Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10538g3.490ON2002008541e-117
AFR308W3.490ON1921932243e-22
SAKL0F02816g3.490ON1921922234e-22
NCAS0E008203.490ON2021962226e-22
Kwal_55.212263.490ON1961942122e-20
Suva_7.4173.490ON2122082122e-20
ZYRO0D10032g3.490ON2092012087e-20
Smik_6.2253.490ON2132081992e-18
KLTH0F14784g3.490ON1951941921e-17
YGR129W (SYF2)3.490ON2152101895e-17
Skud_7.4403.490ON2132121861e-16
NDAI0G009503.490ON2132001773e-15
Kpol_480.153.490ON2071971721e-14
TDEL0D055803.490ON1931941711e-14
Ecym_12393.490ON1931941642e-13
TPHA0D042403.490ON2092111563e-12
KLLA0E04643g3.490ON2211871441e-10
TBLA0C044703.490ON2222031318e-09
KNAG0B008203.490ON2071951081e-05
NCAS0J017304.291ON142868730.66
AFR099C1.280ON81957711.2
NDAI0J026204.291ON145268682.8
TBLA0G020304.291ON144268673.8
TPHA0H003208.153ON450113654.9
Ecym_11728.534ON36653655.2
CAGL0G03751g4.37ON31639646.2
TPHA0C001404.388ON22660638.3
NOTE: 1 genes in the same pillar as CAGL0I10538g were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10538g
         (200 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...   333   e-117
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    91   3e-22
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    91   4e-22
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    90   6e-22
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    86   2e-20
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    86   2e-20
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    85   7e-20
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    81   2e-18
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    79   1e-17
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    77   5e-17
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    76   1e-16
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    73   3e-15
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    71   1e-14
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    70   1e-14
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    68   2e-13
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    65   3e-12
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    60   1e-10
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    55   8e-09
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    46   1e-05
NCAS0J01730 Chr10 (317401..321687) [4287 bp, 1428 aa] {ON} Anc_4...    33   0.66 
AFR099C Chr6 complement(612125..614584) [2460 bp, 819 aa] {ON} S...    32   1.2  
NDAI0J02620 Chr10 complement(650038..654396) [4359 bp, 1452 aa] ...    31   2.8  
TBLA0G02030 Chr7 complement(530489..534817) [4329 bp, 1442 aa] {...    30   3.8  
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...    30   4.9  
Ecym_1172 Chr1 complement(348319..349419) [1101 bp, 366 aa] {ON}...    30   5.2  
CAGL0G03751g Chr7 (360146..361096) [951 bp, 316 aa] {ON} weakly ...    29   6.2  
TPHA0C00140 Chr3 (14138..14818) [681 bp, 226 aa] {ON} Anc_4.388 ...    29   8.3  

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score =  333 bits (854), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/200 (91%), Positives = 183/200 (91%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMH             
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
               MRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS 180
           KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS 180

Query: 181 INAKNLQFNKSLDDDHEAEK 200
           INAKNLQFNKSLDDDHEAEK
Sbjct: 181 INAKNLQFNKSLDDDHEAEK 200

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 90.9 bits (224), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 96/193 (49%), Gaps = 9/193 (4%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M +ED N +L+ LKK   D  IRNR     E   +    KPRVYSM              
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                   L  Y + D+  W+++Q+R K    +   G  L  LA +TY  EL  L R   
Sbjct: 61  SEQ---LKLLNYRIADYEKWDEKQKRHK----QPSDGADLGELANSTYRSELHQLHRRGV 113

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS 180
            +K + T  RI+  SGKV + D  ELV++L+  +++TAK+R++  +K A      + +GS
Sbjct: 114 -VKGRATNGRISA-SGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS 171

Query: 181 INAKNLQFNKSLD 193
           +N KN  FN+ LD
Sbjct: 172 LNDKNRHFNEKLD 184

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 90.5 bits (223), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 106/192 (55%), Gaps = 10/192 (5%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+L D   KLK LK+   D+ ++NR   ++E ++ ++  KP+VYSM+             
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEED- 59

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                R  L  Y+++D+  W    Q K+ +KL++  G   Q LAK TYDKE++ + +   
Sbjct: 60  ----TRGKLLNYSIKDYEKW----QLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGS 111

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGS 180
             + K T+ R+N   G++ I D+K+ +++L+ NL ++ K+RY   +K A   + ++  G 
Sbjct: 112 LNRGKVTKARLN-GKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGF 170

Query: 181 INAKNLQFNKSL 192
           IN KN QFN+ L
Sbjct: 171 INDKNKQFNEKL 182

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 90.1 bits (222), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 108/196 (55%), Gaps = 8/196 (4%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           ++LE Y+ KLK LK+  QD  I NR L+ +E+++ E   KPRVY+M              
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLP--RP 118
               +   L  YT++ + +WEK+Q+ KK     S     ++ LA  +YDK + NL   R 
Sbjct: 62  ADDKV-AKLMNYTLRQYEEWEKKQKDKKIKDDSSD----MKQLAMFSYDKGVSNLNRFRT 116

Query: 119 EFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRY-DSNRKIANDKEHTSL 177
           +     +E Q ++N  +GKVNI+D K+LV  L++NL +TA +RY  + +K+    + +S 
Sbjct: 117 DKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSA 176

Query: 178 SGSINAKNLQFNKSLD 193
            G IN +N  FN+ LD
Sbjct: 177 EGYINERNKHFNEKLD 192

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 86.3 bits (212), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 103/194 (53%), Gaps = 9/194 (4%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+L  Y ++LK LK+   D+ ++N+N + +E +      KP VYSM+             
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                   L +Y++ ++  W   Q + KK+    + G   Q LAK+TYDKE+Q L + + 
Sbjct: 61  EANK----LLKYSMLEYEQW---QDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDG 113

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDS-NRKIANDKEHTSLSG 179
               K T++R+N + GK+ ++D+++LV  L + L +TA +RY    +KI     +T+  G
Sbjct: 114 NRVNKNTKYRVN-NKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172

Query: 180 SINAKNLQFNKSLD 193
            IN KN QFN  L+
Sbjct: 173 YINEKNKQFNDKLE 186

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 86.3 bits (212), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 106/208 (50%), Gaps = 20/208 (9%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+LE+   KLK LK+   D  ++ R L  +E +E     KPRVYSM              
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLP---- 116
                +   F YTVQ++  WE++Q+++K  K +  +G     LAK +YDK L+NL     
Sbjct: 61  DD---KDRAFHYTVQEYNAWEQKQKQRKSGKTQG-TGNSYDQLAKLSYDKTLRNLTTQNY 116

Query: 117 -RPEFKMKAKETQFRINKD----------SGKVNIKDNKELVQRLSQNLKETAKQRYDSN 165
            + E  +  K+++  + K           +GK+ I D+ ELV +L+  L+  +K+R+D+ 
Sbjct: 117 GKHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDAR 176

Query: 166 -RKIANDKEHTSLSGSINAKNLQFNKSL 192
            R++ N K  + +   IN KN QFN+ L
Sbjct: 177 KRQMENVKTPSGVESFINDKNKQFNEKL 204

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 84.7 bits (208), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 104/201 (51%), Gaps = 17/201 (8%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+L+ + +    LKK   +I + NR L+  E++E   G KPRVY +              
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH 70

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRP-- 118
                   L  YT+Q + +W  R QR + +K +S +   LQ +AK TYDKEL  L +   
Sbjct: 71  GNQ-----LMNYTIQQYEEWNSR-QRDQTNKRDSGN---LQDMAKYTYDKELNKLHKDTM 121

Query: 119 ---EFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRK---IANDK 172
               +       +   N  +GK+ IKD+ +LV++L++++ +TA +RY++ R+    +N +
Sbjct: 122 LQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQ 181

Query: 173 EHTSLSGSINAKNLQFNKSLD 193
             +S  G IN KN QFN+ LD
Sbjct: 182 NASSGGGYINEKNKQFNEKLD 202

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 81.3 bits (199), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 108/208 (51%), Gaps = 19/208 (9%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           MNL+   ++LK LKK   ++ I+NR L  +E +E     KPRVY+M              
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                R   F YT Q++I WE+R  ++K  +   +SG+    LAK +Y+K L+NL   + 
Sbjct: 61  SSDKDRA--FHYTAQEYIAWEQRHHQRKIGQ-SKRSGISYDQLAKLSYEKTLRNLATQDL 117

Query: 121 ------------KMKAKETQF-RINKD--SGKVNIKDNKELVQRLSQNLKETAKQRYDSN 165
                       K  +K ++  RI KD  +GK+ I D+ +LV +L+ +L+  +K+RY++ 
Sbjct: 118 SEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEAR 177

Query: 166 -RKIANDKEHTSLSGSINAKNLQFNKSL 192
            R++ +    + +   IN KN QFN+ L
Sbjct: 178 KRQMESAVIPSGVESFINDKNKQFNEKL 205

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 97/194 (50%), Gaps = 9/194 (4%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+L  Y ++LK LK+    + ++N+  + QE ++     KP VYSM              
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                   L QY+++DF  W+ +++RK +   +S    + Q LAK TYDKE+Q L +   
Sbjct: 61  KE----AKLLQYSMKDFEQWQDKERRKSQ---KSSDVAKYQDLAKFTYDKEVQQLRKNYT 113

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDS-NRKIANDKEHTSLSG 179
               K  +  INK  GK+ +KD+  LV  L+ +L +TA +RY    +KI       +  G
Sbjct: 114 NKVEKPKKVSINK-KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGG 172

Query: 180 SINAKNLQFNKSLD 193
            IN KN QFN  ++
Sbjct: 173 FINEKNKQFNDKIE 186

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 77.4 bits (189), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 103/210 (49%), Gaps = 21/210 (10%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+    +EKLK LK+   D+ I++R L  +E +E     KPRVYSM              
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                +   F YTVQ++  WE+R  + K  + + + G+    LAK +Y+K L+NL     
Sbjct: 61  SPEKEKA--FHYTVQEYDAWERRHPQGKTGQSQ-RGGISYDQLAKLSYEKTLRNLATQTQ 117

Query: 121 KMKAKETQF---------------RINKD--SGKVNIKDNKELVQRLSQNLKETAKQRYD 163
               +++                 ++ KD  +GK+ I D+ +LV +L+ +L+  +K+RY+
Sbjct: 118 NSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYE 177

Query: 164 SN-RKIANDKEHTSLSGSINAKNLQFNKSL 192
           +  R++ N K    +   IN KN QFN+ L
Sbjct: 178 ARKRQMQNAKTLYGVESFINDKNKQFNEKL 207

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 108/212 (50%), Gaps = 27/212 (12%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M L+  ++KLK+LK+   ++ I+NR L  +E +E     KP+VYSM              
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                +   F YTVQ++  W+++Q ++K  + + +SG     +AK +Y+K L+NL     
Sbjct: 61  TSDKDKA--FHYTVQEYNAWKQKQNQRKNGQGQ-RSGNSYDQVAKLSYEKTLRNL----V 113

Query: 121 KMKAKETQFRINKD-------------------SGKVNIKDNKELVQRLSQNLKETAKQR 161
              + + +  +NK+                   +GK+ I D+ +LV +L+  L+  +K+R
Sbjct: 114 TQNSNKNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKR 173

Query: 162 YDSNRK-IANDKEHTSLSGSINAKNLQFNKSL 192
           Y++ RK + N K  +S+   IN KN QFN+ L
Sbjct: 174 YEARRKQMENAKTPSSVESFINDKNKQFNEKL 205

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 72.8 bits (177), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 103/200 (51%), Gaps = 12/200 (6%)

Query: 3   LEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXX---- 58
           L+ Y E LK LK+SV DI   NR    QE +EK +  KP+VY +                
Sbjct: 6   LDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGL 65

Query: 59  ---XXXXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNL 115
                     +  L  YT++++ +W+K+Q+ K++ +++   G  L  LA  TY+KEL  L
Sbjct: 66  GDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVD---GSDLTELATFTYEKELSKL 122

Query: 116 -PRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEH 174
             + E     ++ Q  +N  +GK+N+KD + L+  L  NL ETAK+RY   +K    K  
Sbjct: 123 NSKLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKAS 182

Query: 175 TSLSGS-INAKNLQFNKSLD 193
           + ++G+    KN QFN+ L+
Sbjct: 183 SDIAGNYFKDKNKQFNEKLE 202

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 70.9 bits (172), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 106/197 (53%), Gaps = 7/197 (3%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M +++  E+ K LK+   DI I NR LL     E +K  KP+ YSM              
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGM-RLQHLAKNTYDKELQNLPRPE 119
                   L  Y+++++ +WEK+Q R K++   +KS +     +AK TYDK+++ L + +
Sbjct: 63  DEADR---LLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK 119

Query: 120 FK--MKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYD-SNRKIANDKEHTS 176
                + K ++ R +  +GK+ + D+K+L+++L+++L +T K+RYD +N+K   + +   
Sbjct: 120 STNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNE 179

Query: 177 LSGSINAKNLQFNKSLD 193
               IN KN +FN  L+
Sbjct: 180 NYSYINEKNKEFNDKLE 196

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 101/194 (52%), Gaps = 10/194 (5%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+LE    + K LKK   D+ I+ R + ++EA+++    KP++YSM              
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                R  L  Y+++++ +W+K+Q    K K   + G  +Q LAK +Y+K   +L R + 
Sbjct: 61  ERR--RLKLMNYSMREYEEWDKKQ----KGKEVKRGGANVQELAKYSYEK---DLSRSKQ 111

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRK-IANDKEHTSLSG 179
               +  +   +  + ++ +KD+++LV +L+ +LK+T ++R+ + +K +       +  G
Sbjct: 112 NNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGG 171

Query: 180 SINAKNLQFNKSLD 193
            IN KN QFN  LD
Sbjct: 172 YINEKNKQFNLKLD 185

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 67.8 bits (164), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 103/194 (53%), Gaps = 12/194 (6%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M+++D + +L+ LK    DI I+NR  +  E   +    KP VYS++             
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
                R  L  Y++   ID+EK  +++K++  +   G     +A +TY  E++ L +   
Sbjct: 61  NTE--RRKLLNYSL---IDYEKWDEKEKQANFD---GTYSGDIAYSTYKNEIKQLRKGGL 112

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRK-IANDKEHTS-LS 178
             K K T+ RI+ +SGKV I+D KELV +L+Q L++T+++R+   +K +   K +TS L 
Sbjct: 113 -TKGKITKGRIS-ESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELG 170

Query: 179 GSINAKNLQFNKSL 192
             +N KN  FN+ L
Sbjct: 171 NFVNEKNRHFNEKL 184

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 99/211 (46%), Gaps = 21/211 (9%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M++    ++ K+LKK   D  I +R  L+ + +E++  LKP+VYS++             
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKL-ESKSGMRLQHLAKNTYDKELQNLPRPE 119
                   L  YT++D+ +WE+  +RK K+    S S    Q  AK TYDKE+  + + +
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 120 FKMKAKETQFRINK-----DSGKVNIKDNKELVQRLSQNLKETAKQRY------------ 162
            K    E   R +      D GK+ IKD+K LV     ++ + +  RY            
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNND 180

Query: 163 DSNRKIANDKEHTSLSGSINAKNLQFNKSLD 193
            +  K+++DK  TS +   NAKN  FN  L+
Sbjct: 181 ATGSKVSHDKGKTSYN---NAKNKDFNDKLE 208

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 96/187 (51%), Gaps = 16/187 (8%)

Query: 9   KLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXXXXXXMRTN 68
           KLK L+K   ++ IRN+  +   AEEK K  + RVYSM                  ++  
Sbjct: 45  KLKSLRKQKVEVSIRNKKAII--AEEK-KNSERRVYSMADDGEDKARSNKSEPEDPIK-- 99

Query: 69  LFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRP-EFKMKAKET 127
           L  Y+++++  WE + Q  + +K  S  G   Q +AKN+Y KE+  LP+     +K   T
Sbjct: 100 LANYSIREYEKWEAKTQNSRHNK--SVMG-DFQTIAKNSYKKEVDALPKDISHPLKGGIT 156

Query: 128 QFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSL-SGSINAKNL 186
           +       GKV ++DN ELV+++  +L E +K+RY   ++  + +   +L  G IN KN 
Sbjct: 157 E------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNK 210

Query: 187 QFNKSLD 193
           +FN  L+
Sbjct: 211 RFNAKLN 217

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 27/203 (13%)

Query: 11  KLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXX------XXXXXXXXXXXXXXX 64
           K LK+  ++ +I N++ L    ++     KP+VYSM                        
Sbjct: 12  KTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEE 71

Query: 65  MRTNLFQYTVQDFIDWE-KRQQRKKKSKLESKSGM--RLQHLAKNTYDKELQNLPRPEFK 121
             + L  YT++++ DWE K+ +   +S+  SK      L  LAK TYDK+++ L +    
Sbjct: 72  RISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIRKLNKA--- 128

Query: 122 MKAKETQFRINK----------DSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIAND 171
           ++A  +  + NK          +S K+ IKD+K LV+ L  NLK  + + Y   + +   
Sbjct: 129 LRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLY---KHLGER 185

Query: 172 KEH--TSLSGSINAKNLQFNKSL 192
           +++  T+LSG +N KN +FN+ L
Sbjct: 186 RKNYSTTLSGHVNTKNQEFNEKL 208

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 86/195 (44%), Gaps = 32/195 (16%)

Query: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHXXXXXXXXXXXXX 60
           M L +  +K K L +  Q +++R R   KQ+AE +    KP+VYS+              
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIR---KQQAEVE----KPKVYSLQAAEPSVDGIDGAE 87

Query: 61  XXXXMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120
               +   L    ++     E R+ R+ ++  ++ + +    +AK+TY KEL  L R   
Sbjct: 88  VVDNVTVKLLNTPLRQL---EAREARRGENGDDAVARVEGDRVAKDTYKKELALLGR--- 141

Query: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNR---KIANDKEHTSL 177
             K+    +R N              V+RL  +L + +K+RY   +   K    +  +SL
Sbjct: 142 --KSTRGTYRDN--------------VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSL 185

Query: 178 SGSINAKNLQFNKSL 192
            G IN KN QFNK L
Sbjct: 186 DGYINEKNKQFNKKL 200

>NCAS0J01730 Chr10 (317401..321687) [4287 bp, 1428 aa] {ON} Anc_4.291
          Length = 1428

 Score = 32.7 bits (73), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 74   VQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINK 133
            ++ FI   + +QR+ ++    + G+  +  ++  Y++++ N+P PE K  A E+ +   K
Sbjct: 952  IESFISKAESKQRRGRAG-RVRKGLSFKLFSRKLYEEDMVNMPAPEIKRVALESLYLSVK 1010

Query: 134  DSGKVNIK 141
              G  N+K
Sbjct: 1011 AMGIKNVK 1018

>AFR099C Chr6 complement(612125..614584) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL087C
           (TRL1)
          Length = 819

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 95  KSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLS 151
           ++G+ L  L KNT  +E Q LP PE K  A++   +I     K +I+  +  +Q+ S
Sbjct: 203 RAGLYLHGLNKNT--REFQTLPMPEVKSFAEKYHLKIVDYFVKPDIETLRSFLQQCS 257

>NDAI0J02620 Chr10 complement(650038..654396) [4359 bp, 1452 aa] {ON}
            Anc_4.291 YLR419W
          Length = 1452

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 74   VQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINK 133
            ++ FI   + +QR+ ++    ++G+  +  +K  Y++ + ++P PE K  A E+ +   K
Sbjct: 975  IESFISKAESKQRRGRAG-RVRNGLSFKLYSKQLYEETMISMPAPEIKRVALESLYLSVK 1033

Query: 134  DSGKVNIK 141
              G  N+K
Sbjct: 1034 AMGIRNVK 1041

>TBLA0G02030 Chr7 complement(530489..534817) [4329 bp, 1442 aa] {ON}
            Anc_4.291 YLR419W
          Length = 1442

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 75   QDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINKD 134
            + FI   + +QR+ ++    + GM  +  ++  Y++++  +P PE K  + E+ +   K 
Sbjct: 962  ESFISQAESKQRRGRAG-RVREGMSFKLFSRRLYEEDMVAMPAPEIKRVSLESLYLSVKS 1020

Query: 135  SGKVNIKD 142
             G  N+K+
Sbjct: 1021 MGIKNVKE 1028

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 51/113 (45%), Gaps = 18/113 (15%)

Query: 72  YTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRI 131
           Y + + +D  + ++  K+  L+  S   ++ L+K + D  +  +PR  F           
Sbjct: 63  YGLHNIMDLYETREATKEELLQFHSEDYVEFLSKVSPDN-ISKMPRGTFD---------- 111

Query: 132 NKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSL--SGSIN 182
                K NI D+  + Q + +  K  A    D++RK+ ND+   ++  SG ++
Sbjct: 112 -----KYNIGDDCPIFQNIYEYCKLYAGASLDASRKLINDQSDIAINWSGGLH 159

>Ecym_1172 Chr1 complement(348319..349419) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AEL236C
          Length = 366

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 106 NTYDKELQNLPRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETA 158
           N +D  L   PRP++  K  E  FR    S K+ + +   ++Q L+Q+  E A
Sbjct: 77  NFHDAVLAKFPRPKYHCKRTEPTFRFAGLS-KIKVSELDRIIQDLTQSRNEQA 128

>CAGL0G03751g Chr7 (360146..361096) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|Q12373 Saccharomyces cerevisiae
           YLL022c HIF1 HAT1 Interacting Factor 1
          Length = 316

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 27/39 (69%)

Query: 132 NKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIAN 170
           +++SG+ ++    E+++RLSQNLK +A+   D   +IAN
Sbjct: 196 SRESGERDLTKQIEILERLSQNLKLSAEVSADKKLEIAN 234

>TPHA0C00140 Chr3 (14138..14818) [681 bp, 226 aa] {ON} Anc_4.388
           YER183C
          Length = 226

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 102 HLAKNTYD--KELQNLPRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAK 159
           H+ KN YD  KEL  LPR    ++   + FR N D    ++  +K     +++NLK   K
Sbjct: 59  HIIKNIYDQGKELY-LPRCTHTLETGHSPFRSNGDKHHPHLTFHKVESWEIAKNLKPQGK 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,716,518
Number of extensions: 859543
Number of successful extensions: 5600
Number of sequences better than 10.0: 243
Number of HSP's gapped: 5504
Number of HSP's successfully gapped: 257
Length of query: 200
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 96
Effective length of database: 41,556,135
Effective search space: 3989388960
Effective search space used: 3989388960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)