Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10560g3.489ON67867831110.0
Kpol_480.163.489ON65565713501e-178
Smik_6.2243.489ON70571813451e-177
Suva_7.4163.489ON71372313291e-174
YGR128C (UTP8)3.489ON71371813161e-172
Skud_7.4393.489ON71371913001e-170
NCAS0E008303.489ON67166812621e-165
ZYRO0D10054g3.489ON66470212491e-163
TBLA0C044603.489ON69867712361e-160
SAKL0F02838g3.489ON65465812261e-160
TDEL0D055703.489ON64969612131e-158
NDAI0G009603.489ON70068712011e-155
KLLA0E04665g3.489ON64765711921e-155
KLTH0F14762g3.489ON65065511821e-153
AFR307C3.489ON65065411821e-153
TPHA0D042303.489ON65268811601e-150
Kwal_55.212223.489ON3733487057e-86
KNAG0B008303.489ON6076606627e-77
KAFR0C019403.489ON6096715981e-67
Kwal_55.21225singletonOFF2152343551e-37
NDAI0C041508.737ON44788780.76
YHR079C (IRE1)5.368ON111573761.6
Suva_15.2715.368ON111573752.5
Kwal_27.106047.436ON95087743.0
TBLA0C030905.246ON56773724.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10560g
         (678 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...  1202   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   524   e-178
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   522   e-177
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   516   e-174
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   511   e-172
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   505   e-170
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   490   e-165
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   485   e-163
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   480   e-160
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   476   e-160
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   471   e-158
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   467   e-155
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   463   e-155
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   459   e-153
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   459   e-153
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   451   e-150
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   276   7e-86
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   259   7e-77
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   234   1e-67
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   141   1e-37
NDAI0C04150 Chr3 complement(949316..950659) [1344 bp, 447 aa] {O...    35   0.76 
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    34   1.6  
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    33   2.5  
Kwal_27.10604 s27 complement(416254..419106) [2853 bp, 950 aa] {...    33   3.0  
TBLA0C03090 Chr3 complement(743523..745226) [1704 bp, 567 aa] {O...    32   4.2  

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/678 (89%), Positives = 605/678 (89%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPD              KYVITPTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           RLIFNVPIPSTHLVSACNMGTYSETSTVSS                   VEETKHYEIWC
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180
           YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG
Sbjct: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180

Query: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEEKK 240
           LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEEKK
Sbjct: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEEKK 240

Query: 241 VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIEDKN 300
           VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIEDKN
Sbjct: 241 VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIEDKN 300

Query: 301 CLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSESKLT 360
           CLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSESKLT
Sbjct: 301 CLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSESKLT 360

Query: 361 LALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPEPKYELP 420
           LALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPEPKYELP
Sbjct: 361 LALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPEPKYELP 420

Query: 421 SINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKID 480
           SINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKID
Sbjct: 421 SINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKID 480

Query: 481 YNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIK 540
           YNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTC            FTIK
Sbjct: 481 YNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIK 540

Query: 541 NSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQI 600
           NSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQI
Sbjct: 541 NSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQI 600

Query: 601 FKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMDAKMLXXXXXXXXXX 660
           FKLLSLILDSIGLFG              KEVKIAERNVELWNIMDAKML          
Sbjct: 601 FKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAA 660

Query: 661 XXXXENSQTPYIVEYIDI 678
               ENSQTPYIVEYIDI
Sbjct: 661 SKLAENSQTPYIVEYIDI 678

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  524 bits (1350), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 288/657 (43%), Positives = 417/657 (63%), Gaps = 46/657 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPS SQPFRLAVLPKI SL N   + + +++AD F+ +              +Y+I PTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
            L+FNVPIPST+ V+ACN+G +   +  S                           E W 
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKL-------------------------ECWA 95

Query: 121 YALSANNKTHTLNCLIREVDNNN--TSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178
           Y LS  NK HTLN  I+  D++   TS  E    ++ K  ++I +I+++ K KVIV++ +
Sbjct: 96  YGLSY-NKNHTLNISIKTSDDDKYATSGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLK 154

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEE 238
            GL+QFYD  LKLL S+N  Y DI  V+ FEE+G ++ +++S+++ +K++ +LYE+ T +
Sbjct: 155 NGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKKISFKLYELFTND 214

Query: 239 K-KVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIE 297
           K  + EL+S+I+E+ +L +S +CYQFG+IYRLF+D + +Y++P  QL   +++PF+ + +
Sbjct: 215 KTSINELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQK-K 273

Query: 298 DKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSES 357
           D + L S  PIA NR+LLTV NKIYLLDL+H SIL+ER++SH+K +Q+LK+ +     E+
Sbjct: 274 DSDVL-SFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGEN 332

Query: 358 K--LTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE- 414
           K   T+A+G+S KNG +P S+LE+IN+DVGS +LKDSLGKSF   N +    L++LFPE 
Sbjct: 333 KNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPED 392

Query: 415 ----PKYELPSINFPEILGKLK-NANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLA 469
                K E  S ++  IL +L+ N N   KFD+ FF  LNI +E +TE  RF+ DQ+FL+
Sbjct: 393 ETIYAKGEQKSFDYKNILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLS 452

Query: 470 SVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXX 529
            VLDLIF+   + K  PR+L FLLTHPLFP      LLTK ++  RLFKQA+VTC     
Sbjct: 453 DVLDLIFSA--FKKDYPRALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPL 510

Query: 530 XXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAA 589
                  FTI N EL +DIS+RILQDYT+D+IK+E+K L +V ++NF+ F+I  ++    
Sbjct: 511 KELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVIDTDSE--- 567

Query: 590 VSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMD 646
             D + F PQ+F+LLSL+LD+ GLF                +V +AERN  LW+++D
Sbjct: 568 --DKSQFNPQLFQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLD 622

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  522 bits (1345), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/718 (41%), Positives = 428/718 (59%), Gaps = 53/718 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F                 +Y+I PT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIW 119
           P+LIF+ PIPST++++ACN G                              +  ++ EIW
Sbjct: 61  PKLIFDYPIPSTNIITACNAG------------EAQVNIEDKDNNEKVINSQTKRNIEIW 108

Query: 120 CYALSANNKTHTLNCLIREVDN--NNT------SITENN---------PQFNAKFKEQII 162
            + L  N   +TLN + + ++N  NNT      +  ENN          Q+  K K +++
Sbjct: 109 SFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVM 168

Query: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222
           +I++DTK+ +I+ + + GL++FYD +LKLL+S +  Y ++K  K F ENG+E++ ++  L
Sbjct: 169 SIKIDTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPL 228

Query: 223 KDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278
           +D KV  +L E++  E +    +KEL+S+IIE F+  DS LCYQFG++Y+L K +I VYS
Sbjct: 229 QDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYS 288

Query: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338
           +P  QL   +++P ++  + ++ LIS +P++ NRVLLTV N +YLLDLLH S L +RE+S
Sbjct: 289 LPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELS 348

Query: 339 HMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397
           H+KTFQ+L TA +N + S S  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 349 HVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSF 408

Query: 398 LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGKLK--NANSAEKFD 441
                     LK LF + +                +P+  + EI+ KL    +N    FD
Sbjct: 409 QAEKKDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFD 468

Query: 442 ETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKE 501
           + FF  L IKEE +TE  RF++D  FL  VLDLIF K + N   P++L FLLTHPLFP +
Sbjct: 469 DIFFKDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGN-DYPKTLTFLLTHPLFPLD 527

Query: 502 KAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAI 561
           +   LL+ ++   RLFKQAIVTC            F+I+N EL++DIS RILQD+T+D+I
Sbjct: 528 RTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSI 587

Query: 562 KEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXX 621
           K+E+K+L ++ ++NF+ F+    N  +        + Q+F+LLSL+LDSIGLF       
Sbjct: 588 KQEMKRLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALL 647

Query: 622 XXXXXXXXKEVKIAERNVELWNIMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEYIDI 678
                   K+VKIAERN ELWN++D K                +    P Y +EY+DI
Sbjct: 648 ESLTSYIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  516 bits (1329), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 297/723 (41%), Positives = 436/723 (60%), Gaps = 55/723 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD  F                 +Y+I PT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACN--MGTYS-ETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHY 116
           P+L F+ PIPST++++ACN   G    E  T +S                    +  +  
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTN--------FQSKRDV 112

Query: 117 EIWCYALSANNKTHTLNCLIREV-DNNNTS---ITENN-------------PQFNAKFKE 159
           EIW + L  N   +TLN + + V DN++TS   +TEN               Q+  K K+
Sbjct: 113 EIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKD 172

Query: 160 QIINIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLI 219
           +++NI++D K+ +++ + + GLV+FYD +LKLL+S +  Y ++K  K F ENG E++ ++
Sbjct: 173 KVMNIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVL 232

Query: 220 SDLKDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIE 275
             L+D KV  +L+E+S  E K    +KEL+S+IIE F+ + S  CYQFG++Y+L + +I 
Sbjct: 233 CPLEDDKVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIH 292

Query: 276 VYSIPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSER 335
           VYS+P  QL   + +P +++   +N LIS +P++ NR+LLTV N IYLLDLLH SIL++R
Sbjct: 293 VYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQR 352

Query: 336 EVSHMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLG 394
           E++H++TFQ+L++A ++ + S++  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLG
Sbjct: 353 ELTHVRTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLG 412

Query: 395 KSF-LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGK---LKNANS 436
           KSF + +N+     LK LF +                  +P+  + EI+ K   LKN N 
Sbjct: 413 KSFQIGKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKN-ND 471

Query: 437 AEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHP 496
              FD+ FF  L +KEE +TE  RF++D  FL  VLDLIF K + N   P++L FLLTHP
Sbjct: 472 VASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGN-DYPKALTFLLTHP 530

Query: 497 LFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDY 556
           LFP  +   LL++++   RLFKQAIVTC            F+I+N EL++DIS RILQD+
Sbjct: 531 LFPLNRTHNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDF 590

Query: 557 TKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGX 616
           T+D+IK+E+K L ++ ++NF++FI   +      +     + Q+F+LLSL+LDSIGLF  
Sbjct: 591 TRDSIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSL 650

Query: 617 XXXXXXXXXXXXXKEVKIAERNVELWNIMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEY 675
                        K+V+IAERN ELWN+++ K                +    P Y +EY
Sbjct: 651 EGALLDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEY 710

Query: 676 IDI 678
           ++I
Sbjct: 711 LEI 713

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  511 bits (1316), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/718 (40%), Positives = 423/718 (58%), Gaps = 45/718 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F                 +Y+I PT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIW 119
           P+L F+ PIPST++++ACN    +E    +                     ++ ++ EIW
Sbjct: 61  PKLTFDYPIPSTNIITACN----AEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIW 116

Query: 120 CYALSANNKTHTLNCLIREV----DNNNTSITENN-------------PQFNAKFKEQII 162
            + L  N   +TLN + + +    D +N  ++E++              Q+  K K +++
Sbjct: 117 AFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVM 176

Query: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222
           +I++DTK+ +++ + + GL++ +D +L LL+S +  Y ++K  K F ENG EY+ ++  L
Sbjct: 177 SIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPL 236

Query: 223 KDQKVALQLYEV----STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278
           +D KV  +L E+    S E   +KEL+S+IIE F+ ++S LCYQFG++Y+L + +I +YS
Sbjct: 237 QDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYS 296

Query: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338
           +P  QL   ++ P + ++   + LIS +P++ NRVLLTV N IYLLDLLH S LS+RE++
Sbjct: 297 LPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELT 356

Query: 339 HMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397
           H+KTFQ+LK+A +N + S +  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 357 HVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 416

Query: 398 LRRNNQIQGQLKNLFPE--------------PKYELPSINFPEILGKLK--NANSAEKFD 441
              NN     LK LF +                  +P ++  E++ KL     N    FD
Sbjct: 417 QVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFD 476

Query: 442 ETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKE 501
           + FF  L IKEE +TE  R+++D  FL  VLDLIF K   N   P++L FLLTHPLFP  
Sbjct: 477 DIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGN-DYPKTLTFLLTHPLFPLS 535

Query: 502 KAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAI 561
           +   LL+ ++   RLFKQAIVTC            F+I+N EL++DIS RILQD+T+D+I
Sbjct: 536 RTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSI 595

Query: 562 KEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXX 621
           K+E+KKL ++ V+NF+ FI       +        + Q+F+LLSL+LDSIGLF       
Sbjct: 596 KQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALL 655

Query: 622 XXXXXXXXKEVKIAERNVELWNIMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEYIDI 678
                   K+V+IAERN ELWN++D K                +    P Y +EY+DI
Sbjct: 656 ENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  505 bits (1300), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 291/719 (40%), Positives = 423/719 (58%), Gaps = 47/719 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F                 +Y+I PT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIW 119
           P+L F+ PIPST++++AC+         V+                     +  ++ EIW
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQ----VNVEEDLKISNDDSNDEEKAANSQTKRNIEIW 116

Query: 120 CYALSANNKTHTLNCLIREVDNN----NTSITENN-------------PQFNAKFKEQII 162
            +    N   +TLN   + +++N    N  + E++              Q   K K +++
Sbjct: 117 SFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVM 176

Query: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222
           NI++D K+ +I+ + + GL++FYDL+LKLL S +  Y ++K  K F ENG +++ ++  L
Sbjct: 177 NIKIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPL 236

Query: 223 KDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278
           +D KV  ++ E+S  E K    +KEL+S+IIE F+ + S LCYQFG++Y+L + +I VYS
Sbjct: 237 EDDKVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYS 296

Query: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338
           +P  QL   +++P +++   ++ LIS +P++ NR+LLTV N IYLLDLLH SIL+ RE++
Sbjct: 297 LPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELT 356

Query: 339 HMKTFQILKTAM-NRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397
           H+KTFQ+LK+A+ + + S +  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 357 HVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 416

Query: 398 LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGKLK--NANSAEKFD 441
               N     LK LF +                  +P  ++ E++ KL     N    FD
Sbjct: 417 QVGKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFD 476

Query: 442 ETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKE 501
           E FFN L +KEE +TE  RF++D  FL  VLDLIF K   N   P++L FLLTHPLFP  
Sbjct: 477 EIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGN-DYPKALTFLLTHPLFPLN 535

Query: 502 KAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAI 561
           +  GLL+ ++   RLFKQAIVTC            F+I+N EL++DIS R+LQD+T+D+I
Sbjct: 536 RTHGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSI 595

Query: 562 KEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTM-FTPQIFKLLSLILDSIGLFGXXXXX 620
           K+E+KKL ++ ++NF+  I      +  +  F    + Q+F+LLSL+LDSIGLF      
Sbjct: 596 KQEMKKLSKLDIQNFIECITNT-EEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGAL 654

Query: 621 XXXXXXXXXKEVKIAERNVELWNIMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEYIDI 678
                    K+VKIAERN ELWN++D K                +    P Y +EY+DI
Sbjct: 655 LENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  490 bits (1262), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/668 (42%), Positives = 418/668 (62%), Gaps = 60/668 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRL +LPKIASL NF+ +  YI+V DS F+P               +Y++ PT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIW 119
           P+LIFN PIPST++V+ACN+     +S                        EET     W
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSS------------------------EET-----W 91

Query: 120 CYALSANNKTHTLNCLIR--------EVDNNNTSITENNPQFNAKFKEQIINIEVDTKHK 171
           C+A  A NKT TLN + +        E  ++  S +    +F  K  + +++I++  K K
Sbjct: 92  CFATMA-NKTSTLNLINKNQYQTNEEESGDSAPSDSSVTSEFKIKADDHVVDIKILNKKK 150

Query: 172 VIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQL 231
           +IV+L + G +Q YD +LKLLNSIN  Y +++ V+ F E+G ++M ++ DL++ KV L+L
Sbjct: 151 IIVVL-KNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKL 209

Query: 232 YEVS----TEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSK 287
           ++++    T      ELTS+I+ENF L+++  CYQFG+ Y+L  D+I VYS+P  Q    
Sbjct: 210 FQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYS 269

Query: 288 VKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILK 347
           + +P ++++++   ++S KPI+ NR+LLTV NKIYLLDL+H SILSERE++H+KTFQ+LK
Sbjct: 270 ITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLK 329

Query: 348 TAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRN--NQIQ 405
           TA+         TLA+G+STK G NPTS+LE++N+DVG++++KDSLGKSF   +  N +Q
Sbjct: 330 TAVVDTNINQNRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQ 389

Query: 406 GQLKNLF------PEPKYELPSINFPEILGKLKNA-NSAEKFDETFFNLLNIKEEMFTEN 458
             LK+LF       + K ++ + N+ +I  +L ++ N   KFD+ FF   +IK+E +TE 
Sbjct: 390 S-LKSLFDDENDYSDKKKQVKNFNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEK 448

Query: 459 SRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFK 518
            RF+ +  FL  ++DLIF    + +  P++  +LLT PLFP E+  GLL ++ ++ RLFK
Sbjct: 449 DRFIYNHEFLVQIIDLIFET--FKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFK 506

Query: 519 QAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMN 578
           QAIVTC            FTI N EL +DIS+RILQDYT+D+IK+E+KKL ++ VENF+ 
Sbjct: 507 QAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIE 566

Query: 579 FIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERN 638
           FII   + E+ + D T   P +F+LLSL++DSIGLF               ++V IA+ N
Sbjct: 567 FII---DEESDIKD-TTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSN 622

Query: 639 VELWNIMD 646
            ELW+++D
Sbjct: 623 TELWHLLD 630

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 267/702 (38%), Positives = 414/702 (58%), Gaps = 62/702 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPS+ QPFRL+VLP+I +L N+  +  Y++V+   +P+              +Y++ PTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L+ N+ IPST++VSAC++ T ++                                EIWC
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDK------------------------------EIWC 90

Query: 121 YALSANNKTHTLNCLIREVDNN---NTSITENNPQFNAKFKEQIINIEVDTKHKVIVILF 177
           Y + +  K+H LN  ++ VD +   +T   +    F  K   +++ I++   +K IV++ 
Sbjct: 91  YCVKSG-KSHFLNASVKPVDADTVLDTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVL 149

Query: 178 ETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTE 237
           E+GL+Q+YD QL+ L+S++  Y+++K+V  F ENG  +M ++S  ++ KV  +L+E+   
Sbjct: 150 ESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKVCFKLFELLYH 209

Query: 238 EKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFL 293
           + K    +KEL+++I+ENFNL  S LCYQ G++Y+L    I+ Y++P   L     +P +
Sbjct: 210 DGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMI 269

Query: 294 SEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTA---- 349
             ++  +  +SL P++TNR+LLTV N++YLLDL+H S+LSER ++H KTFQ+L++A    
Sbjct: 270 --LDPNSQKVSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNV 327

Query: 350 -MNRDGSE-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQ 407
             +  GSE +  TLA+G++TKNG NPTSALE+IN+DVG+ +LKDSLGKSF   N+     
Sbjct: 328 SSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHN 387

Query: 408 LKNLFPEPKY---------ELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTE 457
           L+ LF + +          E+ +  + +I  +L KN  S  KFD TF   LNI+EE +T+
Sbjct: 388 LQPLFSDDESDAGDNADSDEVVAFAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTD 447

Query: 458 NSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLF 517
             RF+ DQ FL+ V+ LI    D  +  PR+L FLLTHPLFP +   GLL + +++ RLF
Sbjct: 448 RERFICDQEFLSKVVRLILDSFD--QEYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLF 505

Query: 518 KQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFM 577
           KQAIVTC            F+I N EL +DIS+RILQD+T D IK+E+KKL++V V NF+
Sbjct: 506 KQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFV 565

Query: 578 NFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAER 637
           NF+I   + E   +  T    ++F+LLSL++D+IGLF               ++V +AER
Sbjct: 566 NFLISPKDEELIQNKSTY---ELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAER 622

Query: 638 NVELWNIMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEYIDI 678
           N  LWN++D +                +    P Y VEY+++
Sbjct: 623 NARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  480 bits (1236), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/677 (41%), Positives = 417/677 (61%), Gaps = 41/677 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVA-DSFTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRLAVLPKIASL N+S +  Y++VA D+FT D              +Y+I PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSE-----TSTVSSXXXXXXXXXXXXXXXXXXXVEET- 113
           P+L+FN+ IPST+ V+A N+  Y E      STV++                    E T 
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 114 ---KHYEIWCYALSANNKTHTLNCLIRE--VDNNNTSITENNPQFNAKFKEQIINIEVDT 168
              +  E+W Y L AN K++TLN  ++   +D  +T+  E   +   K   +++NI++  
Sbjct: 121 VTKRSVELWAYGLVAN-KSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFK 179

Query: 169 KHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQK-- 226
           + K IV++ + GLV+ +D  L L +S++  Y D++ V+ F E+   ++L++S++ ++K  
Sbjct: 180 EFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSS 239

Query: 227 VALQLYEV--STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQL 284
           V  +LY++   ++  +V EL+ SI+++F+L  S L YQFG++YRL   E+ VYS+P  QL
Sbjct: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQL 299

Query: 285 NSKVKIPFLSEIEDKNCLIS-LKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTF 343
              +    L+EI      +S +KP+A NR++L + N +YL+D LH+SIL+ERE +H+KTF
Sbjct: 300 LQNIS---LAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTF 356

Query: 344 QILKTAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRR-NN 402
           Q+L++A   D + ++ T+A+G+STK+G    SALE+INI+VGS +LKDSLGK   ++ + 
Sbjct: 357 QLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSE 416

Query: 403 QIQGQLKNLFPE---------PKYELP---SINFPEILGKLKNANSAEKFDETFFNLLNI 450
                LK LF E         P +++    S NF +IL  LK++++   FD+TFF  L I
Sbjct: 417 GSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEI 476

Query: 451 KEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKV 510
           KE  +TEN RF++DQ F+A+ +DLIF K D     P++  FLLTHPLFP +  +GLL K+
Sbjct: 477 KENHYTENDRFISDQDFIANTIDLIFKKFD--TEFPKAFTFLLTHPLFPIKLTVGLLDKL 534

Query: 511 KSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQ 570
           K + RLFKQAIVTC            FT+KN EL +DIS+R+LQDY+++ +K+EIKKLD 
Sbjct: 535 KDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDN 594

Query: 571 VSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXK 630
           V +ENF+ FII     E   +     TPQ+F+LLSL+LDSIGLF               +
Sbjct: 595 VDIENFIEFIITPTTEEIQTN-----TPQLFQLLSLVLDSIGLFALKGPLLERLSNYINE 649

Query: 631 EVKIAERNVELWNIMDA 647
           +V IAER+ ELW+++D 
Sbjct: 650 QVTIAERSSELWHLLDT 666

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  476 bits (1226), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/658 (41%), Positives = 404/658 (61%), Gaps = 48/658 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           M S+SQPFRL  LPKIASL+NFS +  Y++VA++ TP               +Y+I PTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L+ N+ IPST +V+AC++    +                           +T+  E+WC
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEG------------------------DTETQEVWC 96

Query: 121 YALSANNKTHTLNCLIREVDNNNTSI--TENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178
           YAL AN K+ TLN +I+ +  +  S+  T+    +    K ++ ++++    K I+ + +
Sbjct: 97  YALVAN-KSFTLNTIIKPLTADAPSVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQ 155

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLE-YMLLISDLKDQKVALQLYEVSTE 237
            GLVQ +D QLKLL+S +  Y +I +VK F    L+ +M++++DL D KV  +L+E+   
Sbjct: 156 NGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHH 215

Query: 238 EKKV--KELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSE 295
           +  V  KEL S I+E F+LQ+S   YQFG+IY L   +I +YS+P  QL++ + +PF++ 
Sbjct: 216 DSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTH 275

Query: 296 IEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM-NRDG 354
                 ++S KPI+TNR LLTV N+IYLLDLLH +ILS+RE++H+KTFQ+L TA+   + 
Sbjct: 276 ----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNT 331

Query: 355 SESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414
           +E+  T+A+G+STK+  N TSAL+I+NI+VGS +LKDS+ K FL ++   +  L +LF E
Sbjct: 332 AENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQD-ATEEVLNSLFDE 390

Query: 415 PKYEL-----PSINFPEILGKLKNANS-AEKFDETFFNLLNIKEEMFTENSRFLNDQRFL 468
              EL        ++ +IL +L+ A S  EKFD  FF  LNIK+E +TE  RF N Q FL
Sbjct: 391 QDDELDEDGTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFL 450

Query: 469 ASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXX 528
             VL LIF   ++NK  PR+L +LLTHPLFP + A  LL+K K + RLF+QAIVTC    
Sbjct: 451 DKVLSLIFE--NFNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLP 508

Query: 529 XXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREA 588
                   FT+ N EL +D+S+RILQD+TKD+IK+ IKK+ +V + NF+ F+I  ++ E 
Sbjct: 509 LDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEE 568

Query: 589 AVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMD 646
                    PQ+F+LL+L+LDSIGLF                +V I E+N+EL N++D
Sbjct: 569 RNKS----KPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD 622

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  471 bits (1213), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/696 (38%), Positives = 403/696 (57%), Gaps = 65/696 (9%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPSLSQ F+LAVLP++ASL NF+ +  +++VAD   P               +YV+ PTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L+ ++PIPST++V+AC++    E                                EIWC
Sbjct: 61  KLVLSIPIPSTNIVTACDVARSDEQ-------------------------------EIWC 89

Query: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180
           YAL A  K  TLN +  +V +    +  ++     K  +Q + + V+ K K IV++ + G
Sbjct: 90  YALQAG-KVCTLN-VASKVSHAENGVNSDDV-LKVKVDDQAVGVHVNGKDKTIVVVLKNG 146

Query: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVST---E 237
           L+QFYD QLKLL+S++  Y D+ + K F E   +++ ++  L + KV  +L+E+S     
Sbjct: 147 LIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKVCFKLFELSLPNYN 206

Query: 238 EKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIE 297
           +  +KEL+S I+E+F+L  S +CYQ GR+YRL   E+ VY++P  QL   V +P +   +
Sbjct: 207 QVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGAD 266

Query: 298 DKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSES 357
               +IS+KPI++NR+L+T  NKIYLL+L H SIL +RE++H+K+FQ+LK+A+      S
Sbjct: 267 ----VISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSS 322

Query: 358 KL----TLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFP 413
            L    T  +G+ TK+G+NPTS+LEI+N+DVG+ +LKDSLGK F   N  I   LK LF 
Sbjct: 323 SLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFS 382

Query: 414 EP---------KYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLN 463
           +          K+E    +F +I   L KN  S   FD  F   LNIK E +TE  RF+ 
Sbjct: 383 DEDNEAEDEDNKFE--HFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFIC 440

Query: 464 DQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVT 523
           D++FL++V+ LI    ++ +  P++L FLLTHPLFP +    LL++++ + RLFKQAIVT
Sbjct: 441 DRQFLSNVVHLILQ--NFQEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVT 498

Query: 524 CXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKM 583
           C            F+I+N EL +DIS+RILQDYT D IK+E++KL+++ V+NF+ F+I  
Sbjct: 499 CPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISS 558

Query: 584 NNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWN 643
           N+  A  S     + Q+F+LLSL+LDSIGLF               + V IAERN +L +
Sbjct: 559 NDENAIRS-----SHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCH 613

Query: 644 IMDAKMLXXXXXXXXXXXXXXENSQTP-YIVEYIDI 678
           ++D K                     P Y VEY+D+
Sbjct: 614 LLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  467 bits (1201), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 279/687 (40%), Positives = 407/687 (59%), Gaps = 79/687 (11%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDXXXXXXXXXXXXXXKYVITPT 59
           MPSLSQPFRL VLPKIASL N+S +  YI+V  S F P               +Y+I PT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIW 119
           P+LIFN PIPST++V+AC++                                +  + E+W
Sbjct: 61  PKLIFNYPIPSTNIVTACDV---------------------------LENDNDNTNNEVW 93

Query: 120 CYALSANNKTHTLNCLIREVDNNNTSI-----------TENNPQFNAKFKEQIINIEVDT 168
           C+ L AN KT+TL  + ++   ++ ++           T    +FN K   +I++I++  
Sbjct: 94  CFGLVAN-KTYTLTLITKDKQKSSATMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIK 152

Query: 169 KHKV---IVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQ 225
           K      I+I+ E GL+QF++  LKLLN++   Y+++K V+ F+E+  ++M  I DL D 
Sbjct: 153 KKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDN 212

Query: 226 -KVALQLYEVSTEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQL 284
            KV ++L++++ +     EL S I+ENFN Q++  CYQFG+ Y+L  + + VYS+P  QL
Sbjct: 213 NKVCIKLFQINNDS--AIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQL 270

Query: 285 NSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQ 344
                IP    I+  + ++S+KPI+TNR+LLT+ NKIYLLDL+H SILSERE++H+K+ Q
Sbjct: 271 EHTTTIPM---IKTDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQ 327

Query: 345 ILKTAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF--LRRNN 402
           +L++A+   G  +  T+ +G+STK G NPTS+LEIIN+DVGSN+LKDSLGK F  L   N
Sbjct: 328 LLRSAVIGKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQN 387

Query: 403 QIQGQLKNLFP--EPKYELP-------------SINFPEILGKL-KNANSAEKFDETFFN 446
           QIQ   + L P  +P  +                 N+ EIL KL +N N   KFDE FF 
Sbjct: 388 QIQISTQALKPLFDPNTDGDKDDDLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQ 447

Query: 447 LLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSC------PRSLMFLLTHPLFPK 500
             NIK+E +TEN RF+ +  F   ++DLIF K     +       P++L FLLTHPLFP 
Sbjct: 448 SFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPM 507

Query: 501 EKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDA 560
           E+   LL++  ++ RLFKQAIVTC             TIKN+EL +DIS+RILQDY+KD+
Sbjct: 508 ERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDS 567

Query: 561 IKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXX 620
           IK+E++ L ++ +ENF++FI+    ++   S      PQ+F+LL+L+LDSIGLF      
Sbjct: 568 IKQELRNLPRLEIENFIDFILNDEIKDDQNS------PQLFQLLALVLDSIGLFALSDNI 621

Query: 621 XXXXXXXXXKEVKIAERNVELWNIMDA 647
                    ++V I E+N ELW ++D+
Sbjct: 622 LENLSAYIDRQVSIVEKNTELWYLIDS 648

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  463 bits (1192), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 246/657 (37%), Positives = 404/657 (61%), Gaps = 56/657 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           M S+SQPFRL+ LPKI SL+N++ +  Y++V D+ +P               +Y+I PTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L+FN+PIPST++V+AC++                              VE+  + E+WC
Sbjct: 61  KLVFNLPIPSTNIVTACDV------------------------------VEDAANTEVWC 90

Query: 121 YALSANNKTH----TLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVIL 176
           Y L A   +H    T   +   V ++N  IT    QF  K K ++++I++ +K + ++++
Sbjct: 91  YGLEARKVSHLHLATKPMIQDAVSSSNAEITS---QFKYKLKSEVVSIKIYSKAEKVLVI 147

Query: 177 FETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEEN-GLEYMLLISDLKDQKVALQLYEVS 235
              GL+Q +D +LKL N+I+  Y DI+ V+ F++  G ++  ++  L D+K+  +L++V 
Sbjct: 148 LRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDEKICYKLFQVR 207

Query: 236 TEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLF-KDEIEVYSIPSLQLNSKVKIPFLS 294
           +E     EL S I+EN+ L+++ LC++FG++Y L   +E+ +Y +P LQL + +++PF+S
Sbjct: 208 SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFIS 267

Query: 295 EIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDG 354
               K+ ++S+KP+++NRVLLT  N IYL+DLL+ +IL ++++ ++K  Q+L TA+ ++ 
Sbjct: 268 ----KDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQEN 323

Query: 355 SE-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFP 413
           SE ++ T+AL ++TKNG NPTS L++INIDVG+ +LKD++GK F+ +  Q   +L+ LF 
Sbjct: 324 SEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVKQKQ---KLQKLFE 380

Query: 414 EP----KYELPSINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLA 469
           E       ELPS ++  I+ +L      E FD  FF +L++ +E +T+N RFLND   L 
Sbjct: 381 ESNEDDDVELPSPDYERIIKQLHICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLT 440

Query: 470 SVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXX 529
            ++D +F  +++    P++L +LLTHPLFP   A GLLTK+K+N RLFKQAIVTC     
Sbjct: 441 QIIDCLF--LNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPL 498

Query: 530 XXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAA 589
                  F I N+EL  DI++R+LQDY K++IK  I+K++++ + NF++ I+   N   A
Sbjct: 499 DDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMIL---NSNKA 555

Query: 590 VSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMD 646
            SD  +  PQIF+L+SLI+DSIGLF                +V +  +N+EL ++ +
Sbjct: 556 DSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAE 612

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  459 bits (1182), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/655 (38%), Positives = 391/655 (59%), Gaps = 43/655 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPS+SQPFRL  LPKIASL+N++ +  Y++VAD+ TP               +Y+I PTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L++N PI ST++VSAC +   + TS                         E    E+ C
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTS-------------------------EKDSQEVIC 95

Query: 121 YALSANNKTHTLNCLIREVDN--NNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178
           Y + +N + ++L   I+ V +  +++S  E          +QI+N++V    K IV +  
Sbjct: 96  YGIQSN-RVYSLCATIKPVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLR 154

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTF-EENGLEYMLLISDLKDQKVALQLYEVSTE 237
           +GL+QF+D +LKL +S+++ Y+++  V+ F  E+G  Y  L+SD+   KV+ +L+E+   
Sbjct: 155 SGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQS 214

Query: 238 EKK--VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSE 295
           +      EL+S I+EN  L+DS + YQFG++YRL  + + +Y++P  Q +  +++PFL+ 
Sbjct: 215 DSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLA- 273

Query: 296 IEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGS 355
                 +IS KPI+TNR LLT  NKI+LLDLLH +ILS+RE+ H+K FQ+L+TA+    S
Sbjct: 274 ---PESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNS 330

Query: 356 E-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414
             +  T+ALG+S K+G NP+S+L+IINIDVG+ +L+DS+GK F+ R N+ Q     +   
Sbjct: 331 TLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQHLQPLISTL 390

Query: 415 PKYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLD 473
              E    N+  IL +L K A++ E FD  FF  L IK   +T++ RF+ND+ FL  V  
Sbjct: 391 NDTEAAEFNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVST 450

Query: 474 LIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXX 533
           LIF    +    P++L +LLT+PLFP      LL K+K + RLFKQAIVTC         
Sbjct: 451 LIFKS--FKSEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELV 508

Query: 534 XXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDF 593
              FT+ N EL +D+S+RILQD+ KD+IKE IK+  ++ V NF+NF+I  N  E  + + 
Sbjct: 509 QELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKN- 567

Query: 594 TMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMDAK 648
               P++F+LLSL+LDS+GLF               +++ + + NVEL+N+++ K
Sbjct: 568 ---KPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEK 619

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  459 bits (1182), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 246/654 (37%), Positives = 395/654 (60%), Gaps = 47/654 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           M  ++QPFRLA LPKI+SL+N++Q+ +Y++VAD   P               +YVI PTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L++N+PIPST++V+ C++   S+ +                              E+W 
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGA------------------------------ELWS 90

Query: 121 YALSANNKTHTLNCLIREVDN--NNTSI-TENNPQFNAKFKEQIINIEVDTKHKVIVILF 177
           YAL+AN K HTL+ ++R+       T +    +  F    K +++ + + +  K I+++ 
Sbjct: 91  YALTANGKVHTLHAVLRKAGAAPQETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVL 150

Query: 178 ETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEEN-GLEYMLLISDLKDQKVALQLYEV-- 234
           + GL+Q YD QL+LL+S++  Y ++ +V+ F ++ G +YM ++ D++++K   +L+++  
Sbjct: 151 DCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNH 210

Query: 235 STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLS 294
           S E   + EL S I+E+F L +S + YQFG++YRL   ++ VYS+P  QL+  V +PF+ 
Sbjct: 211 SAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVR 270

Query: 295 EIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM--NR 352
               K+  +SL+ I+TNR+LLT  NKI+LLDLLH +IL ERE+S++K FQ+L+ A+    
Sbjct: 271 ----KDDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGT 326

Query: 353 DGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLF 412
              ES  T A+G+STK G NP+SAL+++ I VG+ +LKDSLGK FL   ++    LK LF
Sbjct: 327 TPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLF 386

Query: 413 PEPKYELPSINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVL 472
                E P+I+F  IL +L +  + + FD  F+  L  K+E +TE+ RF+N+  FLA +L
Sbjct: 387 GTDDDESPNIDFAAILAELTSRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGIL 446

Query: 473 DLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXX 532
           D IF    +    P++L++LLTHPLFP     GLL K+K++ RLFKQA+VTC        
Sbjct: 447 DHIFAT--FADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDEL 504

Query: 533 XXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSD 592
               FT+ N EL +D+S+R+LQ++TK+ IK+ I++L +V + NF+NF+IK       V +
Sbjct: 505 LHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIK---DSTDVEE 561

Query: 593 FTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMD 646
                PQ+F+LLSL++D++GL                 +V +A++ VEL  +++
Sbjct: 562 RQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLE 615

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  451 bits (1160), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 266/688 (38%), Positives = 409/688 (59%), Gaps = 46/688 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPSLSQPFRLA+LPKIA L +++ +   ++VAD FT D              +YVI PTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
            +   VPIPST+ V+ACN+  Y +  T                       EE   +EIW 
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADT-----------------------EEL--FEIWV 95

Query: 121 YALSANNKTHTLNCLIREVDNNNTSITENNP--QFNAKFKEQIINIEVDTKHKVIVILFE 178
           Y L+ N K +TL+  I+ VD +  S T+++    +  K    ++ I+++ + K IV+   
Sbjct: 96  YNLAVNKK-NTLHVAIKTVDPDKFSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLG 154

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEE 238
            G +Q +D +LKLLNS+NT Y +I   + F EN   + +++S ++  K++ +LYE+  ++
Sbjct: 155 NGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQD 214

Query: 239 K-KVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIE 297
           K  +KEL+S+I+E+   +DS + YQFG++YRL+K+++ VYS+P  QL   + +P   +I+
Sbjct: 215 KTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLP---QID 271

Query: 298 -DKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM--NRDG 354
             K+  IS KP++ NR+LLTV NKI++LDL+H++ L+ER + H+K FQ+LK+ +    D 
Sbjct: 272 LKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDA 331

Query: 355 SESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414
           S +  T+A+G+S KNG +P +ALEIIN +VG+ +LKDSLG SF    +     L+ LF +
Sbjct: 332 SNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTD 391

Query: 415 PKYELPSINFP--EILGKLKNA-NSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASV 471
               +   +F    IL KL +  N  +KFD+ FF  L I++  +T+N RF+ D  FL+ V
Sbjct: 392 DANLVKRHDFKYEAILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDV 451

Query: 472 LDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXX 531
           +DLIF   ++ K  P +L FLLTHPLFP  +   LL K++ + RLFKQA+VTC       
Sbjct: 452 IDLIFK--NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDE 509

Query: 532 XXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVS 591
                F+I N EL VDIS+RILQDYTKD+IK E+K L+++ ++NF++F+I  NN E    
Sbjct: 510 LLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKH 569

Query: 592 DFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMDAKMLX 651
           +      Q+F LLSL+LD+ GLF               K+V++ E++ +LW+++D  +  
Sbjct: 570 N-----EQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGK 624

Query: 652 XXXXXXXXXXXXXE-NSQTPYIVEYIDI 678
                        E  + T Y VEY+++
Sbjct: 625 RNNHYQTSGATVPEIKALTAYSVEYLEL 652

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  276 bits (705), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 149/348 (42%), Positives = 222/348 (63%), Gaps = 8/348 (2%)

Query: 303 ISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTA-MNRDGSESKLTL 361
           +S  PI+ NR LLT  NK+YLLDLLH +ILS+RE +H+KTFQ+L TA +  + S +  T+
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 362 ALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPEPKYELPS 421
           A+G++TK G   TS+L+++NIDVG+ +LKDS+GK FL    ++Q     L      E+  
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTEVQE 120

Query: 422 INFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKID 480
            N+ +IL  L K  ++++KFD  FF  LNIK + +T++ RFLNDQ FL + L LIF   +
Sbjct: 121 HNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFE--N 178

Query: 481 YNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXXXXXXXXXXFTIK 540
           +    P++L +LLTHPLFP      LL K+K + RLFKQAIVTC            FT+ 
Sbjct: 179 FQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVI 238

Query: 541 NSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQI 600
           N EL +D+S+RILQD++KD+IK  IK+  +V V  F+NF++  N  E  V +     P++
Sbjct: 239 NDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKN----KPRL 294

Query: 601 FKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMDAK 648
           F+LL+L+LDS+GLF               +++ + ++NV+L+N++D +
Sbjct: 295 FQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDER 342

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  259 bits (662), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 210/660 (31%), Positives = 322/660 (48%), Gaps = 106/660 (16%)

Query: 3   SLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTPRL 62
           S+SQPF +A +P+ AS     Q K  I    S T +              +Y+I PTP+L
Sbjct: 4   SISQPFTIANVPRQAS-----QTKVLIS-QHSLTSNANTLDVAVSKYSISQYIINPTPKL 57

Query: 63  IFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWCYA 122
           + +  IPS   V+A + G Y+  S   S                            +C  
Sbjct: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKS----------------------------FCLY 89

Query: 123 LSANN----KTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178
           L  ++    K+  +NCL  ++ + +                            V   + +
Sbjct: 90  LDESHQIPLKSAVVNCLSEKIHDESV---------------------------VTTAILQ 122

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEE 238
            G VQ Y    ++  + + P +DIK V+  +    +Y L+++    Q  AL  YE+    
Sbjct: 123 DGTVQKYKGGEQVF-AKHLPLKDIKQVEFIDG---QYALIVAA---QSTAL--YEL---- 169

Query: 239 KKVKELTSSIIENFNLQDSLLCYQFGRIYR--LFKDEIEVYSIPSLQLNSKVKIPFLSEI 296
           + + EL  S   +F  Q   +    G+IY+  L  ++ +++ + +L     V IPFLS  
Sbjct: 170 ENLTELRVSTTLHFE-QFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA- 227

Query: 297 EDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSE 356
             K   ++   +  +RV L + N+IYLLDL   S+LS  + + +K  +++  A  RDGS 
Sbjct: 228 -SKGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--RDGS- 283

Query: 357 SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFL-----RRNNQIQGQLKNL 411
                A+ +S     N  S L+IIN+++GS S+KDSLGK F      RR+ + Q  L+ +
Sbjct: 284 ----FAIALSHGPQDNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPI 338

Query: 412 FPEPKYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLAS 470
                    S ++  IL KL   A    KFD+ FF  L I +E +TE  RF+ DQ FL+ 
Sbjct: 339 LDAGDKTKRSFDYASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSE 398

Query: 471 VLDLIFTKIDYNKSC--PRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCXXXX 528
            + +I     +  S   P +  +LLTHPLFP +K   LL+KVK   RL+KQ IVTC    
Sbjct: 399 TVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLP 458

Query: 529 XXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIK--MNNR 586
                   F I+N+EL +D+S++ILQDYTKD+IK+E+K L +V+V NF+ F+I    N+ 
Sbjct: 459 LDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSD 518

Query: 587 EAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIAERNVELWNIMD 646
           E++V+     TPQ+F+LLSL++DSIGLF                 VKIAE N ELWN+++
Sbjct: 519 ESSVA-----TPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLE 573

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  234 bits (598), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 200/671 (29%), Positives = 328/671 (48%), Gaps = 125/671 (18%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPS+SQPF +  +PK +S          I  + S T +              K+VI PTP
Sbjct: 1   MPSISQPFAITTVPKQSS------TSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +LI ++PIPS  +V+A                                       +    
Sbjct: 55  KLINSIPIPSNEVVTA---------------------------------------FHDTV 75

Query: 121 YALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFETG 180
           +A +  N+ +TL+   ++V                  + +I+ +  D    + ++  E G
Sbjct: 76  FATATVNQKYTLHLNGKKV----------------PIQSKIMKLFSDESQTITIL--ENG 117

Query: 181 LVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVST--EE 238
            ++ YD  L + ++  TP++D+  V+  E    +Y LLIS     + ++ LY+++T  E 
Sbjct: 118 TIEKYDSNL-IKSTYKTPHKDLVNVEFIES---KYALLIS-----QNSISLYDINTMIEL 168

Query: 239 KKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSEIED 298
           + V  +   +  +F   D  L YQF +    F    +++ I S+ + + + IPF++++E 
Sbjct: 169 RNVANVQDIVDSDFKSLDGKL-YQFNQKLSKF----DIWEISSMTIVNIITIPFINDVEK 223

Query: 299 KNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSESK 358
              ++S   +  N V++ V + IY L+L   S++S  E+ ++K F+++    N+      
Sbjct: 224 D--VVSFTVVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNLSNQ------ 275

Query: 359 LTLALGISTKNGQNPTSALEIINIDVGSN-SLKDSLGKSFLRRNNQIQGQ-------LKN 410
               LG+S     N     E+IN+D+ SN  LKDSLGK F  RN  +  Q       LK+
Sbjct: 276 --FVLGLS---FNNENYKFELINLDLNSNFGLKDSLGKGF--RNFLVDKQSEKETLVLKS 328

Query: 411 LFP--EPKYELP---------SINFPEILGKLKNA-NSAEKFDETFFNLLNIKEEMFTEN 458
           LF   E   +L          + N+ +I+  L  A  +  KFD+ FF   NIK+E +TE 
Sbjct: 329 LFSADEADEDLHNDSDSDVEHTFNYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEA 388

Query: 459 SRFLNDQRFLASVLDLIFTKIDYNKSC---PRSLMFLLTHPLFPKEKAIGLLTKVKSNSR 515
            RFL +Q FLA V++LI     ++      P++L +LLTHPLFP      LL K + + R
Sbjct: 389 DRFLVNQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPR 448

Query: 516 LFKQAIVTCXXXXXXXXXXXXFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVEN 575
           L+KQAIVTC            FTI+N+EL +DIS+R+LQDYTKD+IKE+IK L +V + N
Sbjct: 449 LYKQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRN 508

Query: 576 FMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGXXXXXXXXXXXXXXKEVKIA 635
           F+ F+ +  +++ +         Q+F+LLSLI+DSIGLF               ++  +A
Sbjct: 509 FIEFVTQDEDQQVS--------SQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVA 560

Query: 636 ERNVELWNIMD 646
           ++N EL +++D
Sbjct: 561 KQNSELLHLLD 571

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  141 bits (355), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 132/234 (56%), Gaps = 26/234 (11%)

Query: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDXXXXXXXXXXXXXXKYVITPTP 60
           MPS+SQPFRL  LPKIASL+N++ + +Y++VAD+ TP               +YVI PTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSXXXXXXXXXXXXXXXXXXXVEETKHYEIWC 120
           +L++N+PI ST++V+AC++   + T+   +                       + +E+ C
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGT----------------------AEAHEVLC 98

Query: 121 YALSANNKTHTLNCLIREVDN--NNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178
           YAL A NKT ++  + + + +   ++S  E           Q +N++V    K IV +  
Sbjct: 99  YALQA-NKTFSICAVKKPIPSAATDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLS 157

Query: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTF-EENGLEYMLLISDLKDQKVALQL 231
           +GL+QF+D  LKL +SI++ Y +++ V+ F  E+  ++M L+SDL  +KV+ +L
Sbjct: 158 SGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLDGRKVSFKL 211

>NDAI0C04150 Chr3 complement(949316..950659) [1344 bp, 447 aa] {ON}
           Anc_8.737 YMR220W
          Length = 447

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 115 HYEIWCYALSANNKTHTLNCLIREVDNNNTSITENNPQF-NAKFKEQII--NIEVDTKHK 171
            Y+ +  ALSA  + H +    R +D N TSIT  +PQF N K+   ++   + VD  +K
Sbjct: 26  RYKSYVVALSA--RMHAMVSTARPMDQNKTSITVCSPQFNNEKWTYNLLQGQLSVDGTNK 83

Query: 172 VIVILFETGL---VQFYDLQLKLLNSIN 196
              +  E G+   + ++D+Q  +   IN
Sbjct: 84  SKNLFIECGIRNALDYFDIQNSMGFDIN 111

>YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON}
           IRE1Serine-threonine kinase and endoribonuclease;
           transmembrane protein that mediates the unfolded protein
           response (UPR) by regulating Hac1p synthesis through
           HAC1 mRNA splicing; Kar2p binds inactive Ire1p and
           releases from it upon ER stress
          Length = 1115

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 440 FDETFFNLLNIKEEMFT-ENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLF 498
           F + +    NI   +F+ +  + L+D+  +A   DLI   ID++     + M +L HPLF
Sbjct: 921 FGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQMIDHDPLKRPTAMKVLRHPLF 980

Query: 499 -PKEKAIGLLTKV 510
            PK K +  L KV
Sbjct: 981 WPKSKKLEFLLKV 993

>Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa]
           {ON} YHR079C (REAL)
          Length = 1115

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 440 FDETFFNLLNIKEEMFT-ENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLF 498
           F + +    NI   +F+ +  + L D+   A   DLI   ID++     + M +L HPLF
Sbjct: 921 FGDKYTRESNIIRGIFSLDEMKCLRDRSLAAEATDLISQMIDHDPLRRPTAMRVLRHPLF 980

Query: 499 -PKEKAIGLLTKV 510
            PK K +  L KV
Sbjct: 981 WPKSKKLEFLLKV 993

>Kwal_27.10604 s27 complement(416254..419106) [2853 bp, 950 aa] {ON}
           YBL101C (ECM21) - involved in cell wall biogenesis
           [contig 34] FULL
          Length = 950

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 223 KDQKVALQLYEVSTEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSL 282
           + Q+  L L+E+ T+EK  + +   I+EN   ++ LL Y   R  +   DE     + SL
Sbjct: 581 RKQERILPLWEIRTKEKGTRSMREDIVENCRSEN-LLSYSSFR--QEGSDEENSDVVDSL 637

Query: 283 QLNSKVKIPFLSEIEDKNCLISLKPIA 309
           Q+NS +  P  S + DK    S+ P  
Sbjct: 638 QINSTLSFPKYS-VLDKRSSKSVPPYG 663

>TBLA0C03090 Chr3 complement(743523..745226) [1704 bp, 567 aa] {ON}
           Anc_5.246 YJL008C
          Length = 567

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 13/73 (17%)

Query: 269 LFKDEIEVYSIPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYL----- 323
           LFK   + YS    Q+N    I  + EI  K CL S+ P  TN+V++    KI +     
Sbjct: 13  LFKQGYQSYSNADGQINKS--IAAIREIH-KMCLTSMGPCGTNKVIVNQLGKIIITNDAA 69

Query: 324 -----LDLLHKSI 331
                LD++H ++
Sbjct: 70  TMLRELDIIHPAV 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,029,683
Number of extensions: 2837194
Number of successful extensions: 11266
Number of sequences better than 10.0: 79
Number of HSP's gapped: 11534
Number of HSP's successfully gapped: 89
Length of query: 678
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 562
Effective length of database: 40,180,143
Effective search space: 22581240366
Effective search space used: 22581240366
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)