Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10626g3.485ON1070107049790.0
Suva_7.4133.485ON1037104429910.0
NDAI0G009903.485ON1054102829610.0
NCAS0E009503.485ON1052102729540.0
YGR125W3.485ON1036104229530.0
Smik_6.2213.485ON1036104129350.0
Skud_7.4363.485ON1036104229290.0
KNAG0B008603.485ON1088104827960.0
TDEL0D055303.485ON1031101327930.0
KAFR0C019103.485ON1020102227830.0
SAKL0F02926g3.485ON1050106127070.0
ZYRO0C07986g3.485ON102488227010.0
Kpol_480.183.485ON1057103726680.0
TBLA0C044403.485ON115090625770.0
TPHA0D042103.485ON104999625640.0
Kwal_55.212013.485ON1011102625560.0
KLTH0F14674g3.485ON1010103925320.0
KLLA0E04731g3.485ON106090423640.0
AFR304W3.485ON1015102122940.0
TDEL0C012808.99ON7275421291e-06
CAGL0L09207g8.99ON7255251263e-06
Suva_16.3228.99ON7425641211e-05
Skud_16.2868.99ON7452871202e-05
Kpol_467.118.99ON7442811192e-05
NCAS0B048008.99ON7245671192e-05
Smik_16.2418.99ON7442851174e-05
AGR213Cna 1ON6892021157e-05
ZYRO0F04796g8.99ON7351241112e-04
NDAI0B022108.99ON7065381093e-04
KNAG0D023908.99ON7163781085e-04
Ecym_7084na 1ON6892041030.002
KLTH0G16764g8.99ON7104061030.002
SAKL0B03124g8.99ON7442941000.004
Kwal_27.110398.99ON726323980.007
SAKL0H08800gna 1ON620288920.034
YPR003C8.99ON754563920.040
KLLA0E14059g8.99ON706270860.19
TPHA0H007208.99ON787128800.99
TBLA0C052708.99ON77683791.3
Smik_12.1258.26ON27388771.5
YLR064W (PER33)8.26ON27388761.9
Ecym_24648.796ON69772762.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10626g
         (1070 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1922   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1156   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1145   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1142   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1142   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1135   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1132   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1081   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1080   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1076   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1047   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1045   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1032   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   997   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   992   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...   989   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...   979   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   915   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   888   0.0  
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    54   1e-06
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    53   3e-06
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    51   1e-05
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    51   2e-05
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    50   2e-05
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    50   2e-05
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    50   4e-05
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    49   7e-05
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    47   2e-04
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    47   3e-04
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    46   5e-04
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    44   0.002
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    44   0.002
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    43   0.004
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    42   0.007
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    40   0.034
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    40   0.040
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    38   0.19 
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    35   0.99 
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    35   1.3  
Smik_12.125 Chr12 (246209..247030) [822 bp, 273 aa] {ON} YLR064W...    34   1.5  
YLR064W Chr12 (265456..266277) [822 bp, 273 aa] {ON}  PER33Prote...    34   1.9  
Ecym_2464 Chr2 (905108..907201) [2094 bp, 697 aa] {ON} similar t...    34   2.9  

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1922 bits (4979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 955/1070 (89%), Positives = 955/1070 (89%)

Query: 1    MKSPQQRRKNXXXXXXXXXXXXXXXQYPEGNRDGSIDRLNESNSLNVNARPNTKNVGIPN 60
            MKSPQQRRKN               QYPEGNRDGSIDRLNESNSLNVNARPNTKNVGIPN
Sbjct: 1    MKSPQQRRKNSILSISESISVSLGLQYPEGNRDGSIDRLNESNSLNVNARPNTKNVGIPN 60

Query: 61   NDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDG 120
            NDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDG
Sbjct: 61   NDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDG 120

Query: 121  TIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKTPVSINLKRATDPELEQQT 180
            TIGESPSSLKEY                        ITDNKTPVSINLKRATDPELEQQT
Sbjct: 121  TIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLITDNKTPVSINLKRATDPELEQQT 180

Query: 181  VALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAWM 240
            VALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAWM
Sbjct: 181  VALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAWM 240

Query: 241  TLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIY 300
            TLKRVTNYMP              SYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIY
Sbjct: 241  TLKRVTNYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIY 300

Query: 301  SSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFY 360
            SSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFY
Sbjct: 301  SSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFY 360

Query: 361  LLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSM 420
            LLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSM
Sbjct: 361  LLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSM 420

Query: 421  LFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIF 480
            LFKW           VTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIF
Sbjct: 421  LFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIF 480

Query: 481  PAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKY 540
            PAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKY
Sbjct: 481  PAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKY 540

Query: 541  DVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGP 600
            DVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGY            GP
Sbjct: 541  DVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYVLIVLTIMVMVIGP 600

Query: 601  VIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVV 660
            VIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVV
Sbjct: 601  VIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVV 660

Query: 661  GILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFF 720
            GILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFF
Sbjct: 661  GILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFF 720

Query: 721  GTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKR 780
            GTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKR
Sbjct: 721  GTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKR 780

Query: 781  IKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQ 840
            IKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQ
Sbjct: 781  IKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQ 840

Query: 841  RRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQ 900
            RRSKNINAAIGNQLRRYDQTNKNQGPT             TPRNYQLVSAAQQAFSNEQQ
Sbjct: 841  RRSKNINAAIGNQLRRYDQTNKNQGPTSSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQ 900

Query: 901  ISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXX 960
            ISTEIDTKLKIPDP           YRPNIVSMDTEKRTDEVEFWKQLCPYFTRKV    
Sbjct: 901  ISTEIDTKLKIPDPLLKVLLFALKLYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTAN 960

Query: 961  XXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVE 1020
                       LVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVE
Sbjct: 961  TTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVE 1020

Query: 1021 TDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070
            TDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA
Sbjct: 1021 TDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1044 (57%), Positives = 726/1044 (69%), Gaps = 44/1044 (4%)

Query: 44   SLNVNARPNTKNVGIPNNDTNTF---LGRSYVSGIL-GSSLPQGGERN--TLPVSNKFGS 97
            SL +N + ++KN  I     +T    L RSY+SG   G S P     +   LP SNK   
Sbjct: 21   SLGINYQDSSKN-KIHRASASTMSPPLCRSYMSGFFTGGSSPMNYNMSDPKLPFSNKQHP 79

Query: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXI 157
            + IH    LHRQTA ++ EF   ++ E+  ++K+Y                         
Sbjct: 80   KVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS------------------- 120

Query: 158  TDNKTPVSI-NLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYE--QE 213
             D K   S+  ++   D E  ++ +  LL+P+SSN D+  + + +    S TS+ E    
Sbjct: 121  DDRKDDQSMRTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQG---SPTSDLEDGHG 177

Query: 214  STYQSITVVPSAGFRQMPTSTTAKAWMTL--KRVTNYMPXXXXXXXXXXXXXXSYGMIIF 271
              YQS+   PS   R  P S     W T    +   Y+P              SYGMIIF
Sbjct: 178  GGYQSVH--PSHDLRFGPRSVW--QWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIF 233

Query: 272  PITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQ 331
            PITEP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSG+GSEMIEITPFYHTMAL I +
Sbjct: 234  PITEPVFSHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKE 293

Query: 332  ALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLI 391
            AL G DDEIITTTIFCYVISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGVGYFLI
Sbjct: 294  ALVGSDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLI 353

Query: 392  ITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFY 451
            ITG+EVTTR+AKFEYS PF++ LF +   L KW            TQ+CFKNSLVLP+FY
Sbjct: 354  ITGIEVTTRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFY 413

Query: 452  IITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIP 511
            I+TL+LFHF+VAI P LSL  LR +GWIFP     SKWYDHY+ F+I K HW+LV++QIP
Sbjct: 414  ILTLVLFHFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIP 473

Query: 512  TMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNS 571
            TM+ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGL GSVQNYLVYTNS
Sbjct: 474  TMMALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNS 533

Query: 572  VLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPF 631
            VLFIRAGADS+ AG+            GPVIISFIPICIVGSLIFLLGYELLVEA++D +
Sbjct: 534  VLFIRAGADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTW 593

Query: 632  GKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKST 691
             K+  FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQTVNGE++G VAKST
Sbjct: 594  SKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKST 653

Query: 692  VYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLIL 751
            VYRD+ QT+FL  IGEQIYVLKLQN+LFFGTIISIEEKIERLLEIS+ D +K RIK+LIL
Sbjct: 654  VYRDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLIL 713

Query: 752  DFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFN 811
            DFKNINADNIDYSAAEGFNRIKR+TE KRIKLIIS+I+E D IY+ FN VGLL D+ELF 
Sbjct: 714  DFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFA 773

Query: 812  DLNSALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGP 866
            DLN ALEWCENEFL+QYK+LREKA+ +L+ R +N     I AA  N+       + N+G 
Sbjct: 774  DLNGALEWCENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGG 833

Query: 867  TXXXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXY 926
                          TPRN+Q++S AQ  F+N++Q    +  + K  +P           Y
Sbjct: 834  NRDQARHLMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQY 893

Query: 927  RPNIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPA 986
            RP+IVS   + R  E++FW QLCPYF+R+                L++ G+LK +Y LP 
Sbjct: 894  RPDIVSEVQKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQ 953

Query: 987  GSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTE 1046
            GS+YE +SNGTC+GKI++  +     Q L ++ ETD+ILW+ID  S++ MK +N+ LY E
Sbjct: 954  GSLYEIMSNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVE 1013

Query: 1047 LVLLILAIRDTRFKELLGYTLVSA 1070
            + L+I+ I+DTRFKELLGYTLVSA
Sbjct: 1014 VTLMIMCIKDTRFKELLGYTLVSA 1037

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1145 bits (2961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/1028 (58%), Positives = 721/1028 (70%), Gaps = 35/1028 (3%)

Query: 61   NDTNTFLGRSYVSGILGSS--LPQGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFD 118
            +DT+ +LGRSYVSG L +S  +      NTLP++N+  +++IH    LHRQTAAI+E+F+
Sbjct: 44   SDTSNYLGRSYVSGFLSASPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFN 103

Query: 119  DGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKTPVSINLKRATDP---- 174
            +    E   ++KEY                          DN+  +   L    +P    
Sbjct: 104  NDPTFEDDINMKEYISNLEDDATGNNGKRYTAYY-----IDNEDRIDNILTEEAEPVTDF 158

Query: 175  -ELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQE-------STYQSITVVPSAG 226
               ++ +  LL+P  S+     S+   EN L + S  EQE       S YQSI    S  
Sbjct: 159  YPQDENSRLLLSPIPSD-----SLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSES 213

Query: 227  FRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGI 286
                   T  K   T   +  Y+P              SYGMIIFPITEPIF+ LGPTGI
Sbjct: 214  TEYSSIPTWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGI 273

Query: 287  SMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP-GRDDEIITTTI 345
            SMFYISTIISQ I+S GWSSFP GIGSEMIE+TPF+HTMA AI  ALP G +D+IITTT+
Sbjct: 274  SMFYISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTL 333

Query: 346  FCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFE 405
            FCYVISS++TGLTFY LGKL LGKIVGFFPRHILIGCIGGVGYFLIITG+EV+TR+AKF+
Sbjct: 334  FCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQ 393

Query: 406  YSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIA 465
            Y+IPF+T LF D   L++W           + QKC +NSLVLPSFYI+TLILFHF+VAI 
Sbjct: 394  YTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAII 453

Query: 466  PNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVP 525
            P+LSL+QLR +GWIFP     SKWYDHY+ F++ K HW+L++KQIPTMLALTFFGILHVP
Sbjct: 454  PSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVP 513

Query: 526  INVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAG 585
            INVPALAMSLQMD+YDVDKELIAHG SNF SG+FGS+QNYLVYTNSVLFIRAGADSA+AG
Sbjct: 514  INVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAG 573

Query: 586  YXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGII 645
            +            GPVIISFIPICIVGSLIFLLGYELLVEA++DP GK++ FEY TI II
Sbjct: 574  HILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVII 633

Query: 646  VLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQI 705
            V TMGIFDFVLG++VGILIACFSFL+DSTKLQT+NGEFDGTVAKSTVYRD  QT+FL+ I
Sbjct: 634  VFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGI 693

Query: 706  GEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSA 765
            GEQIYVLKLQN+LFFGTIISIEEKI++LLEISD D SKHRIK+LILDFKNINADNIDYSA
Sbjct: 694  GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSA 753

Query: 766  AEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFL 825
            AEGFNRIKR+T+ KRI+LIIS+IRE D IY+ FN VGLL+ +ELFNDLNSALEWCENEFL
Sbjct: 754  AEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFL 813

Query: 826  YQYKELREKARNKLQRRSK-NINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRN 884
            ++YK LREK R K  R++K +IN AI N     ++    + P              TPRN
Sbjct: 814  FKYKTLREKTRQK--RKNKIDINLAITNGNPTEERNMHLEIP-----RNIMSLPMNTPRN 866

Query: 885  YQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEF 944
             Q++S AQ  F NE+Q +  +  + K               YRP IVS D      E++F
Sbjct: 867  NQMLSVAQNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKF 926

Query: 945  WKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILS 1004
            W QLCPY + +                +V++GILK  + LP+G++YET+SN TCYGKIL 
Sbjct: 927  WSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILG 986

Query: 1005 KRDNENI--NQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKEL 1062
              +   +   Q+L ++ ETD  LW+ID  ++  M+ +N+ LY ELVLLI++IRDTRFKEL
Sbjct: 987  SNNETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKEL 1046

Query: 1063 LGYTLVSA 1070
            LGYTLVSA
Sbjct: 1047 LGYTLVSA 1054

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1142 bits (2954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1027 (57%), Positives = 725/1027 (70%), Gaps = 33/1027 (3%)

Query: 60   NNDTNTFLGRSYVSGILGSSLPQGG----ERNTLPVSNKFG----SRAIHEQNKLHRQTA 111
            N + N ++GRSYVSG L  S    G    +  +LP++   G    +R IH   KLH+QTA
Sbjct: 43   NVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTA 102

Query: 112  AIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXI-TDNKTPVSINLKR 170
            AI+E+       E  + +K+Y                        +  D +         
Sbjct: 103  AISED---FEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPV 159

Query: 171  ATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSI--TVVPSAGFR 228
            A   ++++ +  L++P SSN      ++P  + L  T   E  S+YQSI  T  PS    
Sbjct: 160  AEAADVDESSRLLISPLSSN------INPNIDDLLPTVTGEDVSSYQSIYRTATPSL--- 210

Query: 229  QMPTSTTAKAWMTLK----RVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPT 284
               +  +   W  +     +  +Y+P              SYGMIIFPITEPIF+ LGPT
Sbjct: 211  ---SRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPT 267

Query: 285  GISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTT 344
            G+SMFYISTIISQ IYSSGWSSFPSGIGSEMIE+TPF+HTMALAI + LPGRDDEIITTT
Sbjct: 268  GLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTT 327

Query: 345  IFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKF 404
            IFCYVISS++TGLTFY LGKL LGKIVGFFPRHILIGCIGGVGYFL++TG+EVTTR+AKF
Sbjct: 328  IFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKF 387

Query: 405  EYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAI 464
            EYSIPFL  LF D + L+KW           VTQ+CFKNSLVLPSFYI+TLILFHF+VAI
Sbjct: 388  EYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAI 447

Query: 465  APNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHV 524
             P+L+L+QLR +GWIFP    +SKWYDHY+ FD  K HW+LV KQIPTMLALTFFGILHV
Sbjct: 448  IPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHV 507

Query: 525  PINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIA 584
            PINVPALAMSL +DKYDVDKELIAHG SNF SG  GS+QNYLVYTNSVLFIRAGADSA+A
Sbjct: 508  PINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMA 567

Query: 585  GYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGI 644
            GY            GPVIISFIPICIVGSLIFLLGYELLVEA+ DP+GK++ FEY TI I
Sbjct: 568  GYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVI 627

Query: 645  IVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQ 704
            IVLTMGIFDFVLGI+VGILIACFSFL+DSTKLQT+NGE+DGTVAKSTVYRD  QT+FL+ 
Sbjct: 628  IVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNG 687

Query: 705  IGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYS 764
            IGEQIYVLKLQN+LFFGTIISIEEKI+ LLEI   D S+ RIK+LILDFKNINADNIDYS
Sbjct: 688  IGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYS 747

Query: 765  AAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEF 824
            AAEGFNRIKR+T+ K+I+L+IS+I+E D IY  F+ VGLL+ +ELFNDLNSALEWCENEF
Sbjct: 748  AAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEF 807

Query: 825  LYQYKELREKARNKLQRRS-KNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPR 883
            L++YK+LR+KA+++L R+   +INA+IG+Q  ++   N ++                TPR
Sbjct: 808  LFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGN-DKKSNLDIPRNLMSLPINTPR 866

Query: 884  NYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVE 943
            N+Q++S AQ  F NE+Q    + T+LK   P           YRP I+S D   + +E++
Sbjct: 867  NHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIK 926

Query: 944  FWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKIL 1003
            FW QLCPYF +                 +V+ GILK  +NLP G++YET+SN TCYGKI 
Sbjct: 927  FWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI- 985

Query: 1004 SKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELL 1063
            + + NE+  + L ++ E D+ILW+ID  S+  M+ +N  L+TEL LLI+A++D RFKELL
Sbjct: 986  TGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELL 1045

Query: 1064 GYTLVSA 1070
            GYTLVSA
Sbjct: 1046 GYTLVSA 1052

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1042 (56%), Positives = 713/1042 (68%), Gaps = 39/1042 (3%)

Query: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL---GSSLPQGGERNTLPVSNKF 95
            +N+ +S+N   R +   +  P       L RSY+SG      S +      + LP+SNK 
Sbjct: 24   INQDSSVNKMHRASVSAMSPP-------LCRSYMSGFFTGGNSPMINNLSDSKLPISNKQ 76

Query: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXX 155
              + IH    LHRQTA ++ EF   ++ E+  ++K+Y                       
Sbjct: 77   HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGN----------------- 119

Query: 156  XITDNKTPVSI-NLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQE 213
               D K   S+  ++   D E  ++ +  LL+P+SSN D+  +   + + L    +    
Sbjct: 120  --GDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELED-GYA 176

Query: 214  STYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPI 273
              YQS+   PS   R  P +          +  +Y+P              SYGMIIFPI
Sbjct: 177  GGYQSLR--PSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPI 234

Query: 274  TEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQAL 333
            TEP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSGIGSEMIEITPFYHTMALAI +AL
Sbjct: 235  TEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEAL 294

Query: 334  PGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 393
             G DDEIITTTIFCYVISS++TG+ FY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT
Sbjct: 295  AGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 354

Query: 394  GLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYII 453
            G+EVTTR+AKFEYS PF + LF D   L KW            TQ+ FKNSLVLPSFYI+
Sbjct: 355  GIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYIL 414

Query: 454  TLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTM 513
            TL+LFHF+VAI P LSL  LR+ GWIFP     SKWYDHYR F++ K HWSLV++QIPTM
Sbjct: 415  TLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTM 474

Query: 514  LALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVL 573
            +ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVL
Sbjct: 475  MALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVL 534

Query: 574  FIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGK 633
            FIRAGADS  AG+            GPVIISFIPICIVGSLIFLLGYELLVEA++D + K
Sbjct: 535  FIRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNK 594

Query: 634  VTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVY 693
            +  FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VA+STVY
Sbjct: 595  LNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVY 654

Query: 694  RDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDF 753
            RD+ QT+FL  IGEQIYVLKLQN+LFFGTIISIEEKIERLL+IS+ D +K RIK+LILDF
Sbjct: 655  RDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDF 714

Query: 754  KNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDL 813
            KNINADNIDYSAAEGFNRIKR+TE KRIKLIIS+I+E DRIY+ FN VGLL D+ELF DL
Sbjct: 715  KNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADL 774

Query: 814  NSALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGPTX 868
            NSALEWCENEFL+QYK+LR+KA+ +L+   +N     + AA  N+         N+G   
Sbjct: 775  NSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNG 834

Query: 869  XXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRP 928
                        TPRNYQ++S AQ  F N++Q       + K  +P           YRP
Sbjct: 835  DTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRP 894

Query: 929  NIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGS 988
            +I+S   + R  E++FW QLCPYFTR+                LV+ G+LK  Y LP G+
Sbjct: 895  DIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGT 954

Query: 989  VYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELV 1048
            +YE  SNGTC+GKI++  +     Q L ++ ETD++LW+ID  S+  +K DN+ LY E+ 
Sbjct: 955  LYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVA 1014

Query: 1049 LLILAIRDTRFKELLGYTLVSA 1070
            L+++ I+DTRFKELLGYTLVSA
Sbjct: 1015 LMVMCIKDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1041 (56%), Positives = 708/1041 (68%), Gaps = 37/1041 (3%)

Query: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL---GSSLPQGGERNTLPVSNKF 95
            +N+ +S+N   R +   +  P       L RSY+SG      S +      + LP+SNK 
Sbjct: 24   INQDSSINKMHRASVSAMSPP-------LCRSYMSGFFTGGNSPMINSMSDSKLPLSNKQ 76

Query: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXX 155
              + IH    LHRQTA ++ EF   ++ E+  ++K+Y                       
Sbjct: 77   HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS----------------- 119

Query: 156  XITDNKTPVSI-NLKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQES 214
               D K   S+  ++   D E   +   LL   +S+N N       +N L++    + E 
Sbjct: 120  --GDRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEG 177

Query: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPIT 274
             YQS+    S   R  P +          +  +Y+P              SYGMIIFPIT
Sbjct: 178  GYQSLR--SSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPIT 235

Query: 275  EPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP 334
            EP+F+ LGPTGISMFYISTIISQ +YS G SSFPSGIGSEMIEITPFYHTMALA+ +AL 
Sbjct: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALA 295

Query: 335  GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394
            G DDEIITTTIFCYVISS++TG  FY+LGKL+LGKIVGFFPRHILIGCIGGVGYFLIITG
Sbjct: 296  GDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITG 355

Query: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIIT 454
            +EVTTR+AKFEYS PF   LF +   L KW            TQ+ FKNSLVLPSFYI+T
Sbjct: 356  IEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILT 415

Query: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514
            L+LFHF+VAI P LSL  LR  GWIFP     SKWYDHY+ F++ K HWSLV++QIPTM+
Sbjct: 416  LVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMM 475

Query: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574
            ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVLF
Sbjct: 476  ALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLF 535

Query: 575  IRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634
            IRAGADS+ AG+            GPVIISFIPICIVGSLIFLLGYELLVEA+ID + K+
Sbjct: 536  IRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKL 595

Query: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694
              FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VAKSTVYR
Sbjct: 596  NRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYR 655

Query: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754
            D+ QT+FL  IGEQIYVLKLQN+LFFGTI+SIEEKIE+LL+IS+ D +K RIK+LILDFK
Sbjct: 656  DYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFK 715

Query: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814
            NINADNIDYSAAEGFNRIKR+TE K+IKLIIS+IRE DRIY+ FN VGLL D+ELF DLN
Sbjct: 716  NINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLN 775

Query: 815  SALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGPTXX 869
            SALEWCENEFL+QYK+LR KA+ +L+ R +N     + AA  N+         N+G    
Sbjct: 776  SALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNID 835

Query: 870  XXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPN 929
                       TPRNYQ++S AQ  F N++Q       + K  +P           YRP+
Sbjct: 836  PVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPD 895

Query: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSV 989
            I+S   + R  E++FW QLCPYFTR+                LV+ G+LK  Y LP G++
Sbjct: 896  IISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTL 955

Query: 990  YETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVL 1049
            YE  SNGTC+GKI++  +     Q L ++ ETD+ILW+ID  S++ MK +N+ LY E+ L
Sbjct: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVAL 1015

Query: 1050 LILAIRDTRFKELLGYTLVSA 1070
            +++ I+DTRFKELLGYTLVSA
Sbjct: 1016 MVMCIKDTRFKELLGYTLVSA 1036

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1042 (56%), Positives = 715/1042 (68%), Gaps = 39/1042 (3%)

Query: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL-GSSLP--QGGERNTLPVSNKF 95
            +N+ +S N   R +   +  P       L RSY+SG   G S P  +    + LP SNK 
Sbjct: 24   INQDSSKNKMHRASVSAMSPP-------LCRSYMSGFFTGGSSPMVKNMSDSKLPFSNKQ 76

Query: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXX 155
                IH    LHRQTA ++ EF   ++ E+  ++K+Y                       
Sbjct: 77   HPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS----------------- 119

Query: 156  XITDNKTPVSI-NLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQE 213
               D K   S+  +    D E  ++ +  LL+P+SSN D+  + + +   +S   + +  
Sbjct: 120  --DDRKDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELED-DYG 176

Query: 214  STYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPI 273
              YQS+   PS   R  P +          +  +Y+P              SYGMIIFPI
Sbjct: 177  GGYQSLR--PSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPI 234

Query: 274  TEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQAL 333
            TEP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSGIGSEMIEITPFYHTMALA+  AL
Sbjct: 235  TEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDAL 294

Query: 334  PGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 393
             G DDEIITTTIFCYVISS++TG+ FY+LGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT
Sbjct: 295  EGNDDEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 354

Query: 394  GLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYII 453
            G+EVTTR+AKFEYS PF + LF +   L KW            TQ+ FKNSLVLP+FYI+
Sbjct: 355  GIEVTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYIL 414

Query: 454  TLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTM 513
            TL+LFHF+VAI P LSL  LR+ GWIFP     SKWYDHY+ F++ K HWSLV++QIPTM
Sbjct: 415  TLVLFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTM 474

Query: 514  LALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVL 573
            +ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVL
Sbjct: 475  MALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVL 534

Query: 574  FIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGK 633
            FIRAGADS+ AG+            GPVIISFIPICIVGSLIFLLGYELLVEA++D + K
Sbjct: 535  FIRAGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNK 594

Query: 634  VTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVY 693
            +  FEY T+ IIV TMG+FDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VAKSTVY
Sbjct: 595  LNRFEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVY 654

Query: 694  RDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDF 753
            RD+ QT+FL  IGEQIYVLKLQN+LFFGTIISIEEKIE+LL+IS+ D  K RIK+LILDF
Sbjct: 655  RDYVQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDF 714

Query: 754  KNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDL 813
            KNINADNIDYSAAEGFNRIKR+T  KRIKLIIS+I+E DRIY+ FN VGLL D+ELF DL
Sbjct: 715  KNINADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADL 774

Query: 814  NSALEWCENEFLYQYKELREKARNKL-QRRSKNINAAI--GNQLRRYDQTNK--NQGPTX 868
            NSALEWCENEFL+QYK+LREKA+ +L +R+  ++ +AI    Q ++ D      + G   
Sbjct: 775  NSALEWCENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENR 834

Query: 869  XXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRP 928
                        TPRNYQ++S AQ  F N++Q       + K  +P           YRP
Sbjct: 835  DHARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRP 894

Query: 929  NIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGS 988
            +I+S     R  E++FW QLCPYFTR+                LV+ G+LK  Y LP G+
Sbjct: 895  DIISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGT 954

Query: 989  VYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELV 1048
            +YE  SNGTC+GKI++  +     Q L ++ ETD++LW+ID  S++ MK +N+ LY E+ 
Sbjct: 955  LYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVT 1014

Query: 1049 LLILAIRDTRFKELLGYTLVSA 1070
            L+++ I+DTRFKELLGYTLVSA
Sbjct: 1015 LMVMCIKDTRFKELLGYTLVSA 1036

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1048 (54%), Positives = 702/1048 (66%), Gaps = 48/1048 (4%)

Query: 64   NTFLGRSYVSGILGSSLPQGGERNT------LPVSNKFG-SRAIHEQNKLHRQTAAIAEE 116
            +++LGRSYVSG+   +     +RN       LP SN+   S+ IH+   LHRQT AI E 
Sbjct: 48   SSYLGRSYVSGLWSPT-----QRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGEN 102

Query: 117  FDD--GTIGESPSSLKEYXXXXXXXXXXXXXXXXX------XXXXXXXITDNKT-PVSIN 167
            F D  G  G     L EY                              +  NKT PV+  
Sbjct: 103  FSDSNGDEGSENKDLNEYIDLVEHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSP 162

Query: 168  LKRATDPELEQQTVALLTPSSSNN---DNYGSVSPEENFLSATSNYEQ-ESTYQS----I 219
            L        ++ +  LLTP SS +    +  S++PE+    A S      STY S    +
Sbjct: 163  LSDEYGIP-DENSRLLLTPVSSLSVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTL 221

Query: 220  TVVPSAGFRQMPTSTTAKAWMTL--KRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPI 277
            +   SAG +  P  T+   +++     + +Y+P              SYGMIIFPITEPI
Sbjct: 222  SSYSSAGMKIGPPITSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPI 281

Query: 278  FAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQAL-PGR 336
            F+QLGP+G+SMFYIST+ISQF YSSGWSSFP GIGSEMIE+TPF+HTMAL I + L   R
Sbjct: 282  FSQLGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEER 341

Query: 337  DDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLE 396
             +EIITTTIFCYVISS+ TGLTF+ LGKL+LGK+VGFFPRHILIGCIGGVGYFL+ITG+E
Sbjct: 342  KNEIITTTIFCYVISSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIE 401

Query: 397  VTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLI 456
            V TRIAKFEYSIPFL  LF D   LF+W            TQ  F+NSLVLPSFYI+TLI
Sbjct: 402  VCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLI 461

Query: 457  LFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLAL 516
            LFHF+VAI PNLSL +LR +GWIFP    +  WYDHY+YF+    HW+LV+KQIPTM+AL
Sbjct: 462  LFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMAL 521

Query: 517  TFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIR 576
            TFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGLFGS++NYLVYTNSVLFIR
Sbjct: 522  TFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIR 581

Query: 577  AGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTT 636
            AGADSA+AGY            GPVIISFIPICIVGSLIFLLGYELL+EA++D +GK+ T
Sbjct: 582  AGADSALAGYILIVLTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNT 641

Query: 637  FEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDF 696
            FEY T+GII+LTMGIFDFVLGI+VGILIACF FL+DST LQTVNGEF G VAKSTVYRD 
Sbjct: 642  FEYVTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDP 701

Query: 697  TQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNI 756
             QT FL  +GEQIYVLKLQN+LFFGTIISIEEKI++LLEIS+ND SK RIK+LILDFKNI
Sbjct: 702  IQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNI 761

Query: 757  NADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSA 816
            N DNIDYSAAEGFNRI+R+T+ K I+LIIS+IRE D IY  FN VGLL+D+ELF DLNS+
Sbjct: 762  NTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSS 821

Query: 817  LEWCENEFLYQYKELREKARNKLQRRSKNINAAI-------GNQLRRYDQTNKNQGPTXX 869
            LEWCENE L+ Y ELR KA+ +L++ +   N+ +         Q+     T+ +Q     
Sbjct: 822  LEWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQS-GRA 880

Query: 870  XXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPN 929
                       TPRN+Q+++ AQ  F N++Q  + +  +LK  DP           YRP+
Sbjct: 881  AISNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPD 940

Query: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSV 989
            I S D   R  E+  W +LCPYF +K                LV  G+LK ++ LP G V
Sbjct: 941  IGSNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCV 1000

Query: 990  YETLSNGTCYGKILSK------RDNENIN-QNLRVQVETDTILWIIDEKSMEIMKMDNIV 1042
            YET++N TCYGKI+         D  N +   L +  ETD+ LW+ID  +M  ++ ++  
Sbjct: 1001 YETMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPE 1060

Query: 1043 LYTELVLLILAIRDTRFKELLGYTLVSA 1070
            L+ +L LL++ I+D RFK+LLG+ L+SA
Sbjct: 1061 LFIQLALLVMLIKDKRFKDLLGHALISA 1088

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1013 (54%), Positives = 696/1013 (68%), Gaps = 45/1013 (4%)

Query: 64   NTFLGRSYVSGILGSSLPQGG---ERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDG 120
            N +LGRSYVSG L  S P G    E + LP++ +  +++IH    LHRQTA + E+F++ 
Sbjct: 58   NNYLGRSYVSGFLSCS-PYGSNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEP 115

Query: 121  TIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKTPVSI-NLKRATDPELEQQ 179
             + ++  ++++Y                         T+   P+ I + +R  D E E  
Sbjct: 116  NVEDN--NIQDYVSA----------------------TEEPRPMEISDAERMYDQEDE-- 149

Query: 180  TVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAW 239
               L  P   N ++ G    E+ + S  +       Y++I   P  G R    S   + +
Sbjct: 150  ---LRNPVHVNTEDRGD-DIEDVYESLVTG--AHGGYRAIPTSPGGGLRTSSRSALWRQF 203

Query: 240  MTLK-RVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYISTIISQF 298
            M+   ++ +Y+P              SYGMIIFPITEPIF+ LGP+G+SMFY+STIISQ 
Sbjct: 204  MSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQV 263

Query: 299  IYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLT 358
            IYSSG+S+FP+G+GSEMIE+TPF+H+MALAI  ALPGRDDEI+TTTIFCYVISS++TGLT
Sbjct: 264  IYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLT 323

Query: 359  FYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDS 418
            FY+LGK++LGKIVGFFPRHILIGCIGGVGYFL++TGLEVTTR+AK EY+ PF++ +F D 
Sbjct: 324  FYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDV 383

Query: 419  SMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGW 478
            S L KW           VTQ+ F+NSLVLP+FYI TL+ FHFVVAI PN+SL +LR  GW
Sbjct: 384  STLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGW 443

Query: 479  IFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMD 538
            IFP      +WYDHY+ F   + HW L+ KQ PTMLAL+FFGILHVPINVPALA+SLQMD
Sbjct: 444  IFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMD 503

Query: 539  KYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXX 598
            KYDVDKELIAHGYSN  SG  GS+QNYLVYTNS+LFIRAGADSA+AGY            
Sbjct: 504  KYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVI 563

Query: 599  GPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGI 658
            GPVIIS+IPICIVGSLIFLLGYELL EA+I+  GKVT FEY TI IIVLTMGIFDFVLG+
Sbjct: 564  GPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGV 623

Query: 659  VVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNIL 718
            +VGILIACFSFLVDSTKLQT+NGE+DG +AKSTVYRD+ Q+RFL  IGEQIYVLKLQ++L
Sbjct: 624  IVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLL 683

Query: 719  FFGTIISIEEKIERLLEISDNDV-SKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTE 777
            FFGTIISIEEKI +LLEISD+   SK RIK LILD KNINADNIDYSAAEGFNRIKR+T+
Sbjct: 684  FFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQ 743

Query: 778  AKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARN 837
            +K I+LIIS+I E+D IY  F++V LL D+ELF DLN ALEWCENE L++YKELR KAR+
Sbjct: 744  SKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARD 803

Query: 838  KLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVSAAQQAFSN 897
            +LQ + +  N A  N  +  D       P              TPRN Q++S AQ+ F N
Sbjct: 804  RLQNKMQMANLAANNDTKAIDGV-----PKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKN 858

Query: 898  EQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVX 957
            EQ+    +    K   P           YRP I+S DT  +  E+E W +LCPYFTR+  
Sbjct: 859  EQKTVDSLKVNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRL 918

Query: 958  XXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRV 1017
                          +++ GILK++Y+LP G VYE+LSN TCYG +L+          + +
Sbjct: 919  ASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTI 978

Query: 1018 QVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070
            + ET+ +LW+ID   +  +K +N+ LYTEL+LLI  +++ R++++LGYTLVSA
Sbjct: 979  KTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1022 (56%), Positives = 698/1022 (68%), Gaps = 57/1022 (5%)

Query: 60   NNDTNTFLGRSYVSGILGSSLP-QGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEFD 118
            +N  + +L RSY+ G+L S+ P +  E NTLP+SN   +++IH+   LH+QTAAI E+F+
Sbjct: 43   SNSKSNYLSRSYMYGLLPSATPVEELETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN 102

Query: 119  DGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKT--PVSINLKRATDPEL 176
            +   G    S+K+Y                        I ++K   PV++ L    D E+
Sbjct: 103  ESDEG----SMKDYLDFIENTDRDN-------------INEHKESLPVTVVLSTPAD-EV 144

Query: 177  EQQTVA---LLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMPTS 233
            E+Q  +   LLTPSSSN +         +  S+      EST  +   +      Q   +
Sbjct: 145  EEQDESSRLLLTPSSSNAEVSSIAEGLRHHYSSI-----ESTKDNNMPIE----EQQDNT 195

Query: 234  TTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYIST 293
               K          Y P              SYGMIIFPI+EPIF+ LGPTG+SMFYIST
Sbjct: 196  INEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYIST 255

Query: 294  IISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRD--DEIITTTIFCYVIS 351
            II QFIYSSGWSSFPS IGSEMIEITPF+HTMA AI ++LPG +  D IITTTIFCYVIS
Sbjct: 256  IICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVIS 315

Query: 352  SVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFL 411
            S+ TGLTF  LGKLRLGKIVGFFPRHILIGCIGGVGYFL+ITG+EVTTRIAKFEYS+P +
Sbjct: 316  SMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLI 375

Query: 412  TKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLH 471
             +LF D+SML+KW           +TQKCFK SLVLPSFYI TLILFHF+VAI P LSL 
Sbjct: 376  KELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLT 435

Query: 472  QLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPAL 531
            QLR+ GWIF     +S WYDHY+ FD  K HW LV KQIPTMLALTFFGILHVPINVPAL
Sbjct: 436  QLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPAL 495

Query: 532  AMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXX 591
            AMS+QMDKYDVDKELIAHG SN  SG+FGS+QNYLVYTNSVLFIRAGADS  AGY     
Sbjct: 496  AMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFL 555

Query: 592  XXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGI 651
                   GPVIISFIPICIVGSLIFLLGYELLVEA++D + K+TTFEY T+ +IVLTMGI
Sbjct: 556  TIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMGI 615

Query: 652  FDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYV 711
             DFVLGI+VGILIACF FL+DS+KLQT+NGEF G VAKSTV RD  Q++FL+ IG+QIYV
Sbjct: 616  VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYV 675

Query: 712  LKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNR 771
            LKLQN+LFFGTIISIEEKI++LLE+SD + SK +IK+LILDF+NINADNIDYSAAEGFNR
Sbjct: 676  LKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNR 735

Query: 772  IKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKEL 831
            IKR TE+K I+LIIS+I+  DRIY+ FN+VGLL  +ELFNDLN ALEWCENEFLYQYK +
Sbjct: 736  IKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMI 795

Query: 832  REKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVSAA 891
            RE  R K++      +++ GN  +    T                    TPRNYQ+ S A
Sbjct: 796  RE--RIKIKNVKTATHSSDGNLSKPSAMT----------------LSINTPRNYQIYSVA 837

Query: 892  QQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPY 951
            Q  F NE+Q    +  + +   P           YRP+IVS+D  K+  E+EFW QL PY
Sbjct: 838  QNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPY 897

Query: 952  FTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSK----RD 1007
            F++K                LV+ G+LKV ++LP G VYET+S   CYGKI+ K      
Sbjct: 898  FSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEA 957

Query: 1008 NENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTL 1067
            +   +Q + ++ E DT++WIID  +++ MK +NI LY ELVLL++ I+D RFK LLG+ L
Sbjct: 958  DAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHAL 1017

Query: 1068 VS 1069
            VS
Sbjct: 1018 VS 1019

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1061 (52%), Positives = 700/1061 (65%), Gaps = 62/1061 (5%)

Query: 41   ESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQ---GGERNTLPVSNKFGS 97
             S+++   ++ N ++   P N +N +LGRSYV      S  Q     +   +   +K  S
Sbjct: 21   HSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQRESSADTGHILSLHKDAS 80

Query: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESPS---SLKEYXXXXXXXXXXXXXXXXXXXXXX 154
            ++IHE  KLHRQTAA++  FDD + G+S     +  +                       
Sbjct: 81   KSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQNEALQRELSLENGSYSNSNN 140

Query: 155  XXITDNKTPVSINLKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQES 214
                +N+   S +     +  L + T  LL+P+S+   +    +   N    +S YEQE 
Sbjct: 141  NNNNNNQIAYSEDAITQENNGLNECT-RLLSPTSAAATDLEYGTSPTNLSPPSSQYEQE- 198

Query: 215  TYQSITVV----PSAGFRQMPTSTTAKAWMTLK-------------------RVTNYMPX 251
              Q +++V    PS+      T     A+ T                     +  NYMP 
Sbjct: 199  --QYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYYDYAKGWSIKTLNYMPA 256

Query: 252  XXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGI 311
                         SYGMIIFPITEP+F+ LGPTG+SMFY+STI+SQ +YS G+S+F +GI
Sbjct: 257  VILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFSAFGNGI 316

Query: 312  GSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIV 371
            GSEMIEITPF+HTMAL+I  +LPG DDEII+TTI CY +SS+ TGL F+LLGKLRLGKIV
Sbjct: 317  GSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKLRLGKIV 376

Query: 372  GFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXX 431
            GFFPRHILIGC+GGVGYFL+ITG+EV TR++KFEYS PFL +LF ++ +L KW       
Sbjct: 377  GFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWMLPLILT 436

Query: 432  XXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYD 491
                VTQ  F NSLVLPSFYIITL LFHFVVAI PNLSL+ LR++GWIFP    S+ WYD
Sbjct: 437  LSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSNHWYD 496

Query: 492  HYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGY 551
             Y+ +D    HW+LV+KQ+PTMLALTFFGILHVPINVPALAMS+ MDK+DVDKELIAHGY
Sbjct: 497  FYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVDKELIAHGY 556

Query: 552  SNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIV 611
            SN  SG  GS+QNYLVYTNS LFIRAG+DS+ AG+            GPVIISFIPICIV
Sbjct: 557  SNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVIISFIPICIV 616

Query: 612  GSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLV 671
            GSLIFLLGYEL+ EA+ D +GK+  FEY TI IIV TMG+FDFVLGI+VGILIACFSFLV
Sbjct: 617  GSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIACFSFLV 676

Query: 672  DSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIE 731
            DSTKLQT+NGEF+G VA+STVYRD+ QT+FL+++GEQI+VLKLQN+LFFGTIISIEEKI+
Sbjct: 677  DSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIISIEEKID 736

Query: 732  RLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRES 791
             LLEISD D S+ RIK+LILDFKNINADNIDYSAAEGFNRIKR+TE KRI+LIIS+I E 
Sbjct: 737  GLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQLIISSITEK 796

Query: 792  DRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIG 851
            DRIY+ FN+VGLLQD+ELF DLNSALEWCENEFL QYK++R + + KLQ + K       
Sbjct: 797  DRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTKAKLQAQKK------- 849

Query: 852  NQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKI 911
                +    +K+  P              TPRN Q+V+ AQ+ F +EQ + T + T+ + 
Sbjct: 850  ----QEKHLSKSLLPI------------NTPRNNQIVTVAQKIFPDEQNV-THLRTQYQK 892

Query: 912  PDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXX 971
             +P           +RP I+S D + +  E +FW +LCPYF RK                
Sbjct: 893  REPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFF 952

Query: 972  LVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQV--ETDTILWIID 1029
            LV++G+LK+ Y+L  G  YET+S+ TCYG+I     N     NL V +  ETD  +WIID
Sbjct: 953  LVESGMLKITYDLHQGQFYETMSSKTCYGRI---SGNAEFTTNLYVNIKTETDCAVWIID 1009

Query: 1030 EKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070
              ++  +K  N+ LY EL+L++++I   R KELLGY+LVS+
Sbjct: 1010 ATNLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/882 (60%), Positives = 638/882 (72%), Gaps = 14/882 (1%)

Query: 200  EENFLSATSNYEQESTYQSITVVPSAGFRQMPTSTTAKAWMTL-----KRVTNYMPXXXX 254
            +EN  S+  +Y     YQ++       +     S TA+A  +      + V +Y P    
Sbjct: 146  DEN--SSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVL 203

Query: 255  XXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSE 314
                      SYGMIIFPITEPIF+ LG TG+SMFYISTIISQ +YS G SSF SGIGSE
Sbjct: 204  GLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSE 263

Query: 315  MIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFF 374
            MIE+TPF+HTMA AI  A+PG+DD+IITTTIFCY ISSV+TG+TFYLLGKLRLGKIVGFF
Sbjct: 264  MIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFF 323

Query: 375  PRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXX 434
            PRHILIGCIGGVGYFL+ITGL VTTR+AK EY+  FL KLFLD+ +L+KW          
Sbjct: 324  PRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILL 383

Query: 435  XVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYR 494
              TQKCF+NSLVLPSFYI+TLILFHFVVAI P++SL QLR  GWIFPA     +W+DHY+
Sbjct: 384  VNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYK 443

Query: 495  YFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNF 554
             FD  K HW+LV+ QIPTMLALTFFGILHVPINVPALA+SL MDK+DVDKELIAHGYSNF
Sbjct: 444  LFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNF 503

Query: 555  FSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSL 614
             SG+ GS+QNYLVYTNSVLFIRAGADS  AGY            GPVI+SFIPICIVGSL
Sbjct: 504  ISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSL 563

Query: 615  IFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDST 674
            IFLLGYELLVEA++D  GKVT FEY TI IIVLTMGI+DFVLG++VGILIACFSFLVDST
Sbjct: 564  IFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDST 623

Query: 675  KLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLL 734
            KLQT+NGEFDG VA+STV RD+ Q+ FL+ +GEQIYVLKLQN+LFFGTIISIEEKI++LL
Sbjct: 624  KLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLL 683

Query: 735  EISDN-DVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDR 793
            EI+D+   SK RIK+LILDFKNINADNIDYSAAEGFNRIKR+T+ KRIKLIIS+I+E D 
Sbjct: 684  EITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDH 743

Query: 794  IYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQ 853
            IY+VF+ VGLL D+ELFNDLN ALEWCENEFL +YK+LR++AR K+Q  S N+ +AI   
Sbjct: 744  IYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQ-HSYNVTSAIEAA 802

Query: 854  LRRYDQTNKNQ----GPTXXXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQI-STEIDTK 908
              +   T+ NQ      +             TPRN+Q++S AQ  F++E+ + + E ++ 
Sbjct: 803  AAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMFNDEEDVDALEDESC 862

Query: 909  LKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXX 968
                 P           YR NI S D   R  E + W QL PYF ++             
Sbjct: 863  NDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLHNQD 922

Query: 969  XXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWII 1028
               +V++G+LK+  +LP G VYET+SN TC G I+      +    + +  ETDT LW+I
Sbjct: 923  FFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCLWLI 982

Query: 1029 DEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070
            D   ++ ++ +N+ LYTELVLL L I+  RF++LLGYTLVSA
Sbjct: 983  DVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 45  LNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQ------GGERNTLPVSNKFGSR 98
           +N N   + + V  P  ++N + GRSY+ G   S+ P+        + + LP+ ++  S+
Sbjct: 50  INQNDSSSIEIVSPPFYNSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-DRSRSK 108

Query: 99  AIHEQNKLHRQTAAIAEEFDDGTIG 123
           +IH    +HRQTA ++  F D T G
Sbjct: 109 SIHGSQIIHRQTAELSNNFSDDTTG 133

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1037 (53%), Positives = 703/1037 (67%), Gaps = 37/1037 (3%)

Query: 48   NARPNTKNVGIPNNDTNTF-------LGRSYVSGILGSS----LPQGGERNTLPVSNKFG 96
            N  PN+ + G  +N T++        +GRSY   I  +S    L        LP+  K  
Sbjct: 44   NLAPNSYS-GYNDNTTSSVSNREFGRIGRSYAGSISSNSPSLYLNTSRTDELLPI-RKMP 101

Query: 97   SRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXX 156
            S++I   + LHRQTA I+ +F+D ++ E+   +K Y                        
Sbjct: 102  SKSILGPDALHRQTAEISNDFNDTSMDEA--KIKRYIELLNRKQIEAEEEGEESAVHLRP 159

Query: 157  IT--DNKTPVS-INLKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQE 213
             T  + K+ +S I    +    LEQ+  ALLTPSSS       +   E  L +T + E  
Sbjct: 160  HTFIEGKSFLSPIGSSASQLDGLEQR--ALLTPSSS-------IVGNEFDLESTYD-EIN 209

Query: 214  STYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPI 273
            + Y SI  + S   R++ +S+ A   + L    NY+P              SYGMIIFPI
Sbjct: 210  NDYNSILRIQS---RELTSSSFATKGLEL---LNYLPAAILGLLLNILDALSYGMIIFPI 263

Query: 274  TEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQAL 333
            TEP+F+ LGPTGISMFYISTI+ Q + S G+SSFP GIGSEMIEITPFYHTMA AI  AL
Sbjct: 264  TEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDAL 323

Query: 334  PGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT 393
            P +D+E+ITTTIFCYVISSV+TGL F++LGKL++GKIVGFFPRHILIGCIGGVGYFLIIT
Sbjct: 324  PNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIIT 383

Query: 394  GLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYII 453
            G+EV+TRI KFEY+  FL  L  +   L KW           + Q+  +NSLVLPSFYI+
Sbjct: 384  GIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYIL 443

Query: 454  TLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTM 513
            T+ILFHF+VAI PNLSL  LR+ GWIFP  +  + WYDHY+YF++   HW LV+KQIPTM
Sbjct: 444  TIILFHFIVAILPNLSLDHLRENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTM 503

Query: 514  LALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVL 573
            LALTFFGILHVPINVPALAMSL MDKYDVD+ELIAHGYSN  SGL GSVQNYLVYTNSVL
Sbjct: 504  LALTFFGILHVPINVPALAMSLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVL 563

Query: 574  FIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGK 633
            FIRAGADS+ AG+            G VI+SFIP+CIVGSLIFLLGYEL+VEA++D  G 
Sbjct: 564  FIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGT 623

Query: 634  VTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVY 693
            VT+FEY TI IIV  MGI+DFVLGI+VGILIAC SF+VD TKL+T+NGE+DG VAKSTVY
Sbjct: 624  VTSFEYITILIIVFIMGIYDFVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVY 683

Query: 694  RDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDF 753
            RD+ QT+FL+ I +QIY+LKLQN+LFFGTIISIEEKI++LLEISD D SK RIK+LILDF
Sbjct: 684  RDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDF 743

Query: 754  KNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDL 813
            KNINADNIDYSAAEGFNRIKR+T+ KRI+LIIS+I+E D+IY VFN V LL+D+ELF+DL
Sbjct: 744  KNINADNIDYSAAEGFNRIKRFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDL 803

Query: 814  NSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXX 873
            NSALEWCENEFLYQY +L EKA++++ +R   I+ +  +    + +   + G +      
Sbjct: 804  NSALEWCENEFLYQYMQLHEKAKDRIHKR---ISISKDSGSTYFSRNRSDSGLSAADQQM 860

Query: 874  XXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSM 933
                   TPRN Q++S A++ F NE Q +++  T  +   P           +RP++ S 
Sbjct: 861  LMSLPINTPRNNQVLSVARKVFKNEAQTASKFKTHNETDKPVLSLLLYSIRLFRPDVFSE 920

Query: 934  DTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETL 993
            D   R  E+ FW QL PYF R +               +V++G+++V ++LP G V ET+
Sbjct: 921  DVSIREKEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETM 980

Query: 994  SNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILA 1053
            SN TCYGK++  R        +  + ET++I+W+ID+ +M  +K +N+ LYTEL+LL++ 
Sbjct: 981  SNRTCYGKVVGHRGTVTNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMT 1040

Query: 1054 IRDTRFKELLGYTLVSA 1070
            IR+ R+K L+GYTLVSA
Sbjct: 1041 IREYRYKGLIGYTLVSA 1057

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/906 (56%), Positives = 644/906 (71%), Gaps = 40/906 (4%)

Query: 190  NNDNYGSVSP--------EEN--FLSATSNYE----QESTYQSITVVPSAGFRQMPTSTT 235
            +ND Y  + P        +EN  F S+++NY+    + + Y S + +P+       TS +
Sbjct: 260  DNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYIS-SSIPTTTDVTQSTSLS 318

Query: 236  AKAWMTLK--RVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYIST 293
             K  +T    ++ + +P              SYGMI+FPIT+ +F  LGPTG+SMFYIST
Sbjct: 319  FKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYIST 378

Query: 294  IISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRD-DEIITTTIFCYVISS 352
            IISQ +YS G+S+FPSG+G EMIEI PF+HTMAL +  ++P +D +EIITTTIFCYVIS 
Sbjct: 379  IISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISC 438

Query: 353  VITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLT 412
            + TG+ F+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TG+EVTTR+ K EYS+ FL 
Sbjct: 439  IFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLL 498

Query: 413  KLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQ 472
             +  + S LFK            + QK + +SL+LPSFYIIT I FHF+VA+ PNLSL  
Sbjct: 499  SVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDS 558

Query: 473  LRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALA 532
            LR TGWIFP  E S  WY HY+YF+    HW LV KQIPTM ALTFFGILHVPINVPALA
Sbjct: 559  LRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALA 618

Query: 533  MSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXX 592
            MS+QMDKYDVDKELIAHGYSN  SGLFGSVQNYLVYTNSVLFIRAG ++A AG       
Sbjct: 619  MSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFT 678

Query: 593  XXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIF 652
                  GPVIISFIP+CIVGSLIFLLG+EL+VEA++D +GKVT FEY TI IIV TMGI+
Sbjct: 679  AIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIY 738

Query: 653  DFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVL 712
            DFVLGI+VGILIACFSFLVDSTKLQTVNGEF+GTVAKSTVYRD+ Q++FLS I EQIYVL
Sbjct: 739  DFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVL 798

Query: 713  KLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRI 772
            KLQN+LFFGTIISIEEKI+ LLEISDND SK RIK+LILD KN+N+DNIDYSAAEGFNRI
Sbjct: 799  KLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNRI 858

Query: 773  KRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELR 832
            KR+T++KRI+LIIS+I+++D+IY +FN V LL+++ELF+DLN ALEWCENEFLYQY++++
Sbjct: 859  KRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYRQVK 918

Query: 833  EKARNKLQR--------RSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRN 884
             KAR + +R        R+  ++ ++ N L   D+ +    P              TPRN
Sbjct: 919  NKARARAKRKATSRDVVRTGYLSTSVSNTLN--DRKSSGNLPI------------NTPRN 964

Query: 885  YQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEF 944
            +Q+VS A+  F N +Q      T L    P           YR +I S D + R  EVEF
Sbjct: 965  HQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEF 1024

Query: 945  WKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILS 1004
            W QLCPYFT++                +V++G+LK+ +NLP GSVYET+SN TCYG+IL 
Sbjct: 1025 WSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILG 1084

Query: 1005 KRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLG 1064
            K   +     L ++ ETD I+W+I+ + ++ MK +N+ LYTEL LL+++++D RF  LLG
Sbjct: 1085 KGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFNNLLG 1144

Query: 1065 YTLVSA 1070
            Y L+SA
Sbjct: 1145 YALISA 1150

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 8/47 (17%)

Query: 89  LPVSNKFGSRAIHEQNKLHRQTAAIAEEF--------DDGTIGESPS 127
           LPV N F   +IH  + LH++TA I+ EF        DD    E+P+
Sbjct: 122 LPVINPFPKSSIHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPN 168

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/996 (51%), Positives = 663/996 (66%), Gaps = 52/996 (5%)

Query: 90   PVSNKFGSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXX 149
            P  NK   ++I   + LHRQTA +++ F D    +    +K+Y                 
Sbjct: 91   PPENKTSMKSITVADILHRQTAELSKTFYDSNFTDK--DVKDYID--------------- 133

Query: 150  XXXXXXXITDNKTPVSINLKRATDPE------LEQQTVALLT---PSSSNNDNYGSVSPE 200
                   I DN    S      + PE       +Q  +A+ T   P+ ++++    ++P 
Sbjct: 134  -------IIDNDVATSNESDSNSTPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLLTPS 186

Query: 201  ENFLSATSNYEQE-STYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXX 259
             + + A  + E     ++ + +  S+  RQ          +   ++ +Y P         
Sbjct: 187  SSIIGAELDLEAHYDEFEPVRMDASSINRQ-----NESKLIDFSQILHYFPAAVLGLLLN 241

Query: 260  XXXXXSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEIT 319
                 SYGMIIFPITEPIFA +G  GISMFYIS+II Q+I S G+SSFP+GIGSEMIEIT
Sbjct: 242  ILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEIT 301

Query: 320  PFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHIL 379
            PFYHTMALAI  +L  ++ EII+TTIFCYVISS++TGL FY LGKL+LGKIV FFPRHIL
Sbjct: 302  PFYHTMALAIKNSLDVQE-EIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHIL 360

Query: 380  IGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQK 439
            IGCIGGVGYFL++TGLEVTTR+AK EYS  FL+ L  D +++ KW            TQ 
Sbjct: 361  IGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQH 420

Query: 440  CFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIG 499
             F+NSLVLPSFYIIT+ILFHF+VA+ P LSL++LR +GWIFP    + KW+DHY+YF++ 
Sbjct: 421  HFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVY 480

Query: 500  KAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLF 559
               W L++KQ+PTMLALTFFGILHVPINVPALAMSL +DK+DVD+E IAHGYSNF SGLF
Sbjct: 481  NVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLF 540

Query: 560  GSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLG 619
            GSVQNYLVYTNSVLFIRAGADS IAGY            GPVIISFIPICIVGSLIFLLG
Sbjct: 541  GSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLG 600

Query: 620  YELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTV 679
            YELL+EA++D  GKVT FEY TI IIV TMGI+DFVLGI+VGIL+AC  F+VD TKLQT+
Sbjct: 601  YELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTI 660

Query: 680  NGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDN 739
            N E+DGT+AKSTVYRDF Q++FL  IGEQIY++KLQN+LFFGTIISIEEKI+ LL++SD+
Sbjct: 661  NTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDS 720

Query: 740  DVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFN 799
            D SKHRI++LILDFKNIN DNIDYSAAEGFNRIKR+T  + IKLIIS+I  +D+IY  FN
Sbjct: 721  DSSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFN 780

Query: 800  QVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQRR-----SKNINAAIGNQL 854
            ++GLLQDIELF+DLN+ LEWCEN++L +Y+EL EKA+ +L  R      KNI++      
Sbjct: 781  KIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISS------ 834

Query: 855  RRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDP 914
            R+ + T+ + G               TPRN+QL+S A+  F NE Q  +         D 
Sbjct: 835  RQINSTSSD-GNEYQSSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDA 893

Query: 915  XXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVD 974
                       +RP++ S   + R  E++FW QL PYF +                 L+D
Sbjct: 894  FTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLD 953

Query: 975  AGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSME 1034
            +G++KV ++L  G + ET+ + T YG + SK +       +    ET +++W+ID + ++
Sbjct: 954  SGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLK 1013

Query: 1035 IMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070
             M+ +N+ LY+EL LLI++I D RFK LLGYTLV+A
Sbjct: 1014 KMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1026 (51%), Positives = 667/1026 (65%), Gaps = 87/1026 (8%)

Query: 66   FLGRSYVSGILGSSLPQ--GGERNTLPVSNK-FGSRAIHEQNKLHRQTAAIAEEF----- 117
            +LGRSYV+ +    L +  GG    LP+S +   S++IH+   L RQTAA++ EF     
Sbjct: 52   YLGRSYVANLSPPPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFE 111

Query: 118  ----------DDG--TIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKTPVS 165
                      DDG  T  E PS                             + D  TP+ 
Sbjct: 112  FEDQLAGVSEDDGHSTTAEEPS------------------MNGTLISPVSSVPD--TPID 151

Query: 166  INLKRATDPELEQQTVALLTPSSSNNDNYGSVSP-EENFLSATSNYEQESTYQSITVVPS 224
            IN          + + ALL P++ ++  YGS+   E  ++S  S     +T+    + P 
Sbjct: 152  IN----------EPSNALLPPNAEHDLEYGSIDGYEHQYVSLQSRRSGANTHN---IGPD 198

Query: 225  AGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPT 284
            A  R+       K   T +R+ NYMP              SYGMIIFPITEP+F+ LGPT
Sbjct: 199  ASLRE-------KMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPT 251

Query: 285  GISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTT 344
            G+SMFY+S+IISQ IYS G+S+F + +GSEMIEITPFYH MA +I   LPG  D +++TT
Sbjct: 252  GMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTT 311

Query: 345  IFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKF 404
            I CY +SS+ITGL F+LLG+LRLGKIVGFFPRHILIGCIGGVGYFL+ITGLEVTTR+AKF
Sbjct: 312  IVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKF 371

Query: 405  EYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAI 464
            EYS  FL+ LF +  +L KW           V Q  F NSLVLP+FYI  L+LFHF+VA+
Sbjct: 372  EYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVAL 431

Query: 465  APNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHV 524
             P+LSL  LR +GWIFPA + +  W+D Y  ++     W +++KQIPTMLALTFFGILHV
Sbjct: 432  IPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHV 491

Query: 525  PINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIA 584
            PINVPALAMS+ +DK DVDKELIAHGYSNF SG+ GSVQNYLVYTNSVLFIRAG D A+A
Sbjct: 492  PINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALA 551

Query: 585  GYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGI 644
            G             GPVI+++IP+CIVGSLIFLLGYELL EA+ D +GK+  FEYAT+  
Sbjct: 552  GLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVA 611

Query: 645  IVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQ 704
            IV TMG FDFVLGI+VGILIACFSFLVDSTKLQTVNGEFDG VA+STV RD+ QT+FL++
Sbjct: 612  IVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNK 671

Query: 705  IGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYS 764
            IGEQI+VLKLQN+LFFGTI+SIEEKI++LLE+SD D SK RIK+LILDFKNINADNIDYS
Sbjct: 672  IGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYS 731

Query: 765  AAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEF 824
            AAEGFNRIKR+T +KRI LIIS+I+ SDRIY  FN+VG+L+ +ELF+DLNSALEWCENEF
Sbjct: 732  AAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEF 791

Query: 825  LYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRN 884
            L Q+K+LR K + K  ++          Q RR  +                     TPRN
Sbjct: 792  LIQFKDLRNKTKLKAGKK----------QDRRMSKV---------------PLPFNTPRN 826

Query: 885  YQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEF 944
             Q VS AQ+ F++EQ + T + +  +   P           +RP I+S D   +  E   
Sbjct: 827  NQFVSVAQKLFTDEQSM-THLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERL 885

Query: 945  WKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILS 1004
            W  LC YF +K                +++ G++KV YNL  G +YET+S  TCYG++  
Sbjct: 886  WSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSI 945

Query: 1005 KRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLG 1064
              +N N    + V++ETD  LWIID+  +  +K +N+ LYTE++L+ L I   R KELLG
Sbjct: 946  PNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQDRLKELLG 1005

Query: 1065 YTLVSA 1070
            + LVS+
Sbjct: 1006 HCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1039 (49%), Positives = 679/1039 (65%), Gaps = 64/1039 (6%)

Query: 40   NESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKF--GS 97
            +E+++L+V  R N  + G  +   + +LGRSYV+ +    L      +  P S+     S
Sbjct: 28   SETDTLSV-PRGNPFSNG-ADGSPHYYLGRSYVANLSPPPLAIKERFSGDPTSSSRPEQS 85

Query: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXI 157
            ++IH+   L RQTAA++ EFD GT  E    L++                          
Sbjct: 86   QSIHQSLSLRRQTAALSNEFD-GTF-EFEDQLEDLAENGNTAVPDESVMAGSAI------ 137

Query: 158  TDNKTPVSINLKRATDPE---LEQQTVA--LLTPSSSNNDNYGSVSP-EENFLSATSNYE 211
                +P S      + PE   L+   V+  LL P++  +  YGS+   +  ++S  S   
Sbjct: 138  ----SPTS------SGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSLQS--- 184

Query: 212  QESTYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIF 271
            Q +   S  + P+A  R        K   T +R+ NY+P              SYGMIIF
Sbjct: 185  QRAGSNSRAIDPNASMRD-------KTLFTFRRLGNYVPAVILGLLLNILDALSYGMIIF 237

Query: 272  PITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQ 331
            PITEP+F+ LGP+G+SMFY+S+++SQ +YS G+S+F + +GSEMIEITPFYH+MA +I  
Sbjct: 238  PITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMA 297

Query: 332  ALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLI 391
            ++PG  D ++TTTI CY +SS++TGL F+LLG+L+LGKIVGFFPRHILIGCIGGVGYFL+
Sbjct: 298  SMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLV 357

Query: 392  ITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFY 451
            ITG EVTTR +KFEYS  FL+ L  D  +L KW           V Q+  KNSLVLP+FY
Sbjct: 358  ITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFY 417

Query: 452  IITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIP 511
            I  L+LFHF+VA+ P+LSLH LR +GW+FPA   +  W+D Y+ ++     W LV+KQ+P
Sbjct: 418  IAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVP 477

Query: 512  TMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNS 571
            TMLALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSNF SG+ GSVQNYLVYTNS
Sbjct: 478  TMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNS 537

Query: 572  VLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPF 631
            +LFI+AGAD ++AG             GPVI+++IP+CIVGSLIFLLGYELL EA++D +
Sbjct: 538  LLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTW 597

Query: 632  GKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKST 691
            GK+  FEYAT+  IV TMG FDFVLGI+VGILIACFSFLVDSTKLQT+NGEFDG VA+ST
Sbjct: 598  GKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARST 657

Query: 692  VYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLIL 751
            V RD+ QT+FL++IGEQI+VLKLQN+LFFGTIISIEEKI++LLE+SD D SK RIK+LIL
Sbjct: 658  VRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLIL 717

Query: 752  DFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFN 811
            DFKNINADNIDYSAAEGFNRIKR+T +KRI LIIS+I+ +DRIY  FN+VG L  +ELF+
Sbjct: 718  DFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFD 777

Query: 812  DLNSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXX 871
            DLNSALEWCENEFL Q+++LR K + K  R+ +              Q +K   P     
Sbjct: 778  DLNSALEWCENEFLRQFRDLRNKTKLKAVRKQER-------------QLSKGALP----- 819

Query: 872  XXXXXXXXXTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIV 931
                     TPRN   VS AQ+ F++EQ +   + T  K   P           YRP I+
Sbjct: 820  -------FNTPRNNHFVSVAQKLFTDEQSMP-HLKTHYKEKTPVLHLLLSALQRYRPEIM 871

Query: 932  SMDTEKRTDEVEFWKQLCPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYE 991
            S +   +  E + W +L  +F ++                +V++G++KV YNL  G +YE
Sbjct: 872  SPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYE 931

Query: 992  TLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLI 1051
             LS  TCYG+I +   +E    ++ +++ETD  LWI+DE ++  +K +N+ LYTEL+L+ 
Sbjct: 932  ILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLVT 991

Query: 1052 LAIRDTRFKELLGYTLVSA 1070
            L +   R KELLG+ LVS+
Sbjct: 992  LCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/904 (53%), Positives = 608/904 (67%), Gaps = 54/904 (5%)

Query: 179  QTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVP---------SAGFRQ 229
            + +ALL P++S+N  Y            T + E +   Q I+++P         S GFR 
Sbjct: 197  ENLALL-PTNSHNSMYVEY--------GTFDEENQPATQYISLLPDGASSGGFTSQGFRS 247

Query: 230  MPTSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMF 289
               S   KA   + R+  Y P              SYGMIIFPITEP+F+ LGPTG+SMF
Sbjct: 248  -SMSHYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMF 306

Query: 290  YISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP-GRDDEIITTTIFCY 348
            Y+ST+I Q  +S G SSFPS IGSEMIEITPF+HTMAL+I  ++P G D+++I+TTI CY
Sbjct: 307  YVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCY 366

Query: 349  VISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSI 408
             +SS+ITGLTF+LLGK+RLGKIVGFFPRHILIGCIGGVGYFLIITGLEV TR+ +F+YS 
Sbjct: 367  ALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSW 426

Query: 409  PFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNL 468
             FL+ LF D  +L KW             Q    NSLVLPSFYIITL+LFHFVVA+ P+L
Sbjct: 427  QFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSL 486

Query: 469  SLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINV 528
            SL +LR  GWIF        WYD Y+ +D     WSL+ KQ+PTMLALTFFGILHVPINV
Sbjct: 487  SLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINV 546

Query: 529  PALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXX 588
            PALAMSL +DKYDVDKELIAHGYSN  SG  GS+QNYLVYTNSVLFIRAGADS IAG   
Sbjct: 547  PALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIML 606

Query: 589  XXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLT 648
                      GPVIISFIPICIVGSLIFLLGYEL+ EA+ID +GK+  FEY TI IIV+T
Sbjct: 607  TIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVIT 666

Query: 649  MGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQ 708
            MG+ DFV+GI+VGIL+ACFSFLV+ST+LQT+NGE+DG VAKSTVYRD+ Q++FL  IGEQ
Sbjct: 667  MGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQ 726

Query: 709  IYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEG 768
            IYVLKLQNILFFGTIISIEEK+  LLEI ++D SK RIK+LILDFKNI A +IDYSAAEG
Sbjct: 727  IYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEG 786

Query: 769  FNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQY 828
            FNRIKR+ E +RI LIIS+I + D+IY  F++V L +++ELF+DLN ALEWCENEFL +Y
Sbjct: 787  FNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRY 846

Query: 829  KELREKARNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLV 888
            K +R K R                  R+  Q  K+Q                TPRN+Q V
Sbjct: 847  KRIRTKTRA-----------------RKLAQLKKSQN-------RMSKLPVNTPRNHQFV 882

Query: 889  SAAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQL 948
            S  +  ++ E +I  ++  +LK               +R  I S +  KRT+E++ WK+L
Sbjct: 883  SEVRNIYTEEMEIQ-KLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRL 941

Query: 949  CPYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDN 1008
              YF +K                +V++G+L + ++L  G  YET+S  T YG I      
Sbjct: 942  ISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVI------ 995

Query: 1009 ENINQN-LRVQVETDT--ILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGY 1065
             N+N + L V + TDT  +L  ID +S+  +K+ +  L+TEL++L++AI   RF+ELLGY
Sbjct: 996  SNVNSDPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGY 1055

Query: 1066 TLVS 1069
            +L+S
Sbjct: 1056 SLIS 1059

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 16/72 (22%)

Query: 63  TNTFLGRSYVSGILGSSLPQG---------------GERNTLPVSNKFGSRAIHEQNKLH 107
           T+T+LGRSYV   +   +                  G+    P S++ GS+ IHE   LH
Sbjct: 30  TSTYLGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSE-GSKLIHESGNLH 88

Query: 108 RQTAAIAEEFDD 119
           +QTA ++  FD+
Sbjct: 89  KQTAFLSNTFDN 100

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1021 (47%), Positives = 639/1021 (62%), Gaps = 72/1021 (7%)

Query: 65   TFLGRSYV-----SGILGS--SLPQGGERNTLPVSNKFGSRAIHEQNKLHRQTAAIAEEF 117
             +LGRSYV     SG L S  +   G +   LP      S  +H  + LHRQTAA+ ++ 
Sbjct: 52   AYLGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDDS 111

Query: 118  D--DGTIGESPSSLKEYXXXXXXXXXXXXXXXXXXXXXXXXITDNKTPVSINLKRA---T 172
               DG   E  + + E                         +  N + V +N+  A   +
Sbjct: 112  RAYDGGPEEEEALVFE---GNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDS 168

Query: 173  DPELEQQTVALLTPSSSNN-DNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGFRQMP 231
            D + E  T   L+P +++   +YG+++ E+   SA+    +  T  S             
Sbjct: 169  DSDQEAGTRLFLSPITTDYIHSYGAINEEQ---SASETASRAETGPS------------- 212

Query: 232  TSTTAKAWMTLKRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGISMFYI 291
                 + W T  R   Y+P              SYGMIIFPI EPIF+ LGP G+SMFY+
Sbjct: 213  ---PLRLWGT--RTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYV 267

Query: 292  STIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPG-RDDEIITTTIFCYVI 350
            STIISQ +YS G+SSF  G GSEMIE+TPF+HTMAL+I  +L   + D+IITTTI CY +
Sbjct: 268  STIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYAL 327

Query: 351  SSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPF 410
            S++ITG  F  LGKLRLGK+V FFP HILIGCIGGV YFLIITG+EV+TR+ KFEYS+ F
Sbjct: 328  STIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAF 387

Query: 411  LTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSL 470
            L  LF+D  +L KW           + Q+   NS++LP FY+    LFHF+VA+ P+LSL
Sbjct: 388  LRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSL 447

Query: 471  HQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPA 530
              LR  GWIFP  E   +WYD+   ++  + HW LV+ +IPTMLALTFFGILHVPINVPA
Sbjct: 448  DTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPA 507

Query: 531  LAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXX 590
            LA+S  +DK DVDKELIAHGYSN FSG  GS+QNYLVYTNSVLFIRAGADS  AG+    
Sbjct: 508  LAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAI 567

Query: 591  XXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMG 650
                    GP IIS IP+CIV SLIFLLGYELL E + D + +++ FEY T+ II+LTMG
Sbjct: 568  ATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMG 627

Query: 651  IFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIY 710
            IFDFVLGI+VG+L+ACFSFLV+ST+ +T++ EFDG VAKS  +RD+ Q+ FL ++ EQIY
Sbjct: 628  IFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIY 687

Query: 711  VLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFN 770
            VLKLQN LFFGTIISIEEKI  LLE + ++  K  IK+LILDFK+IN DNIDYSAAEGFN
Sbjct: 688  VLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKK-IIKYLILDFKHINIDNIDYSAAEGFN 746

Query: 771  RIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKE 830
            RIKR  E KRIKLI+S+I E D+IY +F+++GLLQD+ELF DLNSALEWCENE L +Y+ 
Sbjct: 747  RIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRS 806

Query: 831  LREKA-RNKLQRRSKNINAAIGNQLRRYDQTNKNQGPTXXXXXXXXXXXXXTPRNYQLVS 889
            L  +A R K++RRSK+I               K Q P              TPRN Q+++
Sbjct: 807  LLSRAHRVKVRRRSKDI-------------VPKAQIP-----------LENTPRNAQIMT 842

Query: 890  AAQQAFSNEQQISTEIDTKLKIPDPXXXXXXXXXXXYRPNIVSMDTEKRTDEVEFWKQLC 949
            AAQ  +S EQQ++  + +K K   P           YR    S    K T E+  WK LC
Sbjct: 843  AAQAVYSGEQQLNKTL-SKYKASHPALALLLVALKTYR----SGHAYKETKEIRLWKHLC 897

Query: 950  PYFTRKVXXXXXXXXXXXXXXXLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNE 1009
            PYF RK                +V++G+LK+ Y LP GS+ E +++ TCYG I       
Sbjct: 898  PYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNI---SGPG 954

Query: 1010 NINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVS 1069
            +++ +  V+ ET+ +LW+ID   ++ ++ +N+ LYTEL+++ +++   RFKELLG++L++
Sbjct: 955  SLSYSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLIN 1014

Query: 1070 A 1070
             
Sbjct: 1015 G 1015

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 106/542 (19%), Positives = 197/542 (36%), Gaps = 89/542 (16%)

Query: 324 TMALAISQA---LPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILI 380
            ++L + QA   L   + EI T +I   V+ + I+G+  ++ G  R G +     R +L 
Sbjct: 156 AISLVVGQAVEKLRAHNHEISTMSI--SVLVTFISGMFLFVFGICRFGFLGNVLSRALLR 213

Query: 381 GCIGGVGYFLIITGL------EVTTRIAKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXX 434
           G I  VG  +I+  L             K  +  PF    F+      K+          
Sbjct: 214 GFISSVGVVMIVNSLISELKLHKLLLETKGHFHTPFQKIRFI-----IKYAPANYHIPTA 268

Query: 435 XVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSS------- 487
            ++  CF                   ++  A  +    +R+  W    PE+         
Sbjct: 269 VLSLTCF------------------IILVTARVIKKKLMRRRRWPVFVPEILILIITTII 310

Query: 488 -----KWYDHYR---------------YFDIGKAHWSLVVKQIPTMLALTFFGILHVPIN 527
                K+  HY                Y  I K++  L    +     +   G       
Sbjct: 311 LSHKFKFKKHYEISIVGDFDTDGLVNFYNPISKSNRELAPNLMNAGFIVAILGFFESTTA 370

Query: 528 VPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYX 587
             +L  + +      ++EL+A G  N  + + G++  +  Y  S +   +GA + ++G  
Sbjct: 371 AKSLGSAYEF-AISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVC 429

Query: 588 XXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMID---PFGKVTTFEYATIGI 644
                          I +IP+CI+  +  ++G  LL EA  D    F      E     +
Sbjct: 430 MGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAV 489

Query: 645 IVLTMGIFDFVLGIVVGILIACFSFLVDSTK--LQTV-----NGEF---DGTVAKSTVYR 694
            VLT   +   +G+ +G   +  S +  S K  +Q +      G+F   D  ++ +T   
Sbjct: 490 TVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPD 549

Query: 695 DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDV------SKHR--I 746
           D      L    E   V+K+   L F  +  ++E++ RL       V      S+ R  I
Sbjct: 550 DLPNIEEL----EGCLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESI 605

Query: 747 KFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQD 806
           K+L+ D   +    +D SAA+    I +    +R+K+ ++ +   +++        +L  
Sbjct: 606 KYLVFDLNGMTF--MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNY 663

Query: 807 IE 808
           +E
Sbjct: 664 VE 665

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 102/525 (19%), Positives = 203/525 (38%), Gaps = 54/525 (10%)

Query: 324 TMALAISQA---LPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILI 380
            ++L + QA       D EI T TI   +  + I+G+  + LG +RLG +     + +L 
Sbjct: 148 AISLVVGQATEKFSAHDSEISTVTITMMI--TFISGVVLFFLGSVRLGFLGNILSKALLR 205

Query: 381 GCIGGVGYFLIITGLEVTTRI------AKFEYSIPFLTKLFLDSSMLFKWXXXXXXXXXX 434
           G I  VG  +II  L +  ++          Y  P    +FL     F++          
Sbjct: 206 GFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFL-----FRYASEYYHKPTA 260

Query: 435 XVTQKCF---------KNSLVLPSFYIITLILFHFVVAIAPNLSL-HQLRKTGWIFPAPE 484
            ++  CF         K  L+    ++I +     VV++   LSL +  + +  I    E
Sbjct: 261 ILSLICFLVLISTRIAKKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGE 320

Query: 485 VSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDK 544
            ++  +       +   + +L        LA+   G         +L     +  Y  ++
Sbjct: 321 FNADGFGSIGN-PLSNENRALYSSLWNEGLAVAMLGFFESTTASKSLGSDYNL-TYSSNR 378

Query: 545 ELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIIS 604
           ELIA G+ N    LFG++ ++  Y  S + + +G  + ++G                +I 
Sbjct: 379 ELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIH 438

Query: 605 FIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILI 664
           + P C++  +  ++G  LL E   D    +    Y+ + +  LT  I      + +G+ +
Sbjct: 439 YTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVELGVTV 497

Query: 665 ACFSFLVDSTKLQTVN-----GEFDGT--------VAKSTVYRDFTQTRFLSQIGEQIYV 711
            C   L+   K   ++      + +G+          K+   RDF     L Q  E  Y+
Sbjct: 498 GCIYSLILIVKHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENIT-LEQF-EHCYI 555

Query: 712 LKLQNILFFGTIISIEEKIERLLEISDND--------VSKHRIKFLILDFKNINADNIDY 763
           +K+   L F     +  ++ RL      +        VS+  ++++I D + + +  +D 
Sbjct: 556 VKIPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDS 613

Query: 764 SAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIE 808
            +A+    I R    + +++ ++ +     I       G+L  +E
Sbjct: 614 GSAQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 104/564 (18%), Positives = 220/564 (39%), Gaps = 68/564 (12%)

Query: 300 YSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEI----------IT------T 343
           Y++  +  P   G   + I+PF + +  ++ Q + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 344 TIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAK 403
            I   ++ + ++G      G  R G +     + +L G I  VG  +II  L    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDK 249

Query: 404 F------EYSIPFLTKLFL---------DSSMLFKWXXXXXXXXXXXVTQKCFK---NSL 445
           F       Y  PF   LFL           + +F             + +K  K   +++
Sbjct: 250 FLVSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAV 309

Query: 446 VLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSL 505
             P   ++ ++     + I+  LSL Q      +    + S   +D  +   +  +   L
Sbjct: 310 FFPDILLVVIV----TILISMKLSLKQRYGISIV---GDFSMDNFDKLKN-PLTHSRRKL 361

Query: 506 VVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNY 565
           +       L +   G         +L  +  +     ++EL+A G  N F  LFG++ ++
Sbjct: 362 MPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSF 420

Query: 566 LVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVE 625
             Y  S +   +GA S ++G                 + +IP C++  +  ++G  LL E
Sbjct: 421 GGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEE 480

Query: 626 AMIDPFGKVTTFEYATIGIIVLTMGI---FDFVLGIVVGILIACFSFLVDSTKLQT-VNG 681
              D    +    Y+ + +  +T G+   +    GI +G + +  + +  S K +  +  
Sbjct: 481 VPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILA 540

Query: 682 EFDGTVAKSTVYRDFTQTR---------FLSQIGEQIYVLKLQNILFFGTIISIEEKIER 732
              GT +  T   D+ +T           + +I E   ++++   L F     ++++++R
Sbjct: 541 RIAGT-SNFTNLDDYLRTTKKNPPAVEGRIEEI-EGCMIVRIPEPLTFTNSEDLKQRLDR 598

Query: 733 LLEISDNDV--------SKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLI 784
           +     + +        SK  IK++I D   + +  ID SAA+  + I    + + + + 
Sbjct: 599 IERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIY 656

Query: 785 ISTIRESDRIYHVFNQVGLLQDIE 808
           ++ +  +D+I     + G+  ++E
Sbjct: 657 LANVSINDKIRTRLLKAGVTPNVE 680

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/287 (19%), Positives = 125/287 (43%), Gaps = 25/287 (8%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G+ N    LFG++ ++  Y  S +   +GA S ++G                 
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGI 662
           + +IP C++  +  ++G  LL E   D    +    Y+ + +  +T G+   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 663 LIACFSFLVDSTKLQT-----VNGEFDGTVAKSTVYRDFTQTRFLSQIG--------EQI 709
            I C   +++  K        +     GT +  T   D+ +T   + +G        E  
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGT-SNFTNLDDYLRTMKKNPLGGENRLEEVEGC 575

Query: 710 YVLKLQNILFFGTIISIEEKIERLLEISDNDV--------SKHRIKFLILDFKNINADNI 761
            ++++   L F     ++++++R+     + +        SK  IK++I D   + +  I
Sbjct: 576 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--I 633

Query: 762 DYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIE 808
           D SAA+  + I    + + + + ++ +  +D+I     + G++ ++E
Sbjct: 634 DSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 118/281 (41%), Gaps = 22/281 (7%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G  N  + LFG++ ++  Y  S +   +G+ + ++G                +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMID---PFGKVTTFEYATIGIIVLTMGIFDFVLGIV 659
           I +IP+CI+  +  ++G  LL EA  +    F      E     I VL   ++   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 660 VGILIACFSFLVDSTKLQT-VNGEFDGTVAKSTVYR--------DFTQTRFLSQIGEQIY 710
           +G   +  S +  S K +  + G   GT   + +          D    +F+ +  E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 711 VLKLQNILFFGTIISIEEKIERLLEISDNDV--------SKHRIKFLILDFKNINADNID 762
           ++K+   L F     ++E++ RL                SK   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 763 YSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGL 803
            SA + F  I    + +++K+ ++ + +S +I     + G+
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 106/567 (18%), Positives = 218/567 (38%), Gaps = 83/567 (14%)

Query: 300 YSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRD-----------DEIITT----- 343
           Y++  +      G   + ITPF + +  ++ Q + G +           ++++T      
Sbjct: 116 YATSLAHVEPLCGLYSLAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVG 175

Query: 344 TIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAK 403
           TI   V+ + ++G    + G  RLG +     R +L G I  VG  ++I  L    ++ K
Sbjct: 176 TINISVVVTFLSGAILLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTK 235

Query: 404 FEYSIP-FLTKLFLDSSMLFKWXXXXXXXXXXXVT-----------------QKCFKNSL 445
              ++P      F     LFK+           ++                  K +K+ +
Sbjct: 236 LLATVPEHYHTPFEKVQFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVI 295

Query: 446 VLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSL 505
             P   I+ +++   ++++  NL     +K   I    + S+  +D      +GK + SL
Sbjct: 296 FFPE--ILLIVISSLIISVNFNL-----KKDFDISMLGDFSTSGFDKLNN-PLGKDNRSL 347

Query: 506 VVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDV----DKELIAHGYSNFFSGLFGS 561
             + +   L     G         +L        YD+    ++EL+A G  N    LFG+
Sbjct: 348 CHELLSVGLMCAILGFFESTTASKSLG-----TIYDLTISSNRELVALGSMNLVGSLFGA 402

Query: 562 VQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYE 621
           + ++  Y  S +   +GA + ++G                +I + P+CI+  +  ++G  
Sbjct: 403 LPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLS 462

Query: 622 LLVEAMIDPFGKVTTFEYATIGI---IVLTMGIFDFVLGIVVGIL--------------I 664
           LL EA  D    +    Y  + I   I +T  I     GI VG +              I
Sbjct: 463 LLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRI 522

Query: 665 ACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTII 724
              + ++ + +   V+G + G     T+  D  ++  L ++ +   ++K+   L F    
Sbjct: 523 QILTRVIGTNQFVPVDGYYPGL---KTI--DLRESSALEELDDSTLIVKIPEPLTFTNTE 577

Query: 725 SIEEKIERLLEISDNDVSKHR--------IKFLILDFKNINADNIDYSAAEGFNRIKRYT 776
            ++E++ RL       +   R        IK++I +   + +  +D SAA+    I +  
Sbjct: 578 DLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGMTS--MDSSAAQILKEIIKTY 635

Query: 777 EAKRIKLIISTIRESDRIYHVFNQVGL 803
           + + + +    +  + +I    +  G+
Sbjct: 636 KKRSVNVYFCKVSSNLQIRTRLHDAGI 662

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/285 (19%), Positives = 125/285 (43%), Gaps = 22/285 (7%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G+ N    LFG++ ++  Y  S +   +GA S I+G                 
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGI---FDFVLGIV 659
           + +IP C++  +  ++G  LL E   D    +    Y+ + +  +T G+   +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 660 VGILIACFSFLVDSTK-----LQTVNGEFDGTVAKS---TVYRDFTQTRFLSQIGEQIYV 711
           +G + +  + +  S K     L  V G  + T        + R+        +I E   +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEI-EGCMI 576

Query: 712 LKLQNILFFGTIISIEEKIERLLEISDNDV--------SKHRIKFLILDFKNINADNIDY 763
           +++   L F     ++++++R+     + +        SK  IK++I D   + +  +D 
Sbjct: 577 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDS 634

Query: 764 SAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIE 808
           SAA+  + I    + + + + ++ +  +D+I    ++ G++ ++E
Sbjct: 635 SAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 93/202 (46%), Gaps = 9/202 (4%)

Query: 540 YDVD----KELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXX 595
           +D+D    +EL++ G  N    +F S+  +  Y  S L I  GA + +AG          
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 596 XXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPF--GKVTTF-EYATIGIIVLTMGIF 652
                 +  ++P+CI+  +I  + Y LL E   D F    V+ + E  T   +VL+  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 653 DFVLGIVVGILIACFSFLVDSTKLQT-VNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYV 711
               G+V+G+ +     L  +T+ +  + G+   T     +Y +  +   L +I E+  V
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKTMV 521

Query: 712 LKLQNILFFGTIISIEEKIERL 733
           +K+   L F  +  + +K++RL
Sbjct: 522 IKVPEPLVFWNVPDLMKKVKRL 543

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G  N FS + GS+  +  Y  S +   +GA + ++G                +
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGI 662
           I +IPIC++  +  ++G  LL EA  D       F Y  + +  LT+ +      + VGI
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTV-LTTMFYSVEVGI 511

Query: 663 LIAC 666
            I C
Sbjct: 512 CIGC 515

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 111/538 (20%), Positives = 195/538 (36%), Gaps = 101/538 (18%)

Query: 292 STIISQFIYSSGWSSFPSGI-GSEMIEITPFYHTMALAISQAL-PGRDDEIITTTIFCYV 349
           S  I+ FIY+  + S P  I G E          ++L + QA+ P  + +   +TI   +
Sbjct: 110 SLAITPFIYAI-FGSVPQMIVGPE--------SAISLVVGQAVEPMVNHDERISTISISI 160

Query: 350 ISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKF----- 404
           + + I+G     LG  RLG +     R +L G I  VG+ +II  L    ++ K      
Sbjct: 161 VVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSP 220

Query: 405 -EYSIPFLTKLFLDSSMLFKWXXXXXXXXXXXVTQKCFKNSLVLPSFYIITLILFHFVVA 463
             Y  PF   LFL      K+             Q  +     + S Y   +++   V  
Sbjct: 221 EHYHTPFEKILFL-----IKY------------GQHNYHAPTAILSLYSFIILMLMKV-- 261

Query: 464 IAPNLSLHQLRKTGWIFPAPEVS---------SKWYDHYRYFDIG--------------- 499
               +    +++  W+   PE+          S  +D    FDI                
Sbjct: 262 ----MKKRLMKRFKWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGDFKVNGFDSLHN 317

Query: 500 ---KAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFS 556
              K +  L+   +   +     G         AL  +  +     ++EL+A G  N   
Sbjct: 318 PLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDL-TVSSNRELVALGSMNIVG 376

Query: 557 GLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIF 616
            LFG++  +  Y  S +   +G  + ++G                ++   P C++  +  
Sbjct: 377 SLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTS 436

Query: 617 LLGYELLVEAMIDP---FGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDS 673
           ++G  LL EA  D    F      E   +G+  +T   +   +GI VG   +  S +  S
Sbjct: 437 VVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHS 496

Query: 674 --TKLQTVN--------------GEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNI 717
             +++Q +               G FDG    +  + +      L  + E   V+K+   
Sbjct: 497 AQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PLLEDLDEDRLVVKIPEP 552

Query: 718 LFFGTIISIEEKIERLLEISDNDV--------SKHRIKFLILDFKNINADNIDYSAAE 767
           L F     ++E++ RL       V        S+ + K++I D   +    ID SAA+
Sbjct: 553 LTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTY--IDASAAQ 608

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 83/378 (21%), Positives = 144/378 (38%), Gaps = 43/378 (11%)

Query: 324 TMALAISQA---LPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILI 380
            ++L + QA   L   D  + T  I   +  S ++GLT    G  RLG +     + +L 
Sbjct: 146 AISLVVGQAVETLTSHDLSLETVDIATMI--SFMSGLTLLFGGIFRLGFLGNILSKALLR 203

Query: 381 GCIGGVGYFLIITGLEVTTRIAKF------EYSIPFLTKLFL----DSSMLFKWXXXXXX 430
           G I  +G+ +I+  L    ++ K        Y  PF   LFL     S+           
Sbjct: 204 GFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYGPSNYHLPTSFLSLA 263

Query: 431 XXXXXVTQKCFKNSLV--------LPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPA 482
                +T + FK  ++        +P   I+++++F  V++      +  L+K   I   
Sbjct: 264 VFTTLMTIRIFKKKMMRRIKWIVFIPE--ILSVVIFSIVLSY-----MCDLKKKYDISVI 316

Query: 483 PEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKY-- 540
            + ++  +D +R   + K +  L+       L     G L       ++  S  +  Y  
Sbjct: 317 GDFNTDGFDDFRN-PLSKCNRGLIPALRDVSLVSALLGFLE------SITASKSLGGYGN 369

Query: 541 ---DVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXX 597
                ++EL+A G  N     FG +  +  Y  S +   +GA + +AG            
Sbjct: 370 TVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIK 429

Query: 598 XGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLG 657
               +I +IP C++  +   +G  LL EA  D    +    Y  + + VLT     F   
Sbjct: 430 FLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFY-S 488

Query: 658 IVVGILIACFSFLVDSTK 675
           I  GIL  C   L+   K
Sbjct: 489 IEFGILAGCTYSLISIVK 506

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 91/204 (44%), Gaps = 9/204 (4%)

Query: 538 DKYDVD----KELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXX 593
           +K+D+D    +EL++ G  N  S +F ++  +  Y  S L I   A + +AG        
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 594 XXXXXGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYA---TIGIIVLTMG 650
                      ++P+C++  +I  + Y LL E   D F   +   Y    T   +V+T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 651 IFDFVLGIVVGILIACFSFLVDSTKLQT-VNGEFDGTVAKSTVYRDFTQTRFLSQIGEQI 709
           ++    G+ +G+ +     L  +T+ +  + G    T     +Y + ++   L +I E+ 
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-EKT 519

Query: 710 YVLKLQNILFFGTIISIEEKIERL 733
            V+K+   L F  +  +++++ RL
Sbjct: 520 MVIKIPEPLIFSNVSDLKKRLSRL 543

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 77/406 (18%), Positives = 147/406 (36%), Gaps = 54/406 (13%)

Query: 300 YSSGWSSFPSGIGSEMIEITPFYHT---------------MALAISQALPG--RDDEIIT 342
           YS+  +  P   G   +  TPF +                ++L + QA+    + D+ + 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 343 TTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIA 402
               C +++  I+G   +  G +R G +     R +L G I  VG  +++  L    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 403 KF------EYSIPFLTKLFL------------DSSMLFKWXXXXXXXXXXXVTQKCFKNS 444
           K        Y  PF   +FL                L  +              + +K  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 445 LVLPSFYII----TLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGK 500
           + +P   I+    TL  +HF   +  N+ +    + G        +SK+ +      + K
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKLRYNIDIVGDIEVGD-------TSKFRN-----PLSK 331

Query: 501 AHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFG 560
            + SL  +       +   G         +L  S ++     ++EL+A G  N    +FG
Sbjct: 332 KNLSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIFG 390

Query: 561 SVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGY 620
           ++ ++  Y  S +   +GA + ++G                 I  IP+C++  +  ++G 
Sbjct: 391 ALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGI 450

Query: 621 ELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIAC 666
            L  EA  D         Y  + I  LT+ +  F   +  GI + C
Sbjct: 451 TLFEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGITLGC 495

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 124/294 (42%), Gaps = 23/294 (7%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G  N    LFG++ ++  Y  S +   +GA + ++G                 
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEY---ATIGIIVLTMGIFDFVLGIV 659
           I +IP+C++  +  ++G  LL EA  D    +    Y    +  I VLT   +    GI 
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGIT 519

Query: 660 VGILIACFSFLVDSTKLQT-VNGEFDGT----VAKSTVYRDFTQTRFLSQIGEQI---YV 711
           VG   +    +  STK +  + G+  GT     A     ++ T  R ++   E+I    +
Sbjct: 520 VGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSERRVNPQLEEIEGCLI 579

Query: 712 LKLQNILFFGTIISIEEKIERL--------LEISDNDVSKHRIKFLILDFKNINADNIDY 763
           +++   L F     ++ ++ RL           +     +   K++I D   +    ID 
Sbjct: 580 VRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDS 637

Query: 764 SAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSAL 817
           SA +    I    + + + + +  +  + ++ + F   G+L+ +E  +D++ +L
Sbjct: 638 SAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSL 689

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 55/140 (39%), Gaps = 24/140 (17%)

Query: 300 YSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPG-----------------RDDEIIT 342
           Y++  +      G   +  TPF++ +  ++ Q + G                 R D  ++
Sbjct: 132 YATSIAHVEPLCGLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLS 191

Query: 343 TTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIA 402
           +   C +I+  I+G+  +  G  R G +     R  L G I  VG  ++I  L V  ++ 
Sbjct: 192 SLDLCVIIT-FISGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLK 250

Query: 403 KF------EYSIPFLTKLFL 416
           K        Y  PF   LFL
Sbjct: 251 KVFDDAPSHYHSPFEKVLFL 270

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/323 (20%), Positives = 125/323 (38%), Gaps = 34/323 (10%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G  N    LFG++ ++  Y  S +   +GA + ++G                 
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMID---PFGKVTTFEYATIGIIVLTMGIFDFVLGIV 659
           I  IPIC++  +  ++G  L  EA  D    F      E  T  I VLT     F   + 
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITVLTT----FFYSVE 503

Query: 660 VGILIACFSFLVDSTKLQTVNG-EFDGTVAKSTVYRD----FTQTRFLSQIG------EQ 708
            GI + C   ++ + K  T +G +  G ++ +  + +    ++ +   S+ G      E 
Sbjct: 504 AGITLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHMEG 563

Query: 709 IYVLKLQNILFFGTIISIEEKIERL--------LEISDNDVSKHRIKFLILDFKNINADN 760
             V ++   L F     ++ ++ RL           S     K   + +I D + +    
Sbjct: 564 CLVARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT--Q 621

Query: 761 IDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSAL--- 817
           ID SA++    I +    +++++ ++ +  +  +       G+   +E    LN+A    
Sbjct: 622 IDSSASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMGQ 681

Query: 818 ---EWCENEFLYQYKELREKARN 837
               WC        K   E A N
Sbjct: 682 PGDSWCFKSIQEALKMCDELAPN 704

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 60/273 (21%), Positives = 105/273 (38%), Gaps = 48/273 (17%)

Query: 168 LKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSITVVPSAGF 227
           +K+ T   L  ++  L   SS + D   S+SPE    +  S    + + Q   V P+   
Sbjct: 10  VKKGTRKGLIYESSNLRPESSISVDGDSSLSPENQ--ARQSRVSTDISEQPKEVSPA--- 64

Query: 228 RQMPTSTTAKAWMTL-KRVTNYMPXXXXXXXXXXXXXXSYGMIIFPITEPIFAQLGPTGI 286
             MP  +  +  +T+  R+T Y+P                 +  +  T+ I   +    +
Sbjct: 65  --MPAPSRDEIQLTMWHRLTYYLPCFSW-------------LPTYDATKFIGDLIAGASL 109

Query: 287 SMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHT---------------MALAISQ 331
           + F I   +S   YS+  +  P   G   +  TP  +                ++L + Q
Sbjct: 110 ASFQIPLAMS---YSTSVAHVPPICGLNALAFTPLVYAVFGSVPHMIVGPESAISLVVGQ 166

Query: 332 ALPG--RDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYF 389
           A+    + D  +  T  C V++  I+G   +  G +R G +     R +L G I  VG  
Sbjct: 167 AIEKLTKHDASLNVTNLCVVLT-FISGSILFSFGLMRFGFLDSVLSRALLRGFISAVGLI 225

Query: 390 LIITG------LEVTTRIAKFEYSIPFLTKLFL 416
           ++I        L+ T + A   Y  PF   +FL
Sbjct: 226 MVINSLISELKLKDTFKNAPGHYHAPFQKVVFL 258

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 58/288 (20%), Positives = 114/288 (39%), Gaps = 37/288 (12%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL++ G  N  S +F ++  +  Y  S + I  GA +  +G                 
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIG---------IIVLTMGIFD 653
              +PICI+  +I  + + LL EA  D         Y ++G         IIV+T  ++ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPAD------LMFYWSVGGYQELFIFIIIVVTTLVWS 385

Query: 654 FVLGIVVGILIACFSFLVDSTKLQT-VNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVL 712
              G+ +G+ +     L  ST+ +  + G    T     +  D      L +I E++ V+
Sbjct: 386 PQFGVTMGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVV 444

Query: 713 KLQNILFFGTIISIEEKIERLLE-----------------ISDNDVSKHRIKFLILDFKN 755
           K+   L F  +  +   ++R+ +                 +S     +  +K+L++D   
Sbjct: 445 KIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFG 504

Query: 756 INADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGL 803
           +    ID SA +    I      + I ++ +  +  D + H F + G+
Sbjct: 505 MT--YIDISALQALREIVDAYSRRNICVMFTRPKIPD-LRHKFRKSGI 549

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 107/563 (19%), Positives = 209/563 (37%), Gaps = 67/563 (11%)

Query: 300 YSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEI----------IT---TTIF 346
           Y++  +  P   G   + I+PF + +  ++ Q + G +  I          IT     + 
Sbjct: 140 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVS 199

Query: 347 CYVISSVIT---GLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAK 403
              IS+VIT   G      G  R G +     + +L G I  VG  +II  L    ++ K
Sbjct: 200 LIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 259

Query: 404 F------EYSIPFLTKLFLDS---------SMLFKWXXXXXXXXXXXVTQKCFK---NSL 445
           F       Y  PF   LFL           + +F             + +K  K   +++
Sbjct: 260 FLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAI 319

Query: 446 VLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSL 505
             P       IL   +V I  ++  +   + G I    + S   +D  +   + +    L
Sbjct: 320 FFPD------ILLVVIVTILISMKFNLKHRYG-ISIIGDFSMDNFDELKN-PLTRPRRKL 371

Query: 506 VVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNY 565
           +       L +   G         +L  +  +     ++EL+A G+ N    LFG++  +
Sbjct: 372 IPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAF 430

Query: 566 LVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVIISFIPICIVGSLIFLLGYELLVE 625
             Y  S +   +GA S ++G                 + +IP C++  +  ++G  LL E
Sbjct: 431 GGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEE 490

Query: 626 AMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTK---------L 676
              D    +    ++ + +  +T     F   I  GI I C   +++  K         L
Sbjct: 491 VPGDIKFHLRCGGFSELFVFAVTFCTTIF-YSIEAGICIGCVYSIINIIKHSAKSRIQIL 549

Query: 677 QTVNGEFDGTVAKS---TVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERL 733
             V G  + T        + R+        +I E   ++++   L F     ++++++R+
Sbjct: 550 ARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEI-EGCMIVRIPEPLTFTNSEDLKQRLDRI 608

Query: 734 LEISDNDV--------SKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLII 785
                + +        SK  IK++I D   + +  ID SAA+    I    + + + + +
Sbjct: 609 ERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSSAAQVLEEIITSYKRRNVFIYL 666

Query: 786 STIRESDRIYHVFNQVGLLQDIE 808
             +  +D++     + G+   +E
Sbjct: 667 VNVSINDKVRRRLFKAGVAASVE 689

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 54/270 (20%), Positives = 112/270 (41%), Gaps = 21/270 (7%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++ELIA G  N    +F  +  +  Y  S +   +GA + ++G+               I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGI 662
           I +IP+CI+  +  ++G  LL EA  D         Y+ + +  +T+ +      +  GI
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTL-LATLFYSLEAGI 495

Query: 663 LIACFSFLVDSTKLQT-----VNGEFDG--TVAKSTVYRDFTQTRFLSQIGEQI---YVL 712
            I C   +++  K        + G   G  T   +  Y+      F++   E+I    ++
Sbjct: 496 YIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEIEGFLIV 555

Query: 713 KLQNILFFGTIISIEEKIERLLE----ISDNDVSKHRIKFL----ILDFKNINADNIDYS 764
           K+   L F     ++ ++ RL +    ++     + R K +    I D K +   +ID S
Sbjct: 556 KIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HIDSS 613

Query: 765 AAEGFNRIKRYTEAKRIKLIISTIRESDRI 794
           AA+    I      + + + ++ +  ++++
Sbjct: 614 AAQTLEEILSAYNRRDVHVFLTNVPLTEKV 643

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 9/128 (7%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G  N  + L G + ++  Y  S +   +GA + ++G                 
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 603 ISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIG----IIVLTMGIFDFVLGI 658
           I FIP C++  +  ++G  L+ EA     G+V  F +   G    II            +
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAP----GEV-KFHWRCKGYNELIIFFMTACGTIFFSV 542

Query: 659 VVGILIAC 666
            VGI+I C
Sbjct: 543 EVGIIIGC 550

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%)

Query: 543 DKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYXXXXXXXXXXXXGPVI 602
           ++EL+A G SN      G++ ++  Y  S +   +G  + ++G                +
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 603 ISFIPICIVGSLIFLLGYELLVE 625
           I +IP+CI+  +  ++G+ LL E
Sbjct: 473 IHYIPVCILSVITTVIGFTLLEE 495

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 345 IFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKF 404
           I   +  ++I+G    + G  RLG +     + +L G IG VG+ +II  L    ++   
Sbjct: 206 ILIVIAVTLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI 265

Query: 405 ------EYSIPFLTKLFL 416
                  Y+ PFL  +FL
Sbjct: 266 LADTPEHYNTPFLKIVFL 283

>Smik_12.125 Chr12 (246209..247030) [822 bp, 273 aa] {ON} YLR064W
           (REAL)
          Length = 273

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 632 GKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKST 691
            K+T F     G  +    +F+ + G+ VG+ +  F+F +   +   V+ E  GT+    
Sbjct: 155 SKITVFIQNYNGFFLQMAQVFEIICGLRVGLFLVPFNFFLLLVRRANVSFEIVGTMLAGL 214

Query: 692 VYRDFTQTRFLS-----QIGEQIYVLKL 714
            Y  F + R+L      QI +Q YVL+L
Sbjct: 215 TYVWFFKLRYLQSESMRQIFKQ-YVLRL 241

>YLR064W Chr12 (265456..266277) [822 bp, 273 aa] {ON}  PER33Protein
           that localizes to the endoplasmic reticulum with some
           nuclear pore complex association; deletion extends
           chronological lifespan; highly conserved across species,
           orthologous to human TMEM33 and paralogous to Pom33p
          Length = 273

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 632 GKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKST 691
            K+T F     G  +    +F+ + G+ VG+ +  F+F +   +   V+ E  GT+    
Sbjct: 155 SKITVFIQNYNGFFLQMAQVFEIICGLRVGLFLVPFNFFLLLVRRANVSFEVVGTMLAGL 214

Query: 692 VYRDFTQTRFLS-----QIGEQIYVLKL 714
            Y  F + R+L      QI +Q YVL+L
Sbjct: 215 TYVWFFKLRYLQSESMRQIFKQ-YVLRL 241

>Ecym_2464 Chr2 (905108..907201) [2094 bp, 697 aa] {ON} similar to
           Ashbya gossypii ABL018C
          Length = 697

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 295 ISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVI 354
           IS  +Y+SG +  P G+      I      + + IS++L G +D +I      +++   +
Sbjct: 263 ISCVMYTSGSTGTPKGVTMTHANIVAGVGGVGINISRSLIGHNDTVIAFLPLAHILELAV 322

Query: 355 TGLTFY---LLG 363
             LTFY   LLG
Sbjct: 323 ELLTFYWGALLG 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,114,578
Number of extensions: 4298658
Number of successful extensions: 14732
Number of sequences better than 10.0: 61
Number of HSP's gapped: 14997
Number of HSP's successfully gapped: 80
Length of query: 1070
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 950
Effective length of database: 39,721,479
Effective search space: 37735405050
Effective search space used: 37735405050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)