Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10582g3.487ON31931917120.0
Smik_6.2233.487ON3133268221e-109
Suva_7.4153.487ON3133257891e-104
YGR127W3.487ON3123257811e-103
Skud_7.4383.487ON3133247711e-101
KAFR0C019303.487ON3133217611e-99
NCAS0E008403.487ON3363177594e-99
NDAI0G009703.487ON3323347324e-95
SAKL0F02882g3.487ON2983187191e-93
TPHA0D032603.487ON3143276672e-85
Kpol_1017.93.487ON3103246592e-84
KNAG0B008403.487ON3133216592e-84
KLLA0E04687g3.487ON3063246436e-82
TDEL0D055503.487ON3103186183e-78
Ecym_12423.487ON3113296002e-75
Kwal_55.212173.487ON3033175704e-71
KLTH0F14718g3.487ON3003195695e-71
ZYRO0D10098g3.487ON2762655163e-63
AFR305W3.487ON3093225183e-63
TBLA0D029903.487ON3183284707e-56
NDAI0C053008.507ON757113721.9
Kpol_1051.382.92ON112497703.1
TDEL0D032103.304ON75984703.2
KNAG0J023203.304ON75882693.7
TPHA0A038903.304ON76084684.9
KAFR0E004001.496ON39662685.3
KLTH0D08800g2.601ON91099677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10582g
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   664   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   321   e-109
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   308   e-104
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   305   e-103
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   301   e-101
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   297   e-99 
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   296   4e-99
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   286   4e-95
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   281   1e-93
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   261   2e-85
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   258   2e-84
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   258   2e-84
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   252   6e-82
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   242   3e-78
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   235   2e-75
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   224   4e-71
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   223   5e-71
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   203   3e-63
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   204   3e-63
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   185   7e-56
NDAI0C05300 Chr3 complement(1226365..1228638) [2274 bp, 757 aa] ...    32   1.9  
Kpol_1051.38 s1051 complement(89403..92777) [3375 bp, 1124 aa] {...    32   3.1  
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...    32   3.2  
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...    31   3.7  
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...    31   4.9  
KAFR0E00400 Chr5 (91314..92504) [1191 bp, 396 aa] {ON} Anc_1.496...    31   5.3  
KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {...    30   7.9  

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/319 (100%), Positives = 319/319 (100%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240
           NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG
Sbjct: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240

Query: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300
           VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI
Sbjct: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300

Query: 301 SLYSTSNPKEELRYEYDIE 319
           SLYSTSNPKEELRYEYDIE
Sbjct: 301 SLYSTSNPKEELRYEYDIE 319

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  321 bits (822), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 224/326 (68%), Gaps = 21/326 (6%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHNDDFILSPYDLAR    +    FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAR--TSKEGQEFGT 58

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W+G+N++G++AT+LNL++  E   +  I  +SRG LP++FL++ + NF+DWD+Y+KF   
Sbjct: 59  WSGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNH 115

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176
           Y  +K TGDFN FYGD  E +Y +IDSLG T  + S   +     Y+VISN        +
Sbjct: 116 YDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNG-------R 168

Query: 177 SQDINSGPEE-WGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235
             + +S PE+ W K+K  +  +E+ V  N  L +E +I +CF+LAS + +   +++  D+
Sbjct: 169 FYNTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKP-DV 227

Query: 236 VKSL---GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERI 292
           ++ L    VT  TIYV PL  PP +++G+ +  G +YGTRSQIVLL+ K  TKATFIERI
Sbjct: 228 LQMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERI 287

Query: 293 IYSSDQDISLYSTSNPKEELRYEYDI 318
           IYSSD+D+  YS S PKEE R+E+++
Sbjct: 288 IYSSDEDVRQYSVSAPKEEKRFEFEL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  308 bits (789), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 213/325 (65%), Gaps = 19/325 (5%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL ATR HP YELI+ISNRDEFLERKTH+TCWHNDDFILSPYD+A+         FGT
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAK--TSMEKQIFGT 58

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W+G+N++G++AT+LNL++ D+   +     +SRG LPF FL   +  F+DWD Y KF K 
Sbjct: 59  WSGINKEGKLATILNLKMDDQ---RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKH 115

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176
           Y  ++ TGDFN FYGD  E RY +IDSLG+T  +     +     Y+VISN    K H  
Sbjct: 116 YDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNG---KYHNS 172

Query: 177 SQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLV 236
           S   +   + W K+K  +  +E  +  N    +E +I NCF+LAS + + D   +  DL+
Sbjct: 173 S---SISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKP-DLL 228

Query: 237 KSL---GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293
           + L    VT  TIYV PL  PP +++G+ +  G YYGTRSQIVLLV K  +K TFIER++
Sbjct: 229 QMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVL 288

Query: 294 YSSDQDISLYSTSNPKEELRYEYDI 318
           YSSD+D+S YS S PKEE R+E+++
Sbjct: 289 YSSDEDVSHYSASAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  305 bits (781), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 218/325 (67%), Gaps = 20/325 (6%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHN+DFILSPYDLA+  A +    FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQ--IFGT 58

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W+G+N++G++AT+LNL++ +E +  +    RSRG LPF+FL+  + +FEDWD Y KF   
Sbjct: 59  WSGINKEGKLATILNLKLDNEQNNTK---SRSRGLLPFIFLSIHKADFEDWDNYKKFEGH 115

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176
           Y  +K TGDFN FYGD  + +Y +IDSLG T  + S   +     Y+V+SN        +
Sbjct: 116 YDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNG-------K 168

Query: 177 SQDINSGP-EEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235
             D +S P + W K+K  +  +E  V  N    +E +I +CF+LAS + +   I+   D+
Sbjct: 169 FYDSSSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNP-DV 227

Query: 236 VKSL--GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293
           ++ +   VT  TIYV PL  PP +++G+ +  G YYGTRSQIVLLV K  T+ TFIER++
Sbjct: 228 LQMVDPNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVL 287

Query: 294 YSSDQDISLYSTSNPKEELRYEYDI 318
           YSSD+D+  YS ++PKEE R+++ +
Sbjct: 288 YSSDEDVRKYSVTSPKEEKRFKFKL 312

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  301 bits (771), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 211/324 (65%), Gaps = 17/324 (5%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHNDDFILSPYDLA+    +    FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAK--TSKEKQIFGT 58

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W+G+NR+G++AT+LNL++  + D    I  +SRG LPF FL+  + +F++WD Y KF   
Sbjct: 59  WSGINREGKLATILNLKLDGQRD---TIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMN 115

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           Y  +  TGDFN FYGD  E +Y LIDSLG T  +     K      +N++  + + + + 
Sbjct: 116 YDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCK------SNLNSYMAVSNGEF 169

Query: 181 NSGP----EEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITE--EFD 234
            + P    + W K+K  +  +E+ V  N +  +E +I NCF+LAS + +    ++     
Sbjct: 170 YNSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQ 229

Query: 235 LVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIY 294
           ++    V   TIYV PL  PP +++G+ +  G YYGTRSQIVLLV K+ +K TFIERI+Y
Sbjct: 230 MLADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILY 289

Query: 295 SSDQDISLYSTSNPKEELRYEYDI 318
           SSD+D++ YS + PKEE R+E+ +
Sbjct: 290 SSDEDVNHYSVATPKEEKRFEFKL 313

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  297 bits (761), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 208/321 (64%), Gaps = 12/321 (3%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCILFATR H +YELI+ISNRDE+L RKTH TCWHND+FILSPYD++R      N  FGT
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSR-EENHGNKIFGT 59

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN---FEDWDTYAKF 117
           W G+N+KG++AT+LNLR    +D+K ++  RSRG +PF FL     N   FE+W+T+ KF
Sbjct: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177
              YP ++ +GDFN FYGD KEG Y +IDSLGNT  +     +  ++ISN+++     Q 
Sbjct: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-MIISNDLY-----QH 173

Query: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237
           +D   G   WGKIK G + + +F+K      +++V+  CF+LAS   I   IT E +  K
Sbjct: 174 KDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNK 233

Query: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297
            L    ETIYV PL   P E+IG   T G+YYGTR+QIV+LV K +   T +E  I++SD
Sbjct: 234 ELAA--ETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291

Query: 298 QDISLYSTSNPKEELRYEYDI 318
           ++I  YS  NPKE  R ++ I
Sbjct: 292 EEIYKYSGLNPKEVQRLDFTI 312

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  296 bits (759), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 212/317 (66%), Gaps = 5/317 (1%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL AT  HP YELI+ISNRDEF ERKTH +CWHNDDFILSP+D+A+         FGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W G+NR  ++AT+LNL++  +LD+K+++  +SRG +PFVFL++   +F  WDTY KF   
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           Y  +++TGDFN FYGD     Y +IDS GNT  + S  G  YL +SN++     +  +  
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLS--GDPYLTVSNDMFATGGITVERA 194

Query: 181 -NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSL 239
            N+   EW KIK GK ++++ V+ + +L ++ +IE CFKLAST  +  K   +F+   +L
Sbjct: 195 SNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTL 254

Query: 240 GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQD 299
            +  ETI+V PL    +++IG+ L+ G+YYGTRSQIV+L+ K+  +   +E I+Y+SD D
Sbjct: 255 PM--ETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312

Query: 300 ISLYSTSNPKEELRYEY 316
           I  YS++NPKE   +E+
Sbjct: 313 IQHYSSTNPKEVKSFEF 329

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  286 bits (732), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 216/334 (64%), Gaps = 20/334 (5%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL AT  HPDYELI+ISNRDEFL+RKTH++CWHNDDFILSPYD+A+         FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDR-QGNFEDWDTYAKFCK 119
           W G+N+ G++ATVLNL++   L +K+++  +SRG LPFV+L+D  + +F +WD Y  F K
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 120 CYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNI---HDKL-HL 175
            YP ++ TGDFNLFYGD K  +Y ++DS+GNT    +   + YLV+SN++   + +L  L
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-YLVVSNDVFTCNGQLGEL 179

Query: 176 QSQ--------DINSGPEEWGKIKKGKQIMEEFVKTNTNLGKED---VIENCFKLASTNL 224
           QS          + S  E WGK+K G  +++  V  +  + K+D   +I  CFKL+ST  
Sbjct: 180 QSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSI-VEKQDEDTIISECFKLSSTCS 238

Query: 225 ILDKITEEFDLVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKT 284
           +   + +     ++  +  ETI V PL     +++G+ L  G+YYGTRSQIV+L+ +   
Sbjct: 239 V--TVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296

Query: 285 KATFIERIIYSSDQDISLYSTSNPKEELRYEYDI 318
           +  F E +IY+SD DI  +S +NPKE +R+++ +
Sbjct: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  281 bits (719), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 143/318 (44%), Positives = 202/318 (63%), Gaps = 20/318 (6%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL  T  HP Y LI+ISNRDEF ER+TH TC H+DDFI+SP+D++    G++   FGT
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN---FGT 57

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W GVN+ G+VA +LNLRI    + K +   +SRG +P  FL  +  +F +WD+Y KF   
Sbjct: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHH 117

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           YP I++TG+FNLFYGD  +G Y LI SL  T   F     GY+V+SN           D+
Sbjct: 118 YPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQN-DDGYMVVSN-----------DL 165

Query: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240
            S  ++WGKI   K ++   V+++ +  K+ +++ CFKLAS +   +KI     +VK   
Sbjct: 166 ISSKKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKI-----VVKHES 220

Query: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300
           VT ETIYV PLL    +++   +  G+YYGTRSQIV+LV K + K TF+ER++Y+ D+D+
Sbjct: 221 VTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDV 280

Query: 301 SLYSTSNPKEELRYEYDI 318
             Y   NPKE++ +E+DI
Sbjct: 281 LKYGPKNPKEQIEFEFDI 298

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  261 bits (667), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 211/327 (64%), Gaps = 23/327 (7%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWH--NDDFILSPYDLARIGAGQSNDTF 58
           MCILF TR HPDYELI+ISNRDEFL+RKT  +CW+  ++  +L PYDL+R     S   F
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPS--KF 58

Query: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN-FEDWDTYAKF 117
           GTW G+N  GRV++VLNL++ +     + + ++SRG LP  FL++R+ N F DW++Y+KF
Sbjct: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLF---SKPGKGYLVISNNIHDKLH 174
            K YPD+++TG FNLF GD K+  YALIDS G T  +     + GK  +VISN       
Sbjct: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISN------- 171

Query: 175 LQSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFD 234
             S+ I++  E W KI  G+++M+EF+  +    +  VIE+CFK+AST+ + ++     D
Sbjct: 172 --SEFISNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHD 228

Query: 235 LVKSLGVTKETIYVQPL-LTPPHEE--IGSPLTAGQYYGTRSQIVLLVDKSKTKATFIER 291
            +  L +  ET++V P+ L  P E+  IG+ L  G++YGTRSQIV+LV+K +T   ++ER
Sbjct: 229 DI--LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMER 286

Query: 292 IIYSSDQDISLYSTSNPKEELRYEYDI 318
           ++Y  D D+S      P  EL +EY+I
Sbjct: 287 VLYECDDDVSKAGIEKPINELNFEYNI 313

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  258 bits (659), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 208/324 (64%), Gaps = 20/324 (6%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDF--ILSPYDLARIGAGQSNDTF 58
           MCIL A+R+HP+Y+LI+ISNRDEFL+R+TH TCW+  ++  IL PYD+++      N   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVN-KI 59

Query: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN-FEDWDTYAKF 117
           GTW G+N  GRV+T+LNL+  D         ++SRGALP  FL++++ +   +WD+Y KF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177
            K YP +K TGDFN FYGD + G+Y +IDS+G+T+ + +     YLVISN+   K + +S
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLT-VDNPYLVISNDKFGKSNGKS 178

Query: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237
                  +EW KI   K +++      T   ++D+I  CF +ASTN + + + ++ D+ +
Sbjct: 179 T------KEWEKITLAKNLLKHLPLCET---EDDLIHKCFDIASTNTLNEDLIKDVDVRE 229

Query: 238 SLGVTKETIYVQPLLTPPHEE---IGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIY 294
              +  ETI V PL     EE   IG+ L  GQYYGTRSQIV+LV+K++TK  FIERI+Y
Sbjct: 230 ---LMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286

Query: 295 SSDQDISLYSTSNPKEELRYEYDI 318
           +SD D++    S+P ++L Y + I
Sbjct: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  258 bits (659), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 198/321 (61%), Gaps = 13/321 (4%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL  TREHPDY+L++ISNRDEF ER TH T WH+ D+ILSPYD+ +          GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 61  WTGVNRKGRVATVLNLRICDEL---DMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKF 117
           W G+NR GRV+TVLNL++  E      K  +  RSRG +PF+FL+DR G  + WD++ KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR-GFIDQWDSFEKF 119

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177
              YPD++++GDFNLF GD ++  Y ++DS GNT  + ++     +V+SN+ + + +   
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFN--E 177

Query: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237
            DI+    EW K+K GK  + E V T  NL K   I+ CF  AS   I +K  E  D+ K
Sbjct: 178 NDIS----EWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSI-EKSHE--DISK 230

Query: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297
           +  V   TI+V PL   P +++G   + G Y+GTRSQ+V LV K + + T  ERI+++SD
Sbjct: 231 TPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSD 290

Query: 298 QDISLYSTSNPKEELRYEYDI 318
            D    S  NPKE  ++ +D+
Sbjct: 291 LDRDFNSPHNPKEVKQFTFDL 311

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  252 bits (643), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 204/324 (62%), Gaps = 24/324 (7%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCILFATR HPDY+LI++SNRDEF ERKTH+TCW++D FILSPYD+A    GQ    +GT
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQG---YGT 57

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMI--GE-RSRGALPFVFL-NDRQGNFEDWDTYAK 116
           W G+NR+GR+A +LNL+I   LD + ++  GE RSRG +P  FL  +    F++WD++ K
Sbjct: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117

Query: 117 FCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQ 176
           F   + +++RTG F LFYGD K   Y +ID L ++   F K    ++VISN+I    H  
Sbjct: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEK--MEHMVISNDI---FHCA 172

Query: 177 SQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLV 236
              +      W K + G  +++   K  T + KE++++ CF+L S +   +   E+ D  
Sbjct: 173 ---VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG--EDVD-- 225

Query: 237 KSLGVTKETIYVQPL-LTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYS 295
               VT  +IYV PL +T   + IG+ L  G YYGTRSQIV+LVDK   + T+ E +IY 
Sbjct: 226 ---SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYE 281

Query: 296 SDQDISLYSTSNPKEELRYEYDIE 319
           SD+D   YS  +PKE +++++++E
Sbjct: 282 SDEDCETYSFMDPKEVIQFQFNME 305

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  242 bits (618), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 124/318 (38%), Positives = 185/318 (58%), Gaps = 10/318 (3%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL AT +HP Y+L+++SNRDE+  RK     W  D+F+L P D    G   S +  GT
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDK---GLDSSGEDLGT 57

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W G NR G++ TVLNL++  +   +  +   SRG +P  FL+ R  NF+DWDTY KFC  
Sbjct: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQ 117

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           +  ++ T DFN FYGD   G Y +IDSLGNT  +  K  + Y+V+SN+I        Q  
Sbjct: 118 FQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF-------QGE 170

Query: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240
           ++    W KI    Q +   V+   +  ++  I+ CF +AS N    K       +K++ 
Sbjct: 171 SNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE 230

Query: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300
           ++ +T++V PL T   + +G+ +  G+YYGTRSQ V+LV K ++  T++ERII+ SD D 
Sbjct: 231 LSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDA 290

Query: 301 SLYSTSNPKEELRYEYDI 318
             YS  + KE+ RY++D+
Sbjct: 291 LQYSRDHYKEQKRYDFDL 308

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  235 bits (600), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 194/329 (58%), Gaps = 28/329 (8%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLAR----IGAGQSND 56
           MCIL AT +HPDY+LI+ISNRDEF ER+TH TCWH D  IL+PYD++       A ++  
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 57  TFGTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLND-RQGNFEDWDTYA 115
           ++GTW G+NR G V+ +LNL+   E         +SRG +   FL D   GN++ W+ Y 
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 116 KFCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHL 175
           KF + +  +  T  F LFYGD K G + LIDS   +   FS   + Y+VISN+      +
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-QPYVVISNS-----RV 174

Query: 176 QSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235
             +D   GP  W K+ +G+Q+++E VK N N+ KE +++ CF+LA T+        +FD+
Sbjct: 175 NCED--EGP-RWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTS--------QFDV 223

Query: 236 VKSLGVT-----KETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIE 290
              + VT     ++TI+V  L    +  +G     G+YYGTR+ IV+LVD +    T  E
Sbjct: 224 NGVIQVTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHE 282

Query: 291 RIIYSSDQDISLYSTSNPKEELRYEYDIE 319
            +I+ SD+DI L S  NPK ++ YE+DI+
Sbjct: 283 HVIHDSDKDIGLSSAMNPKTKVAYEFDIQ 311

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  224 bits (570), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 183/317 (57%), Gaps = 26/317 (8%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL A+  HP Y LI+ISNRDEF+ER+T  TC ++DD+++SP D+      + N   GT
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPN--LGT 58

Query: 61  WTGVNRKGRVATVLNLRI--CDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFC 118
           W G NR GR+A +LNLR    ++   KR++   SRG +   +L D+Q    DW++YAKF 
Sbjct: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTDKQP-ASDWNSYAKFA 114

Query: 119 KCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQ 178
              PDIK + +FN+FYGD K G Y  IDS G++  +  +    YLVISN           
Sbjct: 115 SKCPDIK-SCEFNMFYGDCKSGDYTAIDSSGHSFEVL-RSQNPYLVISN----------- 161

Query: 179 DINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKS 238
           D      +W KI+  +++M + V+ + N  ++D++  CF LAS      K     D +  
Sbjct: 162 DSIESATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLAS-----HKQDYNVDHMDK 216

Query: 239 LGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQ 298
             VT   I+V PL  P  E++G+ +  G++YGTRSQIV+LV K      F+E ++Y SD 
Sbjct: 217 EKVTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDP 276

Query: 299 DISLYSTSNPKEELRYE 315
           + + +  +NPK+ + Y+
Sbjct: 277 ETTHFCAANPKKCVSYK 293

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  223 bits (569), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 185/319 (57%), Gaps = 21/319 (6%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60
           MCIL A+  HP Y LI ISNRDEF ERKT +TC ++DD+ILSP D A      +    GT
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTAL--RSNNKPALGT 58

Query: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           W GVNRKGRVA +LNLR  +      +    SRG++P  +L DR G   DW+++ KF   
Sbjct: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDR-GPSTDWNSFEKFVSK 117

Query: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180
           YP I    +FN+FYGD   G Y  IDSLG +    +   K  LV+SN+     H+ S   
Sbjct: 118 YPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTA-NKPNLVLSND-----HIDSSS- 169

Query: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240
                 W K++K   +++E V+++ +  +E++IE CF LAS     +    E D      
Sbjct: 170 -----RWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS-----NTEPAEIDNSDKEE 219

Query: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300
            T  +I++ P+  P   ++G+ L  G++YGTRSQIV+LV + +   +F ER+++ SD ++
Sbjct: 220 FTCSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEV 279

Query: 301 SLYSTSNPKEELRYEYDIE 319
            L+S  +PKE+L++   ++
Sbjct: 280 PLHSEKHPKEKLQFNLHVD 298

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  203 bits (516), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 163/265 (61%), Gaps = 16/265 (6%)

Query: 58  FGTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKF 117
           FGTW G+N+ GRV TVLNL++         +   SRG +P  FL+    ++E W++Y KF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLF----SKPGKGYLVISNNIHDKL 173
              + ++  TGDFN FYGD K G+Y +IDSL  TH +     S+    Y+V+SN+++   
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY- 141

Query: 174 HLQSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEF 233
                    G E W K++  K+ + + ++ N N  ++  I  CF++AST+  LD  +EE 
Sbjct: 142 --------QGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEE- 192

Query: 234 DLVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293
            L+KS  VTK++I+V PL  PP   +G+   AG +YGTRSQIVLLV K + K TF+ER++
Sbjct: 193 -LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVL 250

Query: 294 YSSDQDISLYSTSNPKEELRYEYDI 318
           ++SD+ +S  S  +P E+L++++D+
Sbjct: 251 HNSDEQVSQRSPDHPAEQLKFQFDL 275

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  204 bits (518), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 178/322 (55%), Gaps = 18/322 (5%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAG--QSNDTF 58
           MCILFAT  HP Y+L++ISNRDE+  RKTH+TCW ++D IL+PYD+A   A         
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLND-RQGNFEDWDTYAKF 117
           GTW G+NR G V+ +LNL   D           SRGA+   +L D    N++ W+TY KF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177
              +P + +T  F  FYGD    ++++I+SLG T   FS+    Y V+SN   D      
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQ--SPYYVVSNGPSDGAKALG 178

Query: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237
           Q        W K+ +G Q+ ++ ++ + ++ +E++++ CF LAS +     ++ +   V 
Sbjct: 179 Q--------WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYS---QYVSNQPIGVH 227

Query: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297
              + K TI+V P L     +      AG YYGTRS IV+LV +     T  E +I+ SD
Sbjct: 228 DDSIPKRTIFV-PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285

Query: 298 QDISLYSTSNPKEELRYEYDIE 319
           QD+  YS  NPKE++ + + ++
Sbjct: 286 QDLDSYSILNPKEQVTHRFSLQ 307

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  185 bits (470), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 184/328 (56%), Gaps = 48/328 (14%)

Query: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLAR--IGAGQSNDTF 58
           MCIL  T  HP Y+LI+ISNRDE  ER+THSTCW+++  IL PYD+++     G  ++ F
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 59  ----GTWTGVNRKGRVATVLNLRICDELDMKRMIGE-----RSRGALPFVFLNDRQGNFE 109
               GTW G+N+ G++ TVLNL   +E    R  G+     +SRG +P  +L D    F+
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEE---ARRDGDCNNSLQSRGLIPIKYLCDFDHGFQ 117

Query: 110 DWDTYAKFCKCYPDIK-RTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNN 168
           DW+TY KF +    I  + G FNLF GD K   Y++I+S+G +  +  +    Y+V+SN 
Sbjct: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENP-YMVVSN- 175

Query: 169 IHDKLHLQSQDINSG-PE---EWGKIKKGKQIMEEFVK---TNTNLGKEDVIENCFKLAS 221
                      IN G P+   EW KIK G +++E  +     N+N  + +++E+CF+++S
Sbjct: 176 -----------INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISS 224

Query: 222 T-NLILDKITEEFDLVKSLGVTKETIYVQPLLTPPHE---------EIGSPLTAGQYYGT 271
           T NL   KI      ++ L  TK+ I+V PL     E            +   + +YYGT
Sbjct: 225 TINLSGKKIDGN---IERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGT 281

Query: 272 RSQIVLLVDKSKTKATFIERIIYSSDQD 299
           RSQIV+L ++   K TF+ERI++  ++D
Sbjct: 282 RSQIVVLCERKSNKVTFVERILHCKNED 309

>NDAI0C05300 Chr3 complement(1226365..1228638) [2274 bp, 757 aa]
           {ON} Anc_8.507 YBR156C
          Length = 757

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 19/113 (16%)

Query: 22  DEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGTWTGVNRKGRVATVLNLRICDE 81
           DEF  R  H T +  +  IL+ +  A I    +N+  GT T V   G+V T   L   D 
Sbjct: 601 DEFRRRTRHLTDFR-EAPILNDHSSA-IPIPNNNNISGTNTNVGDNGKVDTTNILHDIDT 658

Query: 82  LDMKRMIG--------------ERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120
           +D + +IG              E SR +LP +F +  Q   ED  T   + K 
Sbjct: 659 IDHRIIIGAPASSNQNSSCRVDEHSRPSLPEIFSDSEQ---EDTVTLTDWAKS 708

>Kpol_1051.38 s1051 complement(89403..92777) [3375 bp, 1124 aa] {ON}
           complement(89403..92777) [3375 nt, 1125 aa]
          Length = 1124

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 18/97 (18%)

Query: 101 LNDRQGNFEDWDTYA-KFCKCYPDIKRTG------DFNLFYGDF--KEGRYALIDSLGNT 151
           LN  + N + WD +  K     PD  R G      + NL  G+F  K G +   DS+ N 
Sbjct: 857 LNKDEKNKDIWDAFGEKLVMFGPD--RIGCNILLSNDNLLNGEFSSKHGTFDFSDSIING 914

Query: 152 H-------PLFSKPGKGYLVISNNIHDKLHLQSQDIN 181
                   PL  +P +G  +I  +IH+   ++  +IN
Sbjct: 915 FQLAVKEGPLAKEPVQGMCIIIEDIHEMTEIEMNNIN 951

>TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.304
           YBR080C
          Length = 759

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 19/84 (22%)

Query: 143 ALIDSLGNTHP----LFSKPGKGYLVISNNIHDKLHLQSQDINSGPEEWGKIKKGKQIME 198
           A+I+ LG +H     LF  PG G  +I+  I   L+ +   I +GPE          I+ 
Sbjct: 265 AVIEKLGISHVKGLLLFGPPGTGKTLIARKIGTMLNAKEPKIVNGPE----------ILS 314

Query: 199 EFVKTNTNLGKEDVIENCFKLAST 222
           ++V ++     E+ I N FK A T
Sbjct: 315 KYVGSS-----EENIRNLFKDAET 333

>KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {ON}
           Anc_3.304 YBR080C
          Length = 758

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 19/82 (23%)

Query: 143 ALIDSLGNTHP----LFSKPGKGYLVISNNIHDKLHLQSQDINSGPEEWGKIKKGKQIME 198
           A+I+ LG TH     LF  PG G  +I+  I   L+ +   I +GPE          I+ 
Sbjct: 267 AVIEKLGITHVKGLLLFGPPGTGKTLIARKIGKMLNAKEPKIVNGPE----------ILS 316

Query: 199 EFVKTNTNLGKEDVIENCFKLA 220
           ++V ++     E+ I N FK A
Sbjct: 317 KYVGSS-----EENIRNLFKDA 333

>TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.304
           YBR080C
          Length = 760

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 19/84 (22%)

Query: 143 ALIDSLGNTHP----LFSKPGKGYLVISNNIHDKLHLQSQDINSGPEEWGKIKKGKQIME 198
           A+I+ LG TH     L+  PG G  +I+  I   L+ +   I +GPE          I+ 
Sbjct: 266 AVIEKLGITHVKGLLLYGPPGTGKTLIARKIGTMLNAREPKIVNGPE----------ILS 315

Query: 199 EFVKTNTNLGKEDVIENCFKLAST 222
           ++V ++     E+ I N FK A T
Sbjct: 316 KYVGSS-----EENIRNLFKDAET 334

>KAFR0E00400 Chr5 (91314..92504) [1191 bp, 396 aa] {ON} Anc_1.496
           YML048W
          Length = 396

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 104 RQGNFEDWDTYAKFCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYL 163
           R   F +W  Y  +  C+P     G   L+  D  E +Y  ++ L    PLF +   G L
Sbjct: 52  RPSIFHEWQPYEYYKSCHPGYLTEGGCLLYSYDAAEPQY--LEKLDEEKPLFDQLWPGQL 109

Query: 164 VI 165
           +I
Sbjct: 110 II 111

>KLTH0D08800g Chr4 complement(734724..737456) [2733 bp, 910 aa] {ON}
           similar to uniprot|P35724 Saccharomyces cerevisiae
           YKL064W
          Length = 910

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 83  DMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKCYPDIKRTGDFNLFYGDFKEGRY 142
           DM R IGE  +  +  + L   + +      +AK C  + ++    +  ++ GD ++   
Sbjct: 753 DMLRRIGECRKRVMSIIRLLGSKADV--IKGFAKRCNEHWEVAPRSEIGMYLGDIQDHIV 810

Query: 143 ALIDSLGNTHPLFSKPGKGYLV--------ISNNIHDKL 173
            ++ SL +   L S+    YL         ++N+++D L
Sbjct: 811 TMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMNDVL 849

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,345,476
Number of extensions: 1746455
Number of successful extensions: 4405
Number of sequences better than 10.0: 41
Number of HSP's gapped: 4447
Number of HSP's successfully gapped: 41
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)