Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10604g3.486ON2112119811e-136
NCAS0E008503.486ON2302304589e-57
Skud_7.4373.486ON2302214389e-54
YGR126W3.486ON2302304197e-51
Smik_6.2223.486ON2302304171e-50
KNAG0B008503.486ON2252174031e-48
Suva_7.4143.486ON2302213989e-48
TDEL0D055403.486ON2162233812e-45
KAFR0C019203.486ON2232273813e-45
NDAI0G009803.486ON2342353606e-42
SAKL0F02904g3.486ON2222033589e-42
KLTH0F14696g3.486ON2191573031e-33
Kwal_55.212153.486ON1421422659e-29
TPHA0D032503.486ON2192272378e-24
Kpol_1017.103.486ON2342232021e-18
KLLA0E04709g3.486ON1661361972e-18
CAGL0I10384g3.503ON630651561e-11
AFR322C3.503ON592651517e-11
TDEL0D057103.503ON616651481e-10
Kwal_47.189193.503ON6401421472e-10
KLLA0E03829g3.503ON609651454e-10
KNAG0B007303.503ON622641454e-10
Smik_16.4083.503ON622651383e-09
KAFR0C020303.503ON624641365e-09
Skud_16.4503.503ON622641366e-09
Suva_16.4843.503ON622641366e-09
KLTH0G02266g3.503ON644651358e-09
NDAI0I027703.503ON626641349e-09
TPHA0D033103.503ON613641349e-09
YPR156C (TPO3)3.503ON622641341e-08
Smik_6.2333.503ON614641304e-08
Kpol_1017.33.503ON621641278e-08
YGR138C (TPO2)3.503ON614641261e-07
Suva_7.4253.503ON613641261e-07
NCAS0F036203.503ON634641261e-07
Skud_7.4483.503ON611641261e-07
NCAS0E007503.503ON620641252e-07
SAKL0F02442g3.503ON610641199e-07
TBLA0D029003.503ON6911321153e-06
ZYRO0G19646g3.503ON594771144e-06
CAGL0D01298g3.372ON679105730.66
Kwal_23.53837.541ON1514129656.4
Skud_10.1441.334ON452122656.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10604g
         (211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   382   e-136
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   181   9e-57
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   173   9e-54
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   166   7e-51
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   165   1e-50
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   159   1e-48
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   157   9e-48
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   151   2e-45
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   151   3e-45
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   143   6e-42
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   142   9e-42
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   121   1e-33
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   106   9e-29
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    96   8e-24
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    82   1e-18
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    80   2e-18
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    65   1e-11
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    63   7e-11
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    62   1e-10
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    61   2e-10
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    60   4e-10
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    60   4e-10
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    58   3e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    57   5e-09
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    57   6e-09
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    57   6e-09
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    57   8e-09
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     56   9e-09
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    56   9e-09
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    56   1e-08
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    55   4e-08
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    54   8e-08
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    53   1e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    53   1e-07
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    53   1e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    53   1e-07
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               53   2e-07
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    50   9e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    49   3e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    49   4e-06
CAGL0D01298g Chr4 (145031..147070) [2040 bp, 679 aa] {ON} highly...    33   0.66 
Kwal_23.5383 s23 (1136313..1140857) [4545 bp, 1514 aa] {ON} YPR1...    30   6.4  
Skud_10.144 Chr10 complement(271684..273042) [1359 bp, 452 aa] {...    30   6.6  

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  382 bits (981), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/211 (89%), Positives = 189/211 (89%)

Query: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATS 60
           MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATS
Sbjct: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATS 60

Query: 61  KHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ 120
           KHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ
Sbjct: 61  KHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ 120

Query: 121 FPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXXIAQKIN 180
           FPEEYRLETDTGLVKMKTLETLKRKSTQVSRN                      IAQKIN
Sbjct: 121 FPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKSEVSDIAQKIN 180

Query: 181 MAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
           MAVERNKKEIAKYQKHKSEKGIKGFFHRMFD
Sbjct: 181 MAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  181 bits (458), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/230 (44%), Positives = 145/230 (63%), Gaps = 19/230 (8%)

Query: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGL-EHTKNENLSRKATNASQGTYM---- 55
           M +  +T+ T+++ ED+SSFSS+DSY+PEPFTG+ E T  +   RK T +   T +    
Sbjct: 1   MEHRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEH 60

Query: 56  -----------DDATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRK 104
                      D  TS+ S +TL++ DS AIE+V+T NA  GN+ET+ SL AKGLD+ +K
Sbjct: 61  TNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKK 120

Query: 105 AIPDYNAPLTTTGTN-QFPEEYRLETDTGLVKMKTLETLKRKSTQVS--RNXXXXXXXXX 161
           A  D NAPLT+   +  FPEEY LET+TGLVK KT+ETL+R++++VS  R          
Sbjct: 121 ATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRRGDDVVSHKS 180

Query: 162 XXXXXXXXXXXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                         A+K+N+AVE+NKKE+ K +KHK +KG+KGF +R+FD
Sbjct: 181 QATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  173 bits (438), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 141/221 (63%), Gaps = 19/221 (8%)

Query: 10  TDYEVEDISSFSSVDSYKPEPFTGLEHT--------KNENLSRKAT-----NASQGTYMD 56
           TD E EDISSFSS+DSYKPEPFTG + +        KN+ +  KA      N  +     
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS 69

Query: 57  DATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTT 116
           D  S HS +TLK+  S +IEK++T NA+ GNSET +SLK +GL++ +KA+PD  AP+T +
Sbjct: 70  DVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNS 129

Query: 117 GTN-QFPEEYRLETDTGLVKMKTLETLKRKSTQVS-----RNXXXXXXXXXXXXXXXXXX 170
             N  FPEEYRLET+TGLVK+KTLETLKR+ ++VS                         
Sbjct: 130 AHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQ 189

Query: 171 XXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                + K+NMAVE+NKK+I +Y+KHKSEKGIKGFFHR+FD
Sbjct: 190 GSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  166 bits (419), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 142/230 (61%), Gaps = 19/230 (8%)

Query: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQGTYMDDA 58
           M     T  TD E EDISSFSS+DSYKPEPFTG + ++   + L +  T   +G   DD+
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60

Query: 59  T-----------SKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIP 107
                       S HS +TLK+  S +IEK+VT NA+ GNSET++SLK  GL++ +KA+P
Sbjct: 61  NVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120

Query: 108 DYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXXXX 166
           D  AP+T +  +  FPEEYRLET+TGLVK+KTLE+LKR+ ++VS                
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180

Query: 167 XXXXXXXXIA-----QKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                           K+NMAVE+NKK I KYQKHKSEKGIKGFFHR+FD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  165 bits (417), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 146/230 (63%), Gaps = 19/230 (8%)

Query: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQGT----- 53
           M     T  TD E EDISSFSS+DSYKPEPFTG + ++  ++ L +  T   +G      
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60

Query: 54  YMDD------ATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIP 107
            +DD        S HS +TLK+  S +IEK+VTQNA+ G SET++SLK  GL++++KA+P
Sbjct: 61  ILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120

Query: 108 DYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKSTQVS-----RNXXXXXXXXX 161
           D  AP+T +  +  FPEEYRLET+TGLVK+KTLETL+R+ ++VS      N         
Sbjct: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180

Query: 162 XXXXXXXXXXXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                           K+NMAVE+NKK+I +YQKHKSEKGIKGFFHR+FD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  159 bits (403), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/217 (43%), Positives = 131/217 (60%), Gaps = 17/217 (7%)

Query: 10  TDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMD----------DAT 59
           TD E +++SSFSSVDSYKPEPF G    + ++ SR   N +     D          D  
Sbjct: 9   TDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLN 68

Query: 60  SKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLD-MQRKAIPDYNAPLTTTGT 118
           SK S  TL K DS AIE+VVT+NA+   SE+ ++L++KGLD  +R+ IPD NAPLT T +
Sbjct: 69  SKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQS 128

Query: 119 NQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXX---- 174
             FPEEY++ET+TGLVKMKT+E+LK + +  + N                          
Sbjct: 129 -HFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAG 187

Query: 175 -IAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMF 210
             A+K+N AVERN+KE+ +Y+K++ +KGIKGF  +MF
Sbjct: 188 LNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  157 bits (398), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 134/221 (60%), Gaps = 19/221 (8%)

Query: 10  TDYEVEDISSFSSVDSYKPEPFTGLEHT--------KNENLSRKATNASQGTYMDDATSK 61
           TD E EDISSFSS+DSYKPEPFTG + +        KN+ +  K  + +  +  D     
Sbjct: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDDSVDDQHRHS 69

Query: 62  HSGA-----TLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTT 116
              +     TLK+  S +IEK+VT NA+ GNSET++SLK +GL++ +K  PD  AP+T +
Sbjct: 70  DVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNS 129

Query: 117 GTN-QFPEEYRLETDTGLVKMKTLETLKRKSTQVS-----RNXXXXXXXXXXXXXXXXXX 170
             +  FPEEYRLET+TGLVK+KTLETLKR+ ++VS                         
Sbjct: 130 AHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHSTRSKATAYSQ 189

Query: 171 XXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                + K+N+AVE+NKK I KYQKHK EKGIKG FHRMFD
Sbjct: 190 GSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  151 bits (381), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 120/223 (53%), Gaps = 26/223 (11%)

Query: 5   GTTS---DTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSK 61
           GTT+   D   + +++SSFSS+DSY+P+PFTG E    E          +        S 
Sbjct: 4   GTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQE----------KNPDSSSRRSS 53

Query: 62  HSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTG-TNQ 120
            SG TL   DS  IEK VT NA+ G SET +SL+  GLD ++KAIPD N P+T    T+Q
Sbjct: 54  KSGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQ 113

Query: 121 FPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXX------------XXXXXX 168
           FPEEYR+ET TGLVK+KTL  L R  T+VS                              
Sbjct: 114 FPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKA 173

Query: 169 XXXXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                  A+ +  A+E+NK  I K++KH+ EKG+KGF HR+FD
Sbjct: 174 EQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  151 bits (381), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/227 (39%), Positives = 132/227 (58%), Gaps = 37/227 (16%)

Query: 13  EVEDISSFSSVDSYKPEPFTG----------LEHTKN-----------------ENLSRK 45
           +VEDISSFSS++SYKPEPF G          LE   N                 + L + 
Sbjct: 6   DVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQV 65

Query: 46  ATNASQGTYMDDA-TSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRK 104
            TN S  ++   + TS+ S   LKK  S  IE++VTQNA+ G +ET++SL+A GLD+ ++
Sbjct: 66  QTNDSFWSFRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKR 125

Query: 105 AIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXX 164
           A+PD N+P+  +  ++  +E + ETDTGL+K KTLETL R +T+ S +            
Sbjct: 126 AVPDINSPI--SHESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKILGNDNSNT 183

Query: 165 XXXXXXXXXXIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                       +++NM VERN+K++ KYQ+HK EKG+KGFF+++FD
Sbjct: 184 SGLD-------PERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  143 bits (360), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 101/235 (42%), Positives = 139/235 (59%), Gaps = 25/235 (10%)

Query: 1   MSYNG---TTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQG--- 52
           M+++G   +  +TD E +DISSFSS+DSY+PEPFTGL+  +  N   S  AT   Q    
Sbjct: 1   MTHSGNIISADNTDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQPSTTATTTEQDHDD 60

Query: 53  ---------TYMDDATSKHSGATLKKLDSLA--IEKVVTQNAVAGNSETIESLKAKGLDM 101
                    T   +  S+ S ATLKKLDS    IEK +T N +   +ET++SL  +GL+ 
Sbjct: 61  TVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT 120

Query: 102 QRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXX 161
           ++K++ D N PL   GT +FPEEYR+ET+TGLVK KT+E+L+R+ +  S N         
Sbjct: 121 RKKSVADINTPLNA-GTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGS 179

Query: 162 XXXXXXXXXXXXXIA-----QKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
                         +      K+NMAVE+NKKE+ KY KHK +KGIKGFF+R+FD
Sbjct: 180 FKSARTNNTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  142 bits (358), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 122/203 (60%), Gaps = 28/203 (13%)

Query: 11  DYEVEDISSFSSVDSYKPEPFTG--LEHTKNENLSRKATNASQGTYMDDATSKHSGATLK 68
           D+E+ED      +D   PEP +G  +     E LS +++N                 TLK
Sbjct: 44  DHELED-----EID---PEPLSGNPVRPNSEEILSVRSSN-----------------TLK 78

Query: 69  KLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLE 128
           KLDS AIEKV+T NAV GN+ET+ESLK +GLD+++KAIPDYN P   T  +QFPEEY++E
Sbjct: 79  KLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIE 138

Query: 129 TDTGLVKMKTLETLKRKSTQVSR-NXXXXXXXXXXXXXXXXXXXXXXIAQKINMAVERNK 187
           T+TGLVK+KTL++L R  T+VS  N                        +K+  AV++NK
Sbjct: 139 TETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQRPVGYDEEKLKKAVDKNK 198

Query: 188 KEIAKYQKHKSEKGIKGFFHRMF 210
           K+I KYQKHK EKGIKGF  R+F
Sbjct: 199 KKIEKYQKHKHEKGIKGFMSRLF 221

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  121 bits (303), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 88/157 (56%), Gaps = 8/157 (5%)

Query: 63  SGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFP 122
           S  TL+K DS AIE+++T NA  G SET+ESLK  GL++Q+KAIPD N P        FP
Sbjct: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFP 122

Query: 123 EEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXXI------- 175
           EEY++ETDTGLVK +TL  L R  ++ S                                
Sbjct: 123 EEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGL 182

Query: 176 -AQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211
             +K+  AVE+N+K+I KYQKHKS  G++ F  ++FD
Sbjct: 183 DGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  106 bits (265), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 9/142 (6%)

Query: 79  VTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKT 138
           +T NA  G SET++SL+  GL++ +KA+PDYN P       +FPEEY+LETDTGLVK++T
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQT 60

Query: 139 LETLKRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXXI---------AQKINMAVERNKKE 189
           L+ L R  ++ S                                  A+K+  AVE+NK++
Sbjct: 61  LQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEKNKRQ 120

Query: 190 IAKYQKHKSEKGIKGFFHRMFD 211
           I KYQKHK+  G+K F  ++FD
Sbjct: 121 IDKYQKHKASGGLKKFLGKIFD 142

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 95.9 bits (237), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 117/227 (51%), Gaps = 33/227 (14%)

Query: 3   YNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKH 62
           Y+ +T+D++   +D+SSF+S +SY P+ F G      + L ++++     T MDD  S  
Sbjct: 6   YSKSTTDSE-NFDDVSSFNSDNSYTPQEFIG------DTLGKESS-----TKMDDRASHL 53

Query: 63  SGA------------TLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQ-RKAIPDY 109
           S A            T+K + S  + ++V++N +  N E+ E+LK +  +M+ R+A  D 
Sbjct: 54  SHAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRA--DI 111

Query: 110 NAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNXXXXXXXXXXXXXXXXX 169
             P +  G + FPEEY +ET TGLV +KTLE +K+K T  S N                 
Sbjct: 112 ILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNN 171

Query: 170 XXXXX-----IAQKINMAVERNKKEIAKYQKHKSEKG-IKGFFHRMF 210
                        K+N AVE+NK+E+ KYQ HK+EK  IK    ++F
Sbjct: 172 TVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 82.4 bits (202), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 100/223 (44%), Gaps = 36/223 (16%)

Query: 15  EDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKHSGATLKKLDSLA 74
           EDISSF S +S+ P+ F G   + N+N          G +    +      TLK   S  
Sbjct: 19  EDISSFDSQNSFAPQEFKGNLDSNNDN--------DTGVFNKTKSGTSETNTLKVNSSNE 70

Query: 75  IEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNA-PLTTTGTNQFPEEYRLETDTGL 133
           IEK+VT+NA+  N+ET+ +L+     + +  +P  N  P T      FPEEYR+ET TGL
Sbjct: 71  IEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFPEEYRIETKTGL 128

Query: 134 VKMKTLETL-------KRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXXIAQK-------- 178
           V +KTLE +       K +  +   +                      + QK        
Sbjct: 129 VPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEKHPAEHL 188

Query: 179 ---------INMAVERNKKEIAKYQKHKSE-KGIKGFFHRMFD 211
                    I++ VERNKK++ K+++HK E   +K F ++  D
Sbjct: 189 PHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 80.5 bits (197), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (50%), Gaps = 12/136 (8%)

Query: 75  IEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLV 134
           +E  V  N   G +++I+SLKA  LD+ +KAIP +N P+      +FPEEY +ET TGLV
Sbjct: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEGA--EFPEEYEIETRTGLV 99

Query: 135 KMKTLETLKRKSTQVSRNXXXXXXXXXXXXXXXXXXXXXXIAQKINMAVERNKKEIAKYQ 194
           K+ TL  L R  T+V+ +                         K+   +ERN+KEI  Y 
Sbjct: 100 KVATLHQLNRLDTRVTTHSSKKSTKEKNTSCGYDN-------DKLQKCIERNQKEIDSYH 152

Query: 195 KHKSEKGIKGFFHRMF 210
           K   + G K F  ++F
Sbjct: 153 K---KSGFKKFIGKLF 165

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+  Q   IPD NAP TTT    FPEEY +ET TGLV + TL++L R ST
Sbjct: 51  TETVKSLQEMGMT-QDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSLGRTST 109

Query: 148 QVSRN 152
            +S++
Sbjct: 110 AISKS 114

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  GL    K IPD NAP T+ G   FPEEY LET TGLVK+ TL +L R  +
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAGV-IFPEEYTLETPTGLVKIATLVSLGRTGS 102

Query: 148 QVSRN 152
            V R 
Sbjct: 103 AVPRG 107

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      +PD NAP TT     FPEEY +ET TGLV + TL+++ R ST
Sbjct: 45  TETVKSLQEMGMT-ATAPVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSIGRTST 103

Query: 148 QVSRN 152
            +SR+
Sbjct: 104 AISRS 108

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 49/142 (34%), Positives = 70/142 (49%), Gaps = 30/142 (21%)

Query: 11  DYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKHSGATLKKL 70
           D + E I+SF+S DSY   P T +  T           A+ G   D   S  SG+   +L
Sbjct: 2   DSDQESINSFNSRDSYTQVPQTYVPST-----------ATSGR--DPRRSSASGSDRLRL 48

Query: 71  DSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLT-TTGTNQFPEEYRLET 129
                            +ET++SL+  G+  +   +PD NAP   T+G   FPEEY LET
Sbjct: 49  VP---------------TETVKSLQEMGVTPE-APLPDVNAPAAATSGKAIFPEEYTLET 92

Query: 130 DTGLVKMKTLETLKRKSTQVSR 151
            TGLV + TL++L R ++ V+R
Sbjct: 93  ATGLVPVATLQSLGRTTSGVTR 114

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKS 146
           +ET +SL+  GL      IPD+NAP T+   N  FPEEY LET TGLV + TL +L R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 147 TQVSR 151
           T +SR
Sbjct: 107 TAISR 111

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+  +   IPD NAP T   T  FPEEY +ET TGLV + TL+++ R +T
Sbjct: 51  TETVKSLQDMGMT-KNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTAT 109

Query: 148 QVSR 151
            +SR
Sbjct: 110 SISR 113

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKS 146
           +ET++SL+  G+   +  +PD NAP   +G N+ FPEEY LET TGLV + TL ++ R S
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAP--QSGKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 147 TQVSR 151
           T +SR
Sbjct: 107 TAISR 111

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G++    A+PD NAP  +     FPEEY +ET TGLV + TL++L R ST
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAP-QSNRNAIFPEEYTIETTTGLVPVATLQSLGRTST 109

Query: 148 QVSR 151
            +SR
Sbjct: 110 AISR 113

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+   +  IPD NAP  ++    FPEEY LET TGLV + TL ++ R ST
Sbjct: 50  TETVKSLQDMGVS-SKAPIPDVNAP-QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 148 QVSR 151
            +SR
Sbjct: 108 AISR 111

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+   R  +PD NAP  ++    FPEEY +ET TGLV + TL ++ R ST
Sbjct: 50  TETVKSLQDMGVS-SRAPVPDVNAP-QSSKNKIFPEEYTIETPTGLVPVATLHSIGRTST 107

Query: 148 QVSR 151
            +SR
Sbjct: 108 AISR 111

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKS 146
           +ET++SL+  G+  +   +PD NAP T  G    FPEEY LET TGLV + TL++L R  
Sbjct: 57  TETVKSLQDMGVTPE-APLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 147 TQVSR 151
           + VSR
Sbjct: 116 SAVSR 120

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET+++L+  G+  +   +PD NAP T+     FPEEY +ET TGLV + TL++L R +T
Sbjct: 52  TETVKTLQDLGVT-RDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSLGRTAT 110

Query: 148 QVSR 151
            ++R
Sbjct: 111 SITR 114

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  GL      IPD NAP T+   + FPEEY +ET TGLV + TL +L R ST
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAP-TSNKHSIFPEEYTMETPTGLVPVATLHSLGRNST 102

Query: 148 QVSR 151
            ++R
Sbjct: 103 TITR 106

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+   +  +PD NAP  ++    FPEEY LET TGLV + TL ++ R ST
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAP-QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 148 QVSR 151
            +SR
Sbjct: 108 AISR 111

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      +PD NAP  T   N FPEEY +ET +GLV + TL+++ R +T
Sbjct: 45  TETVKSLQDLGVT-SNAPVPDINAP-QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTAT 102

Query: 148 QVSR 151
            +SR
Sbjct: 103 ALSR 106

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      IP  NAP  T+    FPEEY +ET TGLV + TL++L R S 
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAP-QTSRVQIFPEEYTMETPTGLVPVATLQSLGRSSL 105

Query: 148 QVSR 151
            V+R
Sbjct: 106 AVTR 109

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      +PD NAP  T   N FPEEY +ET +GLV + TL+++ R ++
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP-QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTAS 102

Query: 148 QVSR 151
            +SR
Sbjct: 103 ALSR 106

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      +PD NAP  T   N FPEEY +ET +GLV + TL+++ R ++
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP-QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTAS 102

Query: 148 QVSR 151
            +SR
Sbjct: 103 ALSR 106

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET ++L+  G+  +   +PD NAP  +     FPEEY +ET TGLV + TL+++ R S+
Sbjct: 50  TETAKTLQDMGMTSE-APLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNSS 108

Query: 148 QVSR 151
            +SR
Sbjct: 109 AISR 112

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET++SL+  G+      +PD NAP  T   N FPEEY +ET +GLV + TL+++ R ++
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP-KTAKNNIFPEEYTMETPSGLVPVATLQSMGRTAS 102

Query: 148 QVSR 151
            +SR
Sbjct: 103 ALSR 106

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET+++L+  G+      +PD NAP ++     FPEEY +ET TGLV + TL+++ R ++
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTAS 104

Query: 148 QVSR 151
            +SR
Sbjct: 105 AISR 108

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 88  SETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKST 147
           +ET +SL+  G+      IPD NAP     +  FPEEY +ET TGLV + TL ++ R ++
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP-QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTTS 101

Query: 148 QVSR 151
            VSR
Sbjct: 102 AVSR 105

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 63/132 (47%), Gaps = 29/132 (21%)

Query: 32  TGLEHTKNENL--------SRKATNASQGTYMDDA-TSKHSGATLKKLDSLAIEKVVTQN 82
           TGLE T+ +          SR    +S  +Y+    T++ S A+  +   L         
Sbjct: 18  TGLEDTQPQQYIYQSVSRQSRDDLQSSINSYLTTTPTNRSSNASTNQRLKLV-------- 69

Query: 83  AVAGNSETIESLKAKGLDMQRKAI---PDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTL 139
                +ET++SL    +DM   +    P  NAP  T+    FPEEY LET+TGLV + TL
Sbjct: 70  ----KTETVKSL----IDMGVSSYIPNPAINAP-KTSKKAIFPEEYTLETETGLVPVSTL 120

Query: 140 ETLKRKSTQVSR 151
            +L R +T +SR
Sbjct: 121 HSLGRTNTNLSR 132

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 75  IEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLV 134
           +E+ VT  A++   ET E+L+  G+  +   +PD  AP T      FPEEY +ET +G+V
Sbjct: 28  LEQDVTSRALS-RHETAETLQTMGMA-RGTPLPDVVAP-TYAAAPVFPEEYTMETPSGIV 84

Query: 135 KMKTLETLKRKSTQVSR 151
            +  LE+L R  T VS+
Sbjct: 85  PLAQLESLGRTVTTVSK 101

>CAGL0D01298g Chr4 (145031..147070) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P23254 Saccharomyces cerevisiae
           YPR074c TKL1 transketolase or uniprot|P33315
           Saccharomyces cerevisiae YBR117c TKL2
          Length = 679

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 42  LSRKATNASQGTYMDDATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDM 101
           LSR+     +G+ ++ A     G  LK+ ++  I  V T + V    + ++ L AKG+  
Sbjct: 525 LSRQNLPQLEGSSVEKALK--GGYVLKEANNADITLVSTGSEVYLTVDAVKVLAAKGITA 582

Query: 102 QRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKS 146
           +  ++PD+ A       +Q PE+Y+L        + ++E L  KS
Sbjct: 583 RVVSLPDFLA------FDQQPEDYKLSVLPDGAPVMSVEVLSTKS 621

>Kwal_23.5383 s23 (1136313..1140857) [4545 bp, 1514 aa] {ON} YPR184W
           (GDB1) - Glycogen debranching enzyme [contig 8] FULL
          Length = 1514

 Score = 29.6 bits (65), Expect = 6.4,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 23  VDSYKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKHSGATLKKLDSLAIEKVVTQN 82
           ++ YKP  F      +N   SR     +Q  Y     + + G     L+SLA++ VV++ 
Sbjct: 97  LEVYKPGSFCFYFSYRN---SRDELETTQRFYFVAPPNLYIGDRFVPLNSLAVQSVVSKW 153

Query: 83  AVAGNSETIESLKAKGLD------MQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKM 136
             +      E + AKG +      +QR+     N+P +     +F  E+    D  + KM
Sbjct: 154 MGSNWDVVFEKIAAKGYNLIHFTPLQRRG--SSNSPYSIYDQLEFDPEHFPNNDKDVAKM 211

Query: 137 KTLETLKRK 145
             +++L+ K
Sbjct: 212 --VKSLREK 218

>Skud_10.144 Chr10 complement(271684..273042) [1359 bp, 452 aa] {ON}
           YJL049W (REAL)
          Length = 452

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 20/122 (16%)

Query: 27  KPEPFTGLEHTKNENLSRKATNASQGTYMDDATS---------KHSGAT---LKKLDSLA 74
           K    T L  TKNE ++ +       TY ++AT+         KH  A+   + K+ +  
Sbjct: 160 KASSITDLVFTKNEFITGETLGPFFATYNEEATNIFLYFLENYKHVIASKDNVIKIVAPE 219

Query: 75  IEKVVTQNA--VAGNSETIESLKAKGLDMQ------RKAIPDYNAPLTTTGTNQFPEEYR 126
           +E V+++ +  +  +   I S+KA  L++       RK I +YN  L     N+ P++ R
Sbjct: 220 VEDVISRFSKDITEDDLRIASVKAGILNINKQITRLRKEINEYNVKLKDPEFNELPKKVR 279

Query: 127 LE 128
           +E
Sbjct: 280 IE 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.123    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,940,479
Number of extensions: 747620
Number of successful extensions: 2850
Number of sequences better than 10.0: 82
Number of HSP's gapped: 2807
Number of HSP's successfully gapped: 86
Length of query: 211
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 106
Effective length of database: 41,441,469
Effective search space: 4392795714
Effective search space used: 4392795714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)