Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0J02420g7.194ON31231216790.0
YIL021W (RPB3)7.194ON31831814090.0
Smik_9.1697.194ON31831813980.0
Skud_9.1487.194ON31831813970.0
Suva_9.1787.194ON31931913930.0
KAFR0A026507.194ON31231513830.0
ZYRO0D15796g7.194ON30831213640.0
NCAS0E018307.194ON31831113640.0
NDAI0G020007.194ON31131513610.0
TDEL0H025307.194ON31131513600.0
TBLA0J015207.194ON33530113430.0
KNAG0H027007.194ON32630813110.0
Kpol_1063.117.194ON31629913040.0
TPHA0C045107.194ON31031313020.0
SAKL0F07458g7.194ON31531912751e-178
KLTH0E04598g7.194ON32829612611e-175
Kwal_55.203807.194ON32328912531e-174
KLLA0D16170g7.194ON30731212511e-174
ADL120C7.194ON31131412401e-172
Ecym_43827.194ON31131312331e-171
CAGL0B04125g3.428ON3342862421e-22
Kpol_1018.1393.428ON3352952412e-22
ZYRO0C12364g3.428ON3352952332e-21
KAFR0A055203.428ON3343022262e-20
TPHA0D039203.428ON3352992262e-20
Kpol_473.33.428ON3202852252e-20
YPR110C (RPC40)3.428ON3352962244e-20
Suva_16.4383.428ON3352962226e-20
KNAG0A076003.428ON3342872227e-20
Smik_16.3533.428ON3352962201e-19
SAKL0F06028g3.428ON3342942201e-19
Skud_16.3973.428ON3352852192e-19
NDAI0A047703.428ON3352972182e-19
KLLA0D14861g3.428ON3342892182e-19
TDEL0F031003.428ON3351962147e-19
NCAS0A115203.428ON3352992149e-19
KLTH0F12056g3.428ON3501822131e-18
ADR031C3.428ON3642912132e-18
TBLA0F017003.428ON3331952112e-18
Kwal_23.39983.428ON3342942093e-18
Ecym_44503.428ON3342942094e-18
KNAG0K003505.45ON80133721.5
ZYRO0D12012g5.506ON126175712.2
Suva_13.59singletonON114337694.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0J02420g
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   651   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   547   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   543   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   542   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   541   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   537   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   530   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   530   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   528   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   528   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   521   0.0  
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   509   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   506   0.0  
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   506   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   495   e-178
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   490   e-175
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   487   e-174
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   486   e-174
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   482   e-172
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   479   e-171
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    98   1e-22
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    97   2e-22
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    94   2e-21
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    92   2e-20
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    92   2e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    91   2e-20
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    91   4e-20
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    90   6e-20
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    90   7e-20
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    89   1e-19
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    89   1e-19
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    89   2e-19
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    89   2e-19
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    89   2e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    87   7e-19
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    87   9e-19
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    87   1e-18
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    87   2e-18
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    86   2e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    85   3e-18
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    85   4e-18
KNAG0K00350 Chr11 (56222..58627) [2406 bp, 801 aa] {ON} Anc_5.45...    32   1.5  
ZYRO0D12012g Chr4 complement(1016679..1020464) [3786 bp, 1261 aa...    32   2.2  
Suva_13.59 Chr13 complement(88493..90265,90334..90459,90481..920...    31   4.6  

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300
           DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300

Query: 301 NGRSSDTYGSAW 312
           NGRSSDTYGSAW
Sbjct: 301 NGRSSDTYGSAW 312

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/318 (82%), Positives = 285/318 (89%), Gaps = 6/318 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++DNVDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL+I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYEDPPN+ +PFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD     N +  + D MM      PY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 299 GDNGRSSDT----YGSAW 312
            +  +  +T    Y +AW
Sbjct: 301 SNASQMGNTGSGGYDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/318 (82%), Positives = 283/318 (88%), Gaps = 6/318 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++DNVDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL+I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYED PN+ +PFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD     N +  + D MM      PY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 299 GDNGR----SSDTYGSAW 312
            +  +     S  Y SAW
Sbjct: 301 SNASQMGNSGSGGYDSAW 318

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/318 (82%), Positives = 285/318 (89%), Gaps = 6/318 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++D VDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL+I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYEDPPN+ +PFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD  A  N +  + D +M      PY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 299 GDNGRSSDT----YGSAW 312
            +  +  +T    Y +AW
Sbjct: 301 SNASQMGNTGSSGYDNAW 318

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/319 (81%), Positives = 284/319 (89%), Gaps = 7/319 (2%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA++DNVDFIL++VDLA+ANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D  KEWPQSKNCEYEDPPN+ + FDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD--AKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGIDTLQKKVASI+LAL QMDQ+KVNFA+GD     N +  + D MM      PY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 299 GD-----NGRSSDTYGSAW 312
            +     N  SS  Y +AW
Sbjct: 301 ANASQMGNTGSSGGYDNAW 319

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/315 (82%), Positives = 282/315 (89%), Gaps = 6/315 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HT+YWYE+D  KEWP SKNCEYEDPPN+++PFDYKAKADTFYMNVE VGSI+V
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNG-HDGPYG 299
           DQVV+RG+DTLQKKVASI+LALNQMDQEKVN+A+G          GD  M     D  Y 
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG---ATADMNQGDIAMGGAEQDAFYS 297

Query: 300 D--NGRSSDTYGSAW 312
           +  N  ++  Y +AW
Sbjct: 298 NMPNSNANGIYDNAW 312

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/312 (82%), Positives = 281/312 (90%), Gaps = 4/312 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATR+NVDFILS+V+LA+ANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRN+GHPIIQDKEGNGVLICKLRKGQEL L C+AKKGIAKEHAKWGP+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HT+YW+E+D  KEWP SKN EYEDPPN+ EPFDY+A A+TFYMNVE+VGS++ 
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300
           DQVVLRGIDTLQKKVASI+LAL QMDQ+KVNFA+G     G   DGD  MMNG D PYG 
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPM--GAVGDGDT-MMNGDDYPYGA 297

Query: 301 NGRSSDTYGSAW 312
            G  S  Y  +W
Sbjct: 298 TG-GSGVYDDSW 308

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/311 (82%), Positives = 277/311 (89%), Gaps = 6/311 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREAT+DNVDFILSNVDLALANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D  KEWP SKNCEYEDPPN+ E FDYKAKA+TFYMNVE VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYG- 299
           DQVV+RG+DTLQKKVASI+LAL QMDQEKVNFAT     NG+   G   MMNG D     
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNP---NGVS--GREGMMNGGDNDVNM 295

Query: 300 DNGRSSDTYGS 310
           D G   ++Y +
Sbjct: 296 DGGMEQNSYAN 306

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/315 (81%), Positives = 280/315 (88%), Gaps = 7/315 (2%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSN+DLALANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELKLTC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D +KEWP SKNCEYEDPPN+ EPFDYKAKA+TFYMNVE VGSI+V
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFAT---GDAKGNGIEEDGDAMMMNGHDGP 297
           DQVV+RGI+TLQ+KVASI+LAL QMDQEK+ +AT   G    N + +D D   M+G    
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVD---MDGDAYA 297

Query: 298 YGDNGRSSDTYGSAW 312
            G N +    Y  AW
Sbjct: 298 NGANNQPG-AYNDAW 311

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/315 (80%), Positives = 280/315 (88%), Gaps = 7/315 (2%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREAT+DNVDFILS VDLA+ANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL + C+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+DI KEWP SKN EYEDPPN D+ FDYKAKA+TFYMNVE VGSIA 
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDA-MMMNG--HDGP 297
           DQVVLRGIDTLQKKVASI+LALNQMDQE+VNF T +  G  I++ G+  + M+G     P
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTG-AIQDAGNVDVAMDGVQDQNP 299

Query: 298 YGDNGRSSDTYGSAW 312
           Y + G +   Y  AW
Sbjct: 300 YSNGGGA---YDEAW 311

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/301 (81%), Positives = 271/301 (90%), Gaps = 1/301 (0%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQ+KIREAT+DNVDFILSN+D+ALANSLRRVMIAEIPTLAIDSVEVE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF++HRLGLIPLQS DI+QLEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWG  AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE D  KEWP SKNC+YEDPP + E FDYKAKA+TFYMNVEAVGSI  
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAM-MMNGHDGPYG 299
           DQV++RGIDTLQKK A I+LAL+QM+QEKVNF TG    N + +  D M M NG+D  YG
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNGNDASYG 300

Query: 300 D 300
           +
Sbjct: 301 N 301

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/308 (79%), Positives = 271/308 (87%), Gaps = 5/308 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA RDNVDFILSNV+LA+ANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DIE+LEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TCIAKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HT YWYE D  +EWP S+NCEYEDPP + EPFDYK+KA+TFYMNVE +GSI+V
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300
           DQVV+RGIDTLQKKVASI+L+L QM+QEK NFA G+    GIE  G+ +   G D  +  
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVP--GIE--GNMINSGGADTGFA- 295

Query: 301 NGRSSDTY 308
            G   D Y
Sbjct: 296 GGNDQDMY 303

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/299 (82%), Positives = 268/299 (89%), Gaps = 1/299 (0%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILS+VD+ALANSLRRVMIAEIPTLAIDSVEV TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGL+PLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTD+W+E+D  KEWPQSKNCEYEDPP++ E FDYKA+AD F    E VG+I+ 
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKG-NGIEEDGDAMMMNGHDGPY 298
           DQVVLRGIDTLQKKVASI+LAL QMDQ+KV +A     G  G+E +GD  M    + PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGNDPY 299

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/313 (78%), Positives = 277/313 (88%), Gaps = 4/313 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MS+EGPQVKIREAT+DNVDFI+SNVDLA+AN+ RRVMIAEIPTLAIDSVEV +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGL+PLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA+GESESTTNVY+KDL+I
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L+GRNIGHPIIQDKEGNGVLICKLRKGQELK TCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HT+YWYE+D  KEWPQSKNCEYEDPPN+   FDYKAKADTFYMNVE +G++  
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDG-PYG 299
           DQV++RGID LQKKVASI+LALN++DQ+KVN   G+   N  E DG+ + MNG +  PY 
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVN-YAGNNNVNNGEMDGEDITMNGTENDPYA 299

Query: 300 DNGRSSDTYGSAW 312
               +S  Y  AW
Sbjct: 300 SGNNNS--YDGAW 310

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  495 bits (1275), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/319 (75%), Positives = 269/319 (84%), Gaps = 11/319 (3%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREAT+D+VDFILSNVD+ALANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL CIAKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D+  EWPQSKNCEYEDPPN+D+ FDY AK +TFYM+VE VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNF--ATGDAKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGI TLQ KVA I+ +L +MDQE+VNF  A G+A    +  DG+  M +    PY
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSD----PY 296

Query: 299 GD-----NGRSSDTYGSAW 312
                  NG  S  +  AW
Sbjct: 297 TSNQDQYNGGPSAGFDDAW 315

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  490 bits (1261), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 231/296 (78%), Positives = 259/296 (87%), Gaps = 3/296 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREAT+DNVDFILSNVD+ +ANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF++HRLGLIPLQS+DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLMGRNIGHPIIQDK+GNGVLICKLRKGQELKL C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYW+E D   EWPQSKNCEYEDPPN+DE FDY AK  TFYMNVE VGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDG 296
           DQVV+RG+ TLQ KVA I+ +L +MDQ+KVNF         +++DG AM +    G
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG---GTAGMVDQDGGAMPVEPDSG 293

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/289 (79%), Positives = 261/289 (90%), Gaps = 3/289 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREAT+DNVDFILSNVD+A+ANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF++HRLGL+PLQS+DI  L Y RDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKL C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYW+E D   EWPQSKNCEYEDPPN+D+ FDY+AK  TFYMNVE+VGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAM 289
           DQVV+RG+ TLQ KVA I+ +L +MDQ+KVNF  G A G   E+DG AM
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF--GGAAGLA-EQDGGAM 286

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 230/312 (73%), Positives = 265/312 (84%), Gaps = 5/312 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDLALANSLRRVMI+EIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF+AHRLGLIPLQS DI+Q+ Y RDC+CEDHCD+CSV L L A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+++ CIAKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYWYE+D R EWPQSKNCE+EDPPN+DE FDY+AK +TFY+NVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300
           +QVV+RGI TLQ KVA I+ +L +MDQEKVNFA G    +  ++      M+ + GP G 
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPMEEDMDPYGGPVGG 300

Query: 301 NGRSSDTYGSAW 312
           +G     Y  AW
Sbjct: 301 SG-----YDDAW 307

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/314 (73%), Positives = 267/314 (85%), Gaps = 5/314 (1%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDL+LANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF++HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYW+E+D   EWP SKNCE+EDPPN+D+ FDY AK +TFYMNVE+VGSI  
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFA--TGDAKGNGIEEDGDAMMMNGHDGPY 298
           DQVV+RGI TLQ KVA I+ +L +MDQ+KV F   TGDA    +++D  +   +G    Y
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYS-ATSGRFNEY 299

Query: 299 GDNGRSSDTYGSAW 312
            DN  ++  Y  AW
Sbjct: 300 NDNAHAA--YDDAW 311

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/313 (72%), Positives = 263/313 (84%), Gaps = 3/313 (0%)

Query: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDL+LANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120
           EF++HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240
           DPWNKL+HTDYW+E+D   EWP SKNCE+EDP NDD+ FDY AK + FY+NVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMM-MNGHDGPYG 299
           DQVV+RGI TLQ KVA I+ +L +MDQ+KV F    ++   +E D D     NG    Y 
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300

Query: 300 DNGRSSDTYGSAW 312
           DN  ++  Y  AW
Sbjct: 301 DNTNTA--YDDAW 311

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 97.8 bits (242), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 139/286 (48%), Gaps = 43/286 (15%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           QV   E    N D I   +D +LAN+ RR+MIAE+P +A + V ++ NT+V+ DE LAHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--STDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESE--------------ST 110
           +GL+PL+     +E+L+ S     E H DK ++V+TL                     + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLLI--VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHA 168
            +VYA+DL     S+ +      P++       +L+ KLR GQE+ L+     G  K+HA
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDP--DILLAKLRPGQEISLSTHCILGEGKDHA 217

Query: 169 KWGPAAAIEFEYDPWNK-LQHTDYWYEEDIRKEWPQ-----SKNCE--YEDPPND----- 215
           K+ P A   +   P  + L+       +  +  +P+     ++N E    DP  D     
Sbjct: 218 KFSPVATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSRE 277

Query: 216 ---DEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
               E F+ K K     D F  NVE+ G++  + +VL+ ID L+KK
Sbjct: 278 VLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 97.4 bits (241), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 134/295 (45%), Gaps = 59/295 (20%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           ++ I        +F L N+D ++AN+ RR+MI+E+P++A++ V    NT+VL DE LAHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------ST 110
           +GL+PL+  D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLLIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKE 166
           +NVYA+DL       G+ +     +P++       +L+CKLR GQE+ L      GI  +
Sbjct: 160 SNVYARDLKFEP--QGKQVESFANYPVV--PANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL----------QHTDYW-------------YEEDIRKEWPQ 203
           HAK+ P A   +   P   +          +   Y+             Y +D RK+   
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SKNCEYEDPPNDDEPFDYKAKA----DTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
            +   + +       F+ K K     + F +NVE+ G++  +++  + +  L+ K
Sbjct: 276 REVFRHPE-------FEGKVKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 130/295 (44%), Gaps = 60/295 (20%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I   T    +F L +VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESES--------------TT 111
           GL+PL+  D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           ++YA+DL       G  +      P+I       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWGPAAAIEFEYDPW------------NKLQH------------TDYWYEEDIRKEWPQ 203
           AK+ P A   +   P              K Q             TD  Y +D RK+   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
            +   +E+       F  K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 REVLRHEE-------FSNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 130/302 (43%), Gaps = 65/302 (21%)

Query: 3   EEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   VKI        +F L ++D ++AN+ RR+MI+E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  LAHRLGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESES----------- 109
           LAHR+GL+PL+  D + L +      +D    D+ ++VLTL                   
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 110 ---TTNVYAKDLLIVSNLMGRNIGHPIIQDKEGNGVLIC-------KLRKGQELKLTCIA 159
               +NVYA DL       G+      ++    N V+ C       KLR GQE+ L    
Sbjct: 156 LYRNSNVYASDLKF--EPQGKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGIAKEHAKWGPAAAIEFEYDP---------------WNK--------LQHTDYWYEED 196
             GI  +HAK+ P A   +   P               + K        ++     Y +D
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQD 268

Query: 197 IRKEWPQSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQ 252
            RK+    +   +E+       F+ K K     D F  NVE+ G++  +++  + +  L+
Sbjct: 269 SRKDTVSREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILK 321

Query: 253 KK 254
            K
Sbjct: 322 NK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 132/299 (44%), Gaps = 61/299 (20%)

Query: 4   EGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFL 63
           E   + I   T    +F L ++D ++AN+ RR+MIAE+P++A + V    NT+V+ DE L
Sbjct: 38  ESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVL 97

Query: 64  AHRLGLIPLQSTDIEQLEYSRDCFC--EDHCDKCSVVLTLQAV------GESEST----- 110
           AHR+GLIPL+  D ++L +        E   D+ ++V+TL A          ++T     
Sbjct: 98  AHRIGLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVL 156

Query: 111 ---TNVYAKDLLI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKG 162
               +VYA+DL        + L        I  D     +LI KLR GQE+ L      G
Sbjct: 157 YRNAHVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCILG 211

Query: 163 IAKEHAKWGPAAAIEFEYDP---------------WNK--------LQHTDYWYEEDIRK 199
           I  +HAK+ P A   +   P               + K        +   D  + +D RK
Sbjct: 212 IGGDHAKFSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDARK 271

Query: 200 EWPQSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           +    +   +E+       F  K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 272 DTVSREVLRHEE-------FQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 130/285 (45%), Gaps = 61/285 (21%)

Query: 17  NVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRLGLIPLQSTD 76
           N+D I  NVD ++AN+LRR+MI+E+P++A + + +  NT+V+ DE +A R+GLIPL+  D
Sbjct: 39  NLDLI--NVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVIAQRIGLIPLK-VD 95

Query: 77  IEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STTNVYAKDLLI 120
            ++L +  +   ED    D+ ++VL+L                        ++YA+DL  
Sbjct: 96  PDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSILYHNAHIYARDLKF 155

Query: 121 VSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAI 176
                G+        P++       +LI KLR GQE+ L      GI  +HAK+ P    
Sbjct: 156 EPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILGIGADHAKFSPVCTA 211

Query: 177 EFEYDP---------------WNK--------LQHTDYWYEEDIRKEWPQSKNCEYEDPP 213
            +   P               + K        +   D  Y +D RK+    +   +E+  
Sbjct: 212 SYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKDTMTREVLRHEE-- 269

Query: 214 NDDEPFDYKAKADT----FYMNVEAVGSIAVDQVVLRGIDTLQKK 254
                F  K K D     F  N+E VG+++ +++ L+ +  L+ K
Sbjct: 270 -----FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 131/296 (44%), Gaps = 60/296 (20%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPW-NKLQH-----------------------TDYWYEEDIRKEWP 202
           HAK+ P +   +   P  N LQ                        +D  Y +D RK+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
             +   YE+       F  K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYEE-------FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 131/296 (44%), Gaps = 60/296 (20%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           +V I      + +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE LAHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAV------GESEST-------- 110
           +GL+PL+  D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLLIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ L      G+  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFANCPVL--PADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------QHTDYWYEEDIRKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +D RK+  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
             +   YE+       F  K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYEE-------FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 129/287 (44%), Gaps = 45/287 (15%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           +KI   +    +F L ++D ++AN+ RR+MI+E+P++A + V V  NT+V+ DE LAHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR  QE+ L      GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPW-NKLQHTDYWYEEDIRKEWPQ-------SKNCEYEDPPNDD--- 216
           AK+ P A   +   P  N L+       +  +  +PQ             E+   D    
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 217 -----EPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
                E F  K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRYEEFKDKVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 131/296 (44%), Gaps = 60/296 (20%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLLIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKE 166
            +VYA+DL       G+        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPW-NKLQ-----------------------HTDYWYEEDIRKEWP 202
           HAK+ P +   +   P  N LQ                        +D  Y +D RK+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
             +   Y++       F  K K     + F  NVE+ G++  +++  + +  L+ K
Sbjct: 276 SREVLRYDE-------FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 127/294 (43%), Gaps = 59/294 (20%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           VKI        +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESES--------------TT 111
           GL+PL+  D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLLIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           N+YA+ L       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNK-----------------------LQHTDYWYEEDIRKEWPQS 204
           AK+ P     +   P                          +      Y ED RK+    
Sbjct: 217 AKFSPVCTASYRLMPQINITEPITGESAKNLVRCFPPGVIGINEQGEAYVEDARKDTVSR 276

Query: 205 KNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           +   +E+       F+ K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHEE-------FEGKVKLGRVRDHFVFNVESAGAMTPEEIFFKSVRILKNK 323

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 124/285 (43%), Gaps = 38/285 (13%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE LAHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLLIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+ L      GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPAAAIEFEYDPW-NKLQHTDYWYEEDIRKEWP--------QSKNCEYEDPPNDD---EP 218
            P +   +   P  N LQ       +  +K +P         S+    +D   D    E 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 219 FDYKAKADT---------FYMNVEAVGSIAVDQVVLRGIDTLQKK 254
             Y+  AD          F  NVE+ G++  +++  + +  L+ K
Sbjct: 280 LRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 131/297 (44%), Gaps = 60/297 (20%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I   +    +F L N+D ++AN+ RR+MI+E+P++A + V   TNT+V+ DE LAHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D  +VV++L                       +
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 112 NVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           +VYAKDL       G+ +      P++       +L+ KLR  QE+ L      G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDPWNKL------------------------QHTDYWYEEDIRKEWPQ 203
           AK+ P +   +   P   +                        + T   Y +D RK+   
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNCEYEDPPNDDEPFDYKAKA----DTFYMNVEAVGSIAVDQVVLRGIDTLQKKVA 256
            +   +E+       F+ K K     D F  NVE+ G++  +++  + +  L+ K +
Sbjct: 277 REVLRHEE-------FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 133/289 (46%), Gaps = 49/289 (16%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I       V+F L +VD ++AN+ RR+MI+E+P++A + V    NT+VL DE LAHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQ--------AVGESE------STT 111
           GL+PL+  D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWGPAAAIEFEYDPWNKLQHTDYWYEEDIRKE---WPQ------SKNCEYEDPPNDD-- 216
           AK+ P +   +   P   +Q T     +D +K    +P+       K   Y   P  D  
Sbjct: 217 AKFSPVSTASYRLLP--HIQITQPITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTV 274

Query: 217 -------EPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
                  + F  K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 275 SREVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 87.0 bits (214), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 95/196 (48%), Gaps = 27/196 (13%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I   T    +F L ++D ++AN+ RR+MI+E+P+LA + V    NT+V+ DE LAHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESES--------------TT 111
           GL+PL+  D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLLI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+ L      G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDP 182
           HAK+ P A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 87.0 bits (214), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 133/299 (44%), Gaps = 66/299 (22%)

Query: 7   QVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHR 66
           +V+I        +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE LAHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFC--EDHCDKCSVVLTLQAV------GESEST-------- 110
           +GLIPL+  D + L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLLIVSNLMGRNI----GHPII---QDKEGNGVLICKLRKGQELKLTCIAKKGI 163
           ++VYA DL       G+ I    G P++   QD     +L+ KLR GQE+ L      G 
Sbjct: 160 SSVYASDLKFEP--QGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 AKEHAKWGPAAAIEFEYDPW------------NKLQH------------TDYWYEEDIRK 199
             +HAK+ P +   +   P              K Q             +   + +D RK
Sbjct: 213 GGDHAKFSPVSTASYRLLPHINITKPIKGELAEKFQKCFLPGVIGIDNASGEAFVKDARK 272

Query: 200 EWPQSKNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           +    +   +E+       F+ K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 273 DTVSREVLRHEE-------FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNK 324

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 19  DFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRLGLIPLQSTDIE 78
           +F L NVD ++AN+ RR+MIAE+P++A + V    NT+V+ DE LAHR+GL PL+  D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYSRDCF--CEDHCDKCSVVLTLQAVGESES--------------TTNVYAKDLLIVS 122
            L +        E   D+ ++VLTL                        ++YA+DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLMGRNI--GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180
               R     +P++       +L+ KLR GQE+ L      GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DP 182
            P
Sbjct: 246 MP 247

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 126/291 (43%), Gaps = 53/291 (18%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I+       +F L  VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLLIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWGPAAAIEFEYDPW-NKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKAD 226
           AK+ P A   +   P+ N ++       E   K +P       E      E F   A+ D
Sbjct: 247 AKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINE----KGEAFVQDARKD 302

Query: 227 T-----------------------FYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           T                       F  NVE+ G++  +++  + +  L+ K
Sbjct: 303 TVSREVLRHPELEQKVKLGRVRDHFIFNVESAGAMTPEEIFFKSVRILKNK 353

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 25/195 (12%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           +KI      +  F L N+D ++AN+ RR+M+AE+P +A + V    NT+V+ DE LAHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLLIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P A   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 124/294 (42%), Gaps = 59/294 (20%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I        +F L NVD ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQAVGESES--------------TT 111
           GL PL+  D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLLIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           ++YA+DL       G+ +     +P++       VL+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLQHT-----------------------DYWYEEDIRKEWPQS 204
           AK+ P     +   P   +                             Y +D R +    
Sbjct: 217 AKFSPVCTASYRLMPHINITSPITGESAQKFAKCFSPGVIGINDEGEAYVKDARHDTVSR 276

Query: 205 KNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           +   +E+       F+ K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHEE-------FEGKVKLGRIRDHFIFNVESAGAMTPEEIFFKSVRILKNK 323

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 129/294 (43%), Gaps = 59/294 (20%)

Query: 8   VKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFLAHRL 67
           V+I        +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE LAHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLLIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEH 167
           ++Y++DL       G+ +     HP++       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWGPAAAIEFEYDP----WNKLQHTDYW-------------------YEEDIRKEWPQS 204
           AK+ P     +   P       +Q  D                     Y +D RK+    
Sbjct: 217 AKFSPVCTASYRLMPHIDILETIQGEDATKFVKCFPPGVAAIDEKGEAYIKDARKDTVSR 276

Query: 205 KNCEYEDPPNDDEPFDYKAK----ADTFYMNVEAVGSIAVDQVVLRGIDTLQKK 254
           +   + +       F+ K K     D F  NVE+ G++  +++  + +  L+ K
Sbjct: 277 EVLRHPE-------FEGKVKLGRVKDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>KNAG0K00350 Chr11 (56222..58627) [2406 bp, 801 aa] {ON} Anc_5.45
           YGR261C
          Length = 801

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 178 FEYDPWNKLQHTDYWYEEDIRKEWPQSKNCEYE 210
           FEY PWN    T   +E+DIRKE P     +Y+
Sbjct: 644 FEYIPWNSTLET---FEDDIRKETPLKDYAKYK 673

>ZYRO0D12012g Chr4 complement(1016679..1020464) [3786 bp, 1261 aa]
           {ON} similar to Q04183 YDR407C uniprot|Q05731
           Saccharomyces cerevisiae TRS120 Component of the
           targeting complex (TRAPP) involved in ER to Golgi
           membrane traffic
          Length = 1261

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 166 EHAKWGPAAAIEFEYDP--WNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEP----- 218
           EH ++  ++ IE    P  W K+Q  D  Y  + + EW ++K  ++ DPP   EP     
Sbjct: 855 EHLQFLHSSNIEQSIKPDYWKKMQLDDL-YGLETQLEWMKNKCIKFIDPPQRMEPHETCS 913

Query: 219 FDYK--AKADTFYMN 231
           FD +  A A  F+ N
Sbjct: 914 FDMEVDATATPFHFN 928

>Suva_13.59 Chr13 complement(88493..90265,90334..90459,90481..92013)
           [3432 bp, 1143 aa] {ON} YML091C (REAL)
          Length = 1143

 Score = 31.2 bits (69), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 119 LIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL 155
           LI+S + GR + H +I + + N V +  LR G  +KL
Sbjct: 809 LIISKIPGRELTHLVINNSKFNEVFVPNLRNGSMIKL 845

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,738,341
Number of extensions: 1471935
Number of successful extensions: 3040
Number of sequences better than 10.0: 52
Number of HSP's gapped: 3086
Number of HSP's successfully gapped: 53
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)