Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J02442g7.196ON41241221580.0
Suva_9.1777.196ON43540617520.0
Smik_9.1687.196ON43140617510.0
TDEL0H025107.196ON41840317390.0
Kpol_1063.97.196ON41739817370.0
Skud_9.1477.196ON43140617230.0
KLLA0D16214g7.196ON41839817100.0
YIL022W (TIM44)7.196ON43140617090.0
NDAI0B017807.196ON43442016940.0
NCAS0A125207.196ON43238416940.0
SAKL0F07502g7.196ON41240316680.0
TPHA0C045307.196ON41639616500.0
KNAG0H026907.196ON41941116330.0
Kwal_55.203687.196ON41240816090.0
ZYRO0D15840g7.196ON40740615990.0
Ecym_43807.196ON41840015930.0
KLTH0E04554g7.196ON47940715900.0
KAFR0A026407.196ON42138515610.0
ADL118C7.196ON41840215500.0
TBLA0J015007.196ON42139713560.0
TDEL0B065902.571ON51574751.2
TPHA0B027707.216ON48093712.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02442g
         (412 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   835   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   679   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   679   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   674   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   673   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   668   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   663   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   662   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   657   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   657   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   647   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   640   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   633   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   624   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   620   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   618   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   617   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   605   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   601   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   526   0.0  
TDEL0B06590 Chr2 complement(1166277..1167824) [1548 bp, 515 aa] ...    33   1.2  
TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.2...    32   2.8  

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASG 60
           MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASG
Sbjct: 1   MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASG 60

Query: 61  RLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKT 120
           RLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKT
Sbjct: 61  RLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKT 120

Query: 121 AKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKS 180
           AKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKS
Sbjct: 121 AKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKS 180

Query: 181 NDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITG 240
           NDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITG
Sbjct: 181 NDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITG 240

Query: 241 KIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSE 300
           KIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSE
Sbjct: 241 KIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSE 300

Query: 301 APFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRK 360
           APFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRK
Sbjct: 301 APFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRK 360

Query: 361 AKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           AKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN
Sbjct: 361 AKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/406 (80%), Positives = 371/406 (91%), Gaps = 3/406 (0%)

Query: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65
           +G+L+AR  F T +      NPRSPLQIFR+TFKKEW+KSQELQ+NIKTLQDASG+LGES
Sbjct: 30  AGLLIARALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGES 89

Query: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125
           EAYKKAREAYL+A +GS TIVGKTL+KTGETVE +AT+AWDS++ K TR  AS TAKKLD
Sbjct: 90  EAYKKAREAYLRAQRGS-TIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLD 148

Query: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKREKDLASGKR RAVKSNDEAG
Sbjct: 149 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAG 208

Query: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245
           +A+VAT+IE+KES GKK+EDFKEKT VGR+++S+K  LWDESENPLIV +RK+T K+GGF
Sbjct: 209 TAVVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGF 268

Query: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305
           FAETES+RVY QFKM+DPTF+N  FT+HLR+YIVPE+LEAYVKGD KVLKKWFSEAPFNV
Sbjct: 269 FAETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNV 328

Query: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365
           Y AQQKIFK+Q++F+DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 329 YAAQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGE 388

Query: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           IAAGDE+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 389 IAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 434

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/406 (80%), Positives = 371/406 (91%), Gaps = 3/406 (0%)

Query: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65
           +G+++AR  F T +      NPRSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASG+LGES
Sbjct: 26  TGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGES 85

Query: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125
           EAYKKAREAYLKA +GS TIVGKTL+KTGET+E +ATKAW+S++ K TR  AS TAKKLD
Sbjct: 86  EAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLD 144

Query: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKREKDLASGKR RAVKSNDEAG
Sbjct: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAG 204

Query: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245
           +A+VAT+IE+KES GKK+EDFKEKT VGR+++S+K  LWDESENPLIV +RKIT K+GGF
Sbjct: 205 TAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGF 264

Query: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305
           FAETES+RVY QFKM+DPTF+N  FT+HLR+YIVPE+LEAYVKGD KVLKKWFSEAPFNV
Sbjct: 265 FAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNV 324

Query: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365
           Y AQQKIFK+Q++++DG+ILDIRGVEVVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 325 YAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGE 384

Query: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           IAAGDE+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 385 IAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/403 (79%), Positives = 365/403 (90%), Gaps = 1/403 (0%)

Query: 9   GVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAY 68
           G L  R  F T S  L NPRSP+QIFR+TFKKEW+KSQELQDNIKTLQDASGRLGESEAY
Sbjct: 16  GRLAGRALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAY 75

Query: 69  KKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESF 128
           K+AREAY++A KGS TIVGKTL+KTGETVE +A+KAWDS+IA+ TR  ASKTAKK+DE F
Sbjct: 76  KRAREAYVRAQKGS-TIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGF 134

Query: 129 EPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSAL 188
           EPVRQTKIYKDVSEV+DDG+SS YGGFITKEQRRLKRE+D+ SGKR +AVK N++AG+AL
Sbjct: 135 EPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTAL 194

Query: 189 VATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAE 248
           VATDIEAK+S GKK+EDFKEKT +GRTL  +K SLWDES NPLIVFLRKIT KIGGFFAE
Sbjct: 195 VATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAE 254

Query: 249 TESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNA 308
           TE+ARV  QFKM+DPTFTN  FT+HLR+Y++PE+LEAYVKGDEKVLKKWFSEAP+NVY A
Sbjct: 255 TEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAA 314

Query: 309 QQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368
           QQK F++Q+LF+DGKILDIRGVE+VSAK+L PQDIPVLVVGCRAQEIHLYRKAKTGE+AA
Sbjct: 315 QQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAA 374

Query: 369 GDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           G ESNI+MSSYAMVFTRDPEQIDD+ETEGW+ILEF+RG SR F
Sbjct: 375 GHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQF 417

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/398 (81%), Positives = 361/398 (90%), Gaps = 1/398 (0%)

Query: 15  RCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREA 74
             F T S +L  PR+P+QIFR+TFKKEWEKS++LQDNIK LQDASGRLGESEAYKKAREA
Sbjct: 21  HLFSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKAREA 80

Query: 75  YLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQT 134
           YLKA KGS TIVGKTLQKTGETVE++A+KAWDS+I K+TR  AS TA+K+DESFEPVR+T
Sbjct: 81  YLKAQKGS-TIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKT 139

Query: 135 KIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIE 194
           ++YKDVS+VIDDGDSS YGGFI KEQRRLKRE DL SGKRVRAVKSNDEAG+++VAT+IE
Sbjct: 140 QVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIE 199

Query: 195 AKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARV 254
           AKESLGKK+EDFKE T  GRT+  VKV LWDE+ENPLIVFLRK++GKIGGFFAETES+RV
Sbjct: 200 AKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRV 259

Query: 255 YKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFK 314
             QFK++DPTF+N  FTKHLR+YI+PEVLEAYVKGDE VLKKWFSEAP+NVY AQQK F+
Sbjct: 260 LSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFR 319

Query: 315 KQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNI 374
           KQ+LF DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEIHLYRK KTGEIAAGDESNI
Sbjct: 320 KQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNI 379

Query: 375 LMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           LMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F 
Sbjct: 380 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/406 (78%), Positives = 370/406 (91%), Gaps = 3/406 (0%)

Query: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65
           +G+LVAR  F T +      NPRSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASG+LGES
Sbjct: 26  AGLLVARVLFSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGES 85

Query: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125
           EAYKKAREAYL+A +GS TIVGKTL+KTGET+E +ATKAW+S++ K TR  AS TAK+LD
Sbjct: 86  EAYKKAREAYLRAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLD 144

Query: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKREKDLASGKR RAVKSNDEAG
Sbjct: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAG 204

Query: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245
           +A+VAT+IE+KES GKK+EDF+EKT +GR+++S+K  LWDESENPLIV +RK+T K+GGF
Sbjct: 205 TAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGF 264

Query: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305
           FAETES+RV+ QFK++DPTF+N  FT+HLRDYIVPE+LEAYVK D KVLKKWFSEAP+NV
Sbjct: 265 FAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNV 324

Query: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365
           Y AQQKIF++Q++++DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 325 YAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGE 384

Query: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           IAAG+E+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 385 IAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/398 (80%), Positives = 356/398 (89%), Gaps = 1/398 (0%)

Query: 15  RCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREA 74
           R F   +  +SNPRSPLQIFRETFK+EWEKS+ELQDNIK LQDASG+LGESEAYKKAREA
Sbjct: 22  RTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREA 81

Query: 75  YLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQT 134
           Y+KA KGS TIVGKTL+KTGETVE +A+KAWDS+IAK+TR V +KTA KLDESFEPVR+T
Sbjct: 82  YVKAQKGS-TIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKT 140

Query: 135 KIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIE 194
           K+YKDVSEVIDDGDSS YGGFITKEQRRL +E+ +ASGKR RAVKSND AG+ALVAT+IE
Sbjct: 141 KVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIE 200

Query: 195 AKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARV 254
           +KES GKKIEDFKEKTPVGR L   K+ LWDESENPL+V LR ++GKIGG FAETESARV
Sbjct: 201 SKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARV 260

Query: 255 YKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFK 314
           Y QFKM+DPTF    FTKHLR+YI+PE+LEAYVKGDE VLK+WFSEAP+NVY AQQK F+
Sbjct: 261 YGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFR 320

Query: 315 KQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNI 374
           +QELF+DGKILDIRGVE+VSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG ES+I
Sbjct: 321 EQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSI 380

Query: 375 LMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           LMSSYAMVFTRDPE +DD ETEGWKILEF+RG SR F 
Sbjct: 381 LMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/406 (79%), Positives = 371/406 (91%), Gaps = 3/406 (0%)

Query: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65
           +G+LVAR  F T +      NPRSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASG+LGES
Sbjct: 26  TGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGES 85

Query: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125
           EAYKKAREAYLKA +GS TIVGKTL+KTGET+E +ATKAW+S++ K TR  A+ TAKKLD
Sbjct: 86  EAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLD 144

Query: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKRE+DLASGKR RAVKSN++AG
Sbjct: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAG 204

Query: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245
           +A+VAT+IE+KES GKK+EDFKEKT VGR+++S+K  LWDESENPLIV +RKIT K+GGF
Sbjct: 205 TAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGF 264

Query: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305
           FAETES+RVY QFK++DPTF+N  FT+HLR+YIVPE+LEAYVKGD KVLKKWFSEAPFNV
Sbjct: 265 FAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNV 324

Query: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365
           Y AQQKIFK+Q++++DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 325 YAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGE 384

Query: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           IAAGDE+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 385 IAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/420 (75%), Positives = 370/420 (88%), Gaps = 9/420 (2%)

Query: 1   MISVRSTSGV----LVARRCFGTRSVLLSNP----RSPLQIFRETFKKEWEKSQELQDNI 52
           +++V+ +S V     V +  F T    L+N     R+P+QIFR+TFKKEWEKSQELQDNI
Sbjct: 16  LLNVQRSSSVPSSYTVGKVLFSTTRTTLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNI 75

Query: 53  KTLQDASGRLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKT 112
           K L DASG+L ESE +K A++AYLKA KGS TIV KTL+KTGETVE +A+KAWDS+I K 
Sbjct: 76  KALHDASGKLSESETFKMAKDAYLKAHKGS-TIVSKTLKKTGETVETMASKAWDSEIGKN 134

Query: 113 TRVVASKTAKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASG 172
           TR+ A KTA+ +D+SFEPVR+T+IYKDVSEVIDDGDSS YGGFITKE+R+LKRE+DLASG
Sbjct: 135 TRIAAKKTAETIDKSFEPVRKTQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASG 194

Query: 173 KRVRAVKSNDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLI 232
           KR RAVKSNDEAG+ALVAT+IEAKES GKK+EDFKEKT VG+T+K+VK+ LWDESENPLI
Sbjct: 195 KRQRAVKSNDEAGTALVATNIEAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLI 254

Query: 233 VFLRKITGKIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEK 292
           V LRKI+ KI GFF ETESA+VY QFK++D TFTN GFT+HLRDYIVPE+LEAY+KGDEK
Sbjct: 255 VTLRKISNKISGFFDETESAKVYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEK 314

Query: 293 VLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRA 352
           VLKKWFSEAPFNVY AQQK+F++Q LFSDG+ILDIRGVE+VSAKLL PQDIPVLVVGCRA
Sbjct: 315 VLKKWFSEAPFNVYAAQQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRA 374

Query: 353 QEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           QEI+LY+KAK+GEIAAGDESNI+MSSYAMVFTRDPEQIDDDETEGWKILEF+RG SRPFN
Sbjct: 375 QEINLYKKAKSGEIAAGDESNIVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPFN 434

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/384 (80%), Positives = 353/384 (91%)

Query: 28  RSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVG 87
           R+P+QIFR+TFKKEW+KSQELQ+NIK L DASG+L ESE +K A++AYLKA KGS TI+ 
Sbjct: 48  RTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDAYLKAHKGSSTILS 107

Query: 88  KTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVIDDG 147
           KT+QKTGETVE +A+KAWDS+IAK+TR  A KTA  LD+SFEPVR+T++YKD+SEVIDDG
Sbjct: 108 KTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQVYKDISEVIDDG 167

Query: 148 DSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDFK 207
           DSS YGGFITKE+RRLKRE DLASGKR RA+KSN+EAG+ALVATDIEAK+S GKK+EDFK
Sbjct: 168 DSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAKQSFGKKVEDFK 227

Query: 208 EKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFTN 267
           EKT VG+T+ SVKV LWDESENPLIVFLRKIT KIGGFF ETESARVY QFKM+D TFTN
Sbjct: 228 EKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARVYTQFKMMDATFTN 287

Query: 268 IGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILDI 327
            GFT+HLR+YIVPE+LEAY+KGDEKVLKKWFSEAPFNVY+AQQK+F++Q LFSDG+ILDI
Sbjct: 288 EGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQGLFSDGRILDI 347

Query: 328 RGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRDP 387
           RGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAGD+SNILMSSYAMVFTRDP
Sbjct: 348 RGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILMSSYAMVFTRDP 407

Query: 388 EQIDDDETEGWKILEFIRGSSRPF 411
           EQIDDDETEGWKILEF+RG SR F
Sbjct: 408 EQIDDDETEGWKILEFVRGGSRQF 431

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/403 (77%), Positives = 352/403 (87%), Gaps = 1/403 (0%)

Query: 10  VLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYK 69
           VL +RR   +   L    RSPLQIFRETFK+EWEKS+ELQDNIKTLQDASG+LGES+AYK
Sbjct: 11  VLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYK 70

Query: 70  KAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFE 129
           KAREAYL+A KGS TIVGKTL+KTGETVE++A KAW+S++ KTTR   + TA+K+DESFE
Sbjct: 71  KAREAYLRAQKGS-TIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFE 129

Query: 130 PVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALV 189
           PVRQTK+YKDVSEVIDDG+SS YGGFITKEQRRLK+E+DLASGKR +AVKSNDEAG+ALV
Sbjct: 130 PVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALV 189

Query: 190 ATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAET 249
           AT+IEAKES  KKIEDFKEKTP GR +  +KV LWDESENPLIV LR I  K+GG FAET
Sbjct: 190 ATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAET 249

Query: 250 ESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQ 309
           ESARV  QFKM+DP F    FTKHLR+YI+PE+LEAYVKGDE VLK+WFSEAP+NVY AQ
Sbjct: 250 ESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQ 309

Query: 310 QKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAG 369
           QK F+ QELF+DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG
Sbjct: 310 QKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAG 369

Query: 370 DESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
            ESNIL+SSYAMVFTRDPE +DD ETEGW+ILEF+RG SR F 
Sbjct: 370 TESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/396 (77%), Positives = 355/396 (89%), Gaps = 2/396 (0%)

Query: 17  FGTRSVLLSNP-RSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREAY 75
           F T +VL +   ++P+QIFRETFKKEWEKSQELQDNIKTLQDASGRLG+SEAYKKA+EAY
Sbjct: 21  FSTSTVLRNGGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAY 80

Query: 76  LKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQTK 135
           +KA + S TIV KTL+KTGETVE+LA K WDS+I K+TR V S+ AKK+DESFEPVRQT+
Sbjct: 81  VKAQQSS-TIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQ 139

Query: 136 IYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIEA 195
           +YK+VSEVIDDG+SS YGGFI+KEQRR KRE DLASGKRVRA KSN+EAG+A+VAT++E+
Sbjct: 140 VYKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVES 199

Query: 196 KESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARVY 255
           KES GKKI+DFKEKT VG+T+KS KV +WDE+ENPLIV LR I+ KI GFFAETES+RVY
Sbjct: 200 KESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVY 259

Query: 256 KQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKK 315
            QFK++DPTF+N  FTKHLRDYI+PEVLEAYVKGDE VLKKWFSEAPFNVY AQQK  +K
Sbjct: 260 SQFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRK 319

Query: 316 QELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNIL 375
           Q+LF+DG+ILDIRGV++VSAKLL PQDIPVLVVGCRAQE+HLYRK KTGE+ AGDESNI+
Sbjct: 320 QQLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIM 379

Query: 376 MSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           MSSYAMVFTRDP+ IDDDETEGWKILEF+RG SR F
Sbjct: 380 MSSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQF 415

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/411 (75%), Positives = 369/411 (89%), Gaps = 5/411 (1%)

Query: 6   STSGV-LVARRCFGTRSVLLS---NPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGR 61
           +++GV +VAR    T  VLL+   +PRSPL IFR+TFKKEWEKSQELQ+NI+TLQDASG+
Sbjct: 10  ASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGK 69

Query: 62  LGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTA 121
           +GE+EAY+KAREA+L+A KGS TIVGKTL+KTGETVE +A+KAWDS+IAK +R  A KTA
Sbjct: 70  IGETEAYRKAREAFLRAQKGS-TIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTA 128

Query: 122 KKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSN 181
           +KLDE FEPVRQT++YKDVSEVIDDGDS+SYGGF T+E+R+ +REK LASG+RVRAVKSN
Sbjct: 129 QKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVRAVKSN 188

Query: 182 DEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGK 241
           DEAG+ALVAT +E+KESLGKK+EDFKEKT VGR+L  +K  LWDESENPLIVF+RK++GK
Sbjct: 189 DEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGK 248

Query: 242 IGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEA 301
           +G FFAETES RVY QFK++DP F ++ FTKHLR+Y+VPE+LEAYV+GDEKVLKKWFSEA
Sbjct: 249 VGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEA 308

Query: 302 PFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKA 361
           P+NVY AQQK+FK++ LF+DG+ILDIRGVE+VSAKLLQPQD+PVLVVGCRAQEI+LY+K 
Sbjct: 309 PYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKV 368

Query: 362 KTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           KTGEIAAG ESNILMSSYAMVFTRDPEQ+ D+ETEGWKILEF+RG SR F 
Sbjct: 369 KTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/408 (73%), Positives = 349/408 (85%), Gaps = 1/408 (0%)

Query: 4   VRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLG 63
           VR    V+ +R+   T      NPRSPLQIFRETFK+EW+KSQELQDNIK LQDASG+LG
Sbjct: 5   VRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLG 64

Query: 64  ESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKK 123
           ES+AYKKAREAYLKA KGS TIVGKT++KTG++VE +A KAW+S+I+K+TR   +KTA K
Sbjct: 65  ESDAYKKAREAYLKAQKGS-TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAK 123

Query: 124 LDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDE 183
           LDESFEPVR T++YKDVSEV++ G+SS YGGFITKEQRRLK E+D+ASGKR +AV+SNDE
Sbjct: 124 LDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDE 183

Query: 184 AGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIG 243
           AG+ALVAT+IEAKES GKK++DFKEKT VGR L   KV LWDESENPLIV LR I  KIG
Sbjct: 184 AGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIG 243

Query: 244 GFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPF 303
           G FAETESARV  QFKM+D  F +  F  HLR+YI+PEVLEAYVKGDEKVLK+WFSEAP+
Sbjct: 244 GLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPY 303

Query: 304 NVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKT 363
           NVY AQQK+F++Q LF+DG+ILDIRGV++VSAKLL PQD+PVLVVGCRAQEIHLYR  KT
Sbjct: 304 NVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKT 363

Query: 364 GEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           GE+AAG +SNILMSSYAMVFTRDPE ID+ ETEGWKILEF+RG SR F
Sbjct: 364 GEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQF 411

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/406 (72%), Positives = 356/406 (87%), Gaps = 4/406 (0%)

Query: 9   GVLVARRC--FGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESE 66
           G++  R    F T S  L   RSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASGRLG+SE
Sbjct: 4   GIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSE 62

Query: 67  AYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDE 126
             K+AREAYL+A KGS TIVGKTLQKTGETVE +A+KAW+S+IAK+TR  AS TAKKLD+
Sbjct: 63  GVKRAREAYLRAQKGS-TIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDK 121

Query: 127 SFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGS 186
           SFEPVR TKIYKDVSEV++D D+S YGGF+TKEQR++KRE+++ASGKR RA++SN+EAG+
Sbjct: 122 SFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGT 181

Query: 187 ALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFF 246
           ALVAT+IEAKESLGKK+EDF+EKT +GR ++ +KV LW+E+ENPLIV LRKIT K+GGFF
Sbjct: 182 ALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFF 241

Query: 247 AETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVY 306
           AETE+A+V  QFK++DP+FT+ GFT+ LRDY++PEVLEAY KGDEK LKKWFSEAPFNVY
Sbjct: 242 AETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVY 301

Query: 307 NAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEI 366
            AQQK F+ Q+LF+D +ILDIRGV++VSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+
Sbjct: 302 AAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEV 361

Query: 367 AAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           AAG ESNILMSSYAMVFTRDPE ++D+ETEGW+I+EF+RG SR F 
Sbjct: 362 AAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/400 (74%), Positives = 338/400 (84%), Gaps = 1/400 (0%)

Query: 12  VARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKA 71
           V  R F T  +  +  +SPLQIFRETFK EW+KSQELQDNIK LQDASGRLGES+AYKKA
Sbjct: 19  VPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKA 78

Query: 72  REAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPV 131
           REAYLKA +GS T+VGKTL+KTGET+E L  KAWDSDI K TR V SKTA+KLDESFEPV
Sbjct: 79  REAYLKAQRGS-TVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPV 137

Query: 132 RQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVAT 191
           R T++YKD+SE+IDDG+SS YGGFI KE RR KRE DLASG+R  AV+SNDEAG+A+VAT
Sbjct: 138 RHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVAT 197

Query: 192 DIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETES 251
           + E KES GKKI+DFKEKT +GR L   KV LWDE+ENPLI  LR I+ KIGG FAETES
Sbjct: 198 NKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETES 257

Query: 252 ARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQK 311
           ARV+ QFK++DPTF +  FTKHLR+YI+PEVLEAYVKGDE VLK+W SEAP+NVY AQQK
Sbjct: 258 ARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQK 317

Query: 312 IFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDE 371
            F++QELF DG++LDIRGVE+VSAKLL PQD+P LVVGCR QEIHLYRKAKTGEIAAG E
Sbjct: 318 QFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHE 377

Query: 372 SNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           SNI+MSSYAMV TRDPE + D ETEGWK+LEFIRG SR F
Sbjct: 378 SNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQF 417

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/407 (72%), Positives = 346/407 (85%), Gaps = 1/407 (0%)

Query: 5   RSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGE 64
           R    V++ R    T      NPRSPLQIFRETFK+EW+KSQELQDNIK LQDASG++GE
Sbjct: 73  RPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132

Query: 65  SEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKL 124
           SEAYKKAREAYL A KGS TIVGKTL+KTG++VE++A KAW+S+I K+TR   +KTA KL
Sbjct: 133 SEAYKKAREAYLSAQKGS-TIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKL 191

Query: 125 DESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEA 184
           DESFEPVR T++YKDVSEV+D  +SS YGGFI+KEQRRLK E+D+ASGKR +AVKSN+EA
Sbjct: 192 DESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEA 251

Query: 185 GSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGG 244
           G+ALVAT+IEAKES GKK++DFKEKT VGR L+ VK  LWDESENPLIV +R I  K+GG
Sbjct: 252 GTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGG 311

Query: 245 FFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFN 304
            FAETESARV  QFKM+D  F +  F  HLR+YI+PEVLEAYVKG+E+VLK+WFSEAP+N
Sbjct: 312 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYN 371

Query: 305 VYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTG 364
           VY AQQK+F++Q LF+DG+ILDIRGV++VSAKLL PQD+PVLVVGCRAQEIHLYR  KTG
Sbjct: 372 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTG 431

Query: 365 EIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           E+AAG +SNILMSSYAMVFTRDPE IDD ETEGWKILEF+RG SR F
Sbjct: 432 EVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQF 478

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/385 (74%), Positives = 342/385 (88%), Gaps = 1/385 (0%)

Query: 28  RSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVG 87
           R+PLQIFRETFKKEWEKS ELQ +IK LQDASG++ ESEAYKKAR+AYLKA +GS TI+ 
Sbjct: 36  RTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTILD 95

Query: 88  KTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVI-DD 146
           KTL+KTG+T+E++ATKAW+S+I+K TR +AS+TAKKLDESFEPVR TKIYKDVSEV+ DD
Sbjct: 96  KTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDD 155

Query: 147 GDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDF 206
           GDS  YGGFI K++RRLKRE  L SGKRVRAVKSNDEAG+ALVAT++++ ES+G+K E+F
Sbjct: 156 GDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYENF 215

Query: 207 KEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFT 266
           KE+T VG+ L + KV+ WDESENPLIV LRKIT KI GFF ETES+RVY QFK++D TF 
Sbjct: 216 KERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTFN 275

Query: 267 NIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILD 326
              FT+HLR+YIVPE+LEAY+KGDEKVLK WFSEAPFNVY+AQQK+F++Q LF DG ILD
Sbjct: 276 AESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILD 335

Query: 327 IRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRD 386
           IR VE+VSAKLLQPQDIPVLVV CRAQEI++YRK KTGE+AAG+ S+ILMS+YAMVFTRD
Sbjct: 336 IRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRD 395

Query: 387 PEQIDDDETEGWKILEFIRGSSRPF 411
           PE+ID+DETEGW+ILEF+RG+SR F
Sbjct: 396 PEEIDNDETEGWRILEFVRGNSRQF 420

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/402 (72%), Positives = 347/402 (86%), Gaps = 1/402 (0%)

Query: 11  LVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKK 70
           ++A R F       + P+SPLQ+FRETFK+EW+KSQELQDNIK LQDA GRLGES+AYKK
Sbjct: 18  VLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKK 77

Query: 71  AREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEP 130
           AREAYLKA KGS TIVGKTL++TGET+E +  +AW+S+I KTTR   SKTA+KLDESFEP
Sbjct: 78  AREAYLKAQKGS-TIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136

Query: 131 VRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVA 190
           VRQTK+YKD+SE+IDDG+SS YGGF+ KE+RR KRE+DLA+GKR   V+SN+EAGSALVA
Sbjct: 137 VRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVA 196

Query: 191 TDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETE 250
           TD EA ESLGKKI+DFKEKT VGR L  +KV LWDE+ENPLI  LR I+ K+GG FAETE
Sbjct: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256

Query: 251 SARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQ 310
           SARV+ QFK++DPTF    FTKHLR+YI+PEVLEAYVKGDE+VLK+WFSEAP+NVY+AQQ
Sbjct: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316

Query: 311 KIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGD 370
           K  ++QELF+DG+ILDIRGVE++SAKLL PQD+P +VVGCRAQEIHL+RKA TGEIAAG 
Sbjct: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376

Query: 371 ESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412
           ESNI++SSYAMV TRDPE++DD ETEGWKILEF+RG SR F 
Sbjct: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 325/397 (81%), Gaps = 12/397 (3%)

Query: 22  VLLSNP--RSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREAYLKAS 79
           VL SN   ++P+QIFRETFK+EWEKS  LQD IKTL DAS R+ +S+A+KKA++AY   S
Sbjct: 29  VLQSNDSNKTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKAKDAYKNVS 88

Query: 80  KGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKD 139
             + TI+ KT+ KTG  + + A KAWDSD+A+ T++ A    KKLD+SFEPVR TKIYKD
Sbjct: 89  NQT-TILSKTISKTGTKLNDAALKAWDSDLAQKTKLAA----KKLDDSFEPVRNTKIYKD 143

Query: 140 VSEVIDDGDSS-SYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIEAKES 198
           VSEVIDD D+S  YGGFI+KE+RR KR  DL +GKR++ +KSNDEAG+AL+ATD+++KES
Sbjct: 144 VSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIATDLKSKES 203

Query: 199 LGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARVYKQF 258
           + +K+ DFKEKT VG+T+ S+K  +WDE++NPLIV +RK+TG    FFAETES+RV  QF
Sbjct: 204 INEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETESSRVLTQF 263

Query: 259 KMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQEL 318
           K++DP F N  F + LR+YI+PEVLEAY+KGDEK+LK WFSEAP+NVY+AQQK  +KQ++
Sbjct: 264 KLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQKELRKQKI 323

Query: 319 FSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRK----AKTGEIAAGDESNI 374
           FSDG++LDIRGV++V+AK+L PQDIPV+VV CRAQEI++Y+K     +T +I AG +SNI
Sbjct: 324 FSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIVAGHDSNI 383

Query: 375 LMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411
           LMS+YAMVFTRDPEQ+D+DETEGWKILEF+RG SR F
Sbjct: 384 LMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSRKF 420

>TDEL0B06590 Chr2 complement(1166277..1167824) [1548 bp, 515 aa]
           {ON} Anc_2.571 YKL047W
          Length = 515

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 3/74 (4%)

Query: 253 RVYKQFKMVDPTFTNIGFTKHLRDYIVPEVL---EAYVKGDEKVLKKWFSEAPFNVYNAQ 309
           ++Y    ++DP F+  G    L     P       AYV   +++L  W +E  F  Y+  
Sbjct: 108 KMYALGVIIDPKFSARGIPDDLVSSWWPTQFIGANAYVDDLQQLLTHWLAEENFENYDLF 167

Query: 310 QKIFKKQELFSDGK 323
           ++ FK   L  DG 
Sbjct: 168 EEYFKCNSLIDDGN 181

>TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.216
           YIL039W
          Length = 480

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 141 SEVIDDGDSSSYGGFITKEQRRL-KREKDLASGKRVRAVKSNDEAGSALVATD--IEAKE 197
           S+ IDD   S +    ++  RR+ KR  D+         +S+DE G   V T+  IE+K 
Sbjct: 147 SQWIDD---SEFYNRTSRYMRRIFKRNTDILFDINN---ESHDENGQYQVNTEKWIESKN 200

Query: 198 SLGKKIEDFKEKTPVGRTLKSVKVSLWDESENP 230
               + E+  E TP+        +  WDE  +P
Sbjct: 201 LFSYEFENIDESTPIDNEFGYEDLYSWDEDSDP 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,393,801
Number of extensions: 1778764
Number of successful extensions: 5762
Number of sequences better than 10.0: 104
Number of HSP's gapped: 6001
Number of HSP's successfully gapped: 105
Length of query: 412
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 300
Effective length of database: 40,638,807
Effective search space: 12191642100
Effective search space used: 12191642100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)