFS    SD+W+ GV L+ L     PF E+ G    L      G  E P     S   +
Sbjct: 204 EGFS----SDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQ 259

Query: 273 QLIMSMLAKNPLHRPNIFQII 293
            LI  +L  +P  R  I  I+
Sbjct: 260 DLISKILVVDPAQRIKIRDIL 280

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 125/279 (44%), Gaps = 36/279 (12%)

Query: 26  KYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYI 85
           K L +G +  +  A+ +   + +   + +LK+ +  ++ HL  L  E+  ++RL HH +I
Sbjct: 42  KTLGAGSFGVVRQARRISTGEDVAVKI-LLKKALQGNEVHLQMLYDELSILQRL-HHPHI 99

Query: 86  VSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGV 145
           V++ D   +K ++       +++ +  + G L D +  R   + TE + + I   +   V
Sbjct: 100 VAFKDWFESKDKF-------YIVTQLATGGELFDRILAR--GKFTENDAVKIIYQLLDAV 150

Query: 146 AAMHTLQPPLIHRDIKIENVLI---SNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIM 202
             +H+    ++HRD+K EN+L    S++    + DF    G  +  K  +++ +      
Sbjct: 151 KYIHS--QNVVHRDLKPENILYVNNSDNSDLVIADF----GIAKQLKNNDDMIF-----K 199

Query: 203 MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGG---- 258
            + +  Y APE+L +          DIW+LGV  Y L    + F      G L       
Sbjct: 200 AAGSLGYVAPEVLTVN---GHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSST 256

Query: 259 --VEF--PPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293
             V F  P +   SD  K+ I+S L   P  RP   Q++
Sbjct: 257 YPVTFHRPYWDKISDEAKKFILSALTIEPEERPTAEQLL 295

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 104/230 (45%), Gaps = 29/230 (12%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D   +  ++ E+  +  LK    I  Y  S      Y+  T  ++++MEYC+ G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGS------YLKDT-SLWILMEYCAGGSLRSLL 111

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
                 ++ E  I  I   +   +  +H     +IHRDIK  NVLI+N+   KLCDFG V
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGSVKLCDFG-V 165

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +  +       + +  R    M+ T  + APE+  + +G   + K DIW+LG+  Y++  
Sbjct: 166 AAQVN------QTSLRRQ--TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEQTGEAGILNGGVEFPPYPH-----YSDAVKQLIMSMLAKNPLHR 286
              P+        +   ++  P P      YS ++K+ I   L ++P  R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKP-PRLEGRSYSSSLKEFIALCLDEDPKER 264

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 98/230 (42%), Gaps = 31/230 (13%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
            R EV+    L H      Y   H  K         V+L+MEY   G L   +  R    
Sbjct: 136 FRREVEIQTSLNHPNLTKLYGHFHDEK--------RVYLLMEYLVYGELYKLL--RSHGP 185

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
             +         I+  +  +H  Q  +IHRD+K EN+LI  ++  KL DFG     I P 
Sbjct: 186 FNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPENILIGFNNVIKLTDFGW--SIINPR 241

Query: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248
               +         +  T  Y +PEM+   +    +DK D+WALGV  Y+L   + PFE+
Sbjct: 242 GVKRK--------TLCGTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSPPFEE 290

Query: 249 TGE----AGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQ 294
             +      IL   ++FP     S  VK LI  +L  NP  R ++  +++
Sbjct: 291 DTKELTYKRILKNDIKFP--ETVSHDVKDLISKLLKYNPSERISMRDVMK 338

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 124/300 (41%), Gaps = 41/300 (13%)

Query: 5    HIPKYEPGTTVTVGSHSVHI-LKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPD- 62
            H P+   G    V   S  + L+ +  G Y ++    I   ++++     + K  I+ D 
Sbjct: 1082 HTPEKNIGAQKHVKKFSDFVSLQKMGEGAYGKV-DLCIHKKERYIVVIKMIFKERILVDT 1140

Query: 63   ---KSHLNTLRAEVDAMKRLKH--HKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117
                  L T+ +E+  M  L    H+ I+  +D       Y       ++        G 
Sbjct: 1141 WVRDRKLGTIPSEIQIMATLNKTPHENILRLLDFFEDDDYY-------YIETPVHGETGC 1193

Query: 118  IDFMN-TRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLC 176
            ID  +    +  +TE E   I   +  G+  +H     ++HRDIK ENV++ +    K+ 
Sbjct: 1194 IDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKII 1251

Query: 177  DFGSVSGYIRPPKTPEELAYVR---HDIMMSTTAQYRAPEMLDLTKGFSVNDK-SDIWAL 232
            DFGS              AYV+    D+ + T   Y APE+L    G     K  DIWA+
Sbjct: 1252 DFGSA-------------AYVKSGPFDVFVGTI-DYAAPEVL---GGNPYEGKPQDIWAI 1294

Query: 233  GVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQI 292
            G+ LY + +   PF    E  IL G ++F      S+   +LI S+L +    RP I  I
Sbjct: 1295 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1352

>KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON}
           Anc_4.384 YHR205W
          Length = 792

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 122/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAE--VDA 75
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E  +  
Sbjct: 380 GPEDFEVLRLLGKGTFGQVY--QVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILV 437

Query: 76  MKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
           +   K   ++V    S    S       +++L+ +Y S G L  F + + + R +E    
Sbjct: 438 ITATKSSHFMVGLKFSFQTPS-------DLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 487

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 488 --KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 538

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 539 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAEDNQKM 592

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 593 YQKIAFGKVKF-PRDVLSAEGRSFVKGLLNRNPKHR 627

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 106/242 (43%), Gaps = 30/242 (12%)

Query: 75  AMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEI 134
           ++ ++ +H +I    + H   + +       +++ EY S G L+D++       L E+  
Sbjct: 152 SLGQILYHPHICRLYEMHTLSNHF-------YMLFEYVSGGQLLDYIIQ--HGSLKESRA 202

Query: 135 LTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
            T    I   +  +H+    ++HRD+KIEN++IS D   KL DFG  + Y +  K     
Sbjct: 203 RTFTRQICSALKYLHSHN--IVHRDLKIENIMISKDGNIKLIDFGLSNLYDKCNKLK--- 257

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGE--- 251
                      +  + APE+L  T    +  + D+W+ GV LY L     PF+       
Sbjct: 258 -------TYCGSLYFAAPELLKATP--YIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVL 308

Query: 252 -AGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPNIH 310
              I  G V +P +   S  V  L+  ML  +P  R  + Q++     + + + P P  +
Sbjct: 309 HEKIKQGKVFYPQF--LSIEVISLLSKMLVVDPFKRATLDQVMNHHWMVRDCDGP-PKSY 365

Query: 311 VP 312
           +P
Sbjct: 366 IP 367

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 129/305 (42%), Gaps = 51/305 (16%)

Query: 6   IPKYEPGTTVTVGSHS-VHILKYLTSGGYA--QIYSAQIMPADQFLGTNMAVLKRVIVPD 62
           I  ++ G T+ +GS   V + +  ++G  A  ++ S  +  A    GT++      I PD
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVG---SITPD 72

Query: 63  KSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMN 122
                  R E+  MK L H   +  Y           +   +++L++EY  +G L + + 
Sbjct: 73  ALPYGIER-EIIIMKLLNHPNVLRLY--------DVWETNTDLYLVLEYAEKGELFNLLV 123

Query: 123 TRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKY--KLCDFGS 180
            R    L E E +     I  GV+  H L   ++HRD+K EN+L+  DHKY  K+ DFG 
Sbjct: 124 ER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLL--DHKYNIKIADFGM 177

Query: 181 VSGYIRPPKTPEELAYVRHDIMMSTTA---QYRAPEMLDLT--KGFSVNDKSDIWALGVF 235
                         A      ++ T+     Y APE++     +GF+    SD+W+ GV 
Sbjct: 178 A-------------ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVI 220

Query: 236 LYKLCYYTTPF-EQTGEAGIL-----NGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNI 289
           L+ L     PF E+ G    L      G  E P     S   + LI  +L  +P  R   
Sbjct: 221 LFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKA 280

Query: 290 FQIIQ 294
             I++
Sbjct: 281 RDILK 285

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 108/241 (44%), Gaps = 39/241 (16%)

Query: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128
           +R E+  +  LK    I  Y  S+   ++       +++IMEYC+ G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTK-------LWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188
           + E  I  I   I   + ++H  +  +IHRDIK  N+LI+N+   KLCDFG         
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVA------- 159

Query: 189 KTPEELAYVRHDIM----MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTT 244
                 A +   ++    M+ T  + APE+  + +G   + K DIW+LG+  Y++     
Sbjct: 160 ------AQLSQSMLKRQTMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 245 PFEQTGEAGILNGGVEFPPYP-----HYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299
           P+        +    +  P P      YS  +K+ I   L ++P  RP   ++ +  SKL
Sbjct: 212 PYCHMEAIRAMQMITKSKP-PRLEGREYSQPLKEFIALCLDEDPKERPYAEELFK--SKL 268

Query: 300 L 300
           +
Sbjct: 269 I 269

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 116/259 (44%), Gaps = 38/259 (14%)

Query: 52   MAVLKRVIVPD-----KSHLNTLRA---EVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTY 103
            M  +K++ VP      ++ LNT+ A   EV  +K L H   IV Y+      + Y     
Sbjct: 1160 MMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLN-IVQYLGFEMKHNIYS---- 1214

Query: 104  EVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE 163
               L +EY + G +   +  R+  R  +  I  +   + +G++ +H+    ++HRD+K +
Sbjct: 1215 ---LFLEYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHSQG--ILHRDMKAD 1267

Query: 164  NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSV 223
            N+L+  D   K+ DFG +S      K  E++ Y   ++ M  T  + APEM+D  +G+  
Sbjct: 1268 NLLLDQDGICKISDFG-IS------KKSEDI-YSNSEMTMRGTVFWMAPEMVDTKQGY-- 1317

Query: 224  NDKSDIWALGVFLYKLCYYTTP---FEQTGEAGILNGGVEFPPYPH-----YSDAVKQLI 275
            N K DIW+LG  + ++     P   FE       +      PP P       S   K  +
Sbjct: 1318 NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFL 1377

Query: 276  MSMLAKNPLHRPNIFQIIQ 294
                  +P  RP   Q+++
Sbjct: 1378 NQCFHIDPKERPTAGQLLE 1396

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 119/288 (41%), Gaps = 34/288 (11%)

Query: 15  VTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVD 74
           +TV   S   ++ L  G   ++Y  +    +Q     + VL +  +  +  +  +  E +
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFA--LKVLNKHEMIKRKKIKRVLTEQE 374

Query: 75  AMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEI 134
            +     H +IV+   S   K         ++L MEYC  G     + TR    + E + 
Sbjct: 375 ILA-TSDHPFIVTLYHSFQTKDY-------LYLCMEYCMGGEFFRALQTRKSKCIAEEDA 426

Query: 135 LTIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFG---SVSGYIRPPKT 190
              + + S+ VAA+  L     I+RD+K EN+L+       L DF      +G  +P  T
Sbjct: 427 ---KFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKP--T 481

Query: 191 PEELAYVRHDIM--------MSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYY 242
            ++  Y+   I            T +Y APE++   +G       D W LG+ +Y++ + 
Sbjct: 482 MKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILIYEMLFG 538

Query: 243 TTPFEQTGE----AGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
            TPF+        + IL   V+FP     S   K LI  +L KN   R
Sbjct: 539 CTPFKGDNSNETFSNILTKDVKFPHDKEVSKNCKDLIKKLLNKNEAKR 586

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 87/185 (47%), Gaps = 23/185 (12%)

Query: 62  DKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFM 121
           D+  +  ++ E+  +  LK    I  Y  S      Y+  T  +++IMEYC+ G L   +
Sbjct: 78  DEDEVEDVQREIQFLASLKQLPNITRYYGS------YLKDT-SLWIIMEYCAGGSLRTLL 130

Query: 122 NTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSV 181
                 ++ E  I  I   I   +  +H  +  +IHRDIK  NVLI+N+   KLCDFG  
Sbjct: 131 R---PGKIDEKYIGVITREILIALKYIH--KDNIIHRDIKAANVLITNEGSIKLCDFGVA 185

Query: 182 SGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCY 241
           +   +  K  +          M+ T  + APE+  + +G   + K DIW+LG+  Y++  
Sbjct: 186 AQLNQSTKRRQ---------TMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIAT 234

Query: 242 YTTPF 246
              P+
Sbjct: 235 GNPPY 239

>Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W
           (REAL)
          Length = 824

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 123/276 (44%), Gaps = 35/276 (12%)

Query: 18  GSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMK 77
           G     +L+ L  G + Q+Y  Q+   D      M VL + ++  K+ +     E + + 
Sbjct: 408 GPQDFEVLRLLGKGTFGQVY--QVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILV 465

Query: 78  RL--KHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRLTETEIL 135
               K   +IV        K  +   T +++L+ +Y S G L  F + + + R +E    
Sbjct: 466 TTASKSSPFIV------GLKFSFQTPT-DLYLVTDYMSGGEL--FWHLQKEGRFSEDRA- 515

Query: 136 TIQLHISQGVAAMHTLQP-PLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPKTPEEL 194
             + +I++ V A+  L    +++RD+K EN+L+  +    LCDFG     ++        
Sbjct: 516 --KFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD------- 566

Query: 195 AYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPF----EQTG 250
              R +    TT +Y APE+L    G++     D W+LGV ++++C   +PF     Q  
Sbjct: 567 ---RTNTFCGTT-EYLAPELLLDETGYT--KMVDFWSLGVLIFEMCCGWSPFFAENNQKM 620

Query: 251 EAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHR 286
              I  G V+F P    S   +  +  +L +NP HR
Sbjct: 621 YQKIAFGKVKF-PRDVLSQEGRSFVKGLLNRNPKHR 655

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,047,484
Number of extensions: 2794578
Number of successful extensions: 15137
Number of sequences better than 10.0: 1945
Number of HSP's gapped: 14255
Number of HSP's successfully gapped: 1984
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)