Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10516g3.492ON81381330340.0
Skud_7.4413.492ON8075127782e-90
Smik_6.2263.492ON8394727714e-89
Suva_7.4183.492ON8314947652e-88
YGR130C3.492ON8164677582e-87
NCAS0E008103.492ON6924256335e-71
SAKL0F02772g3.492ON7734755631e-60
ZYRO0D09988g3.492ON9944635488e-58
NDAI0G009403.492ON6564315191e-55
TDEL0D056003.492ON7002565001e-52
KLTH0F14828g3.492ON8363144323e-43
Kpol_480.143.492ON6992624123e-41
KLLA0D16236g3.492ON8715424102e-40
Kwal_55.212293.492ON7873224021e-39
TPHA0D042503.492ON6293023731e-36
KNAG0B008103.492ON7572843138e-29
Ecym_12373.492ON7272632646e-23
KAFR0C019603.492ON5632782351e-19
KNAG0A079403.492ON2751741587e-11
TBLA0C044803.492ON8021491621e-10
AFR310C3.492ON6232931549e-10
NCAS0F035503.492ON4411241324e-07
NDAI0B058603.492ON6811171074e-04
KAFR0G036903.492ON363186890.046
Smik_4.7578.499ON32338800.56
KLLA0E15511g5.88ON90597717.9
CAGL0K11726g3.251ON45884709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10516g
         (813 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...  1173   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   304   2e-90
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   301   4e-89
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   299   2e-88
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   296   2e-87
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   248   5e-71
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   221   1e-60
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   215   8e-58
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   204   1e-55
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   197   1e-52
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   171   3e-43
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   163   3e-41
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   162   2e-40
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   159   1e-39
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   148   1e-36
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   125   8e-29
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   106   6e-23
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    95   1e-19
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    65   7e-11
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    67   1e-10
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    64   9e-10
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    55   4e-07
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    46   4e-04
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    39   0.046
Smik_4.757 Chr4 (1338682..1339653) [972 bp, 323 aa] {ON} YDR480W...    35   0.56 
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    32   7.9  
CAGL0K11726g Chr11 (1128486..1129862) [1377 bp, 458 aa] {ON} hig...    32   9.2  

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 1173 bits (3034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/813 (76%), Positives = 624/813 (76%)

Query: 1   MSFKSDDPIGRLLQEGSQEKKKSILTRSVEDTGFVSPFRRGLTXXXXXXXXXXXXXXXXX 60
           MSFKSDDPIGRLLQEGSQEKKKSILTRSVEDTGFVSPFRRGLT                 
Sbjct: 1   MSFKSDDPIGRLLQEGSQEKKKSILTRSVEDTGFVSPFRRGLTSASAAASVSASASASRH 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEQKIAVNPFTNKPAYNKNAKQ 120
                                                 NEQKIAVNPFTNKPAYNKNAKQ
Sbjct: 61  RRFSNDSSDSDSDSRDAHNAASGGRSDSSRSDSSSDSDNEQKIAVNPFTNKPAYNKNAKQ 120

Query: 121 MKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTIXXXXXXXXX 180
           MKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTI         
Sbjct: 121 MKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELKEG 180

Query: 181 XXXXXXDSQKIIDLTIRQPDSXXXXXXXXXXXXXXXXXXNVDAENQQAHTKDNDTITDKE 240
                 DSQKIIDLTIRQPDS                  NVDAENQQAHTKDNDTITDKE
Sbjct: 181 KLQYLKDSQKIIDLTIRQPDSDEEQQDEQDEQDDTEVEDNVDAENQQAHTKDNDTITDKE 240

Query: 241 DMASQDAPEKEMSPREDSLPHPDAAETKIMQHKDIDAPKLQERKPTPXXXXXXXXXXXXX 300
           DMASQDAPEKEMSPREDSLPHPDAAETKIMQHKDIDAPKLQERKPTP             
Sbjct: 241 DMASQDAPEKEMSPREDSLPHPDAAETKIMQHKDIDAPKLQERKPTPDVDVAAEQAEEVA 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXXVMDSEAEPESQEKMAPSVKDTSSALASEDLES 360
                                       VMDSEAEPESQEKMAPSVKDTSSALASEDLES
Sbjct: 301 ETDGDVDAKEVDAEAGAEADAEAKAADAVMDSEAEPESQEKMAPSVKDTSSALASEDLES 360

Query: 361 YMTVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIA 420
           YMTVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIA
Sbjct: 361 YMTVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIA 420

Query: 421 TPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEE 480
           TPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEE
Sbjct: 421 TPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEE 480

Query: 481 LQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXX 540
           LQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKET        
Sbjct: 481 LQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKI 540

Query: 541 XXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQD 600
                 LDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQD
Sbjct: 541 QQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQD 600

Query: 601 ETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNEL 660
           ETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNEL
Sbjct: 601 ETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNEL 660

Query: 661 AIIKQENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
           AIIKQENANEQTELSKIT                                          
Sbjct: 661 AIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQ 720

Query: 721 XXXXHEEQVRKMKEQYENELNNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQAEAQ 780
               HEEQVRKMKEQYENELNNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQAEAQ
Sbjct: 721 QKREHEEQVRKMKEQYENELNNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQAEAQ 780

Query: 781 HAAQTKSIATNAANDMQDNSLYEFKTEEEIMYV 813
           HAAQTKSIATNAANDMQDNSLYEFKTEEEIMYV
Sbjct: 781 HAAQTKSIATNAANDMQDNSLYEFKTEEEIMYV 813

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  304 bits (778), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 196/512 (38%), Positives = 281/512 (54%), Gaps = 39/512 (7%)

Query: 329 VMDSEAEPESQEKMAPSVKDTSSALASEDLESYMTVETPQPYD--KVPRIPYTEQP--ES 384
           V D E E   Q  +    ++TS+   SE      +VE   P D  K P++P+ E+P  E 
Sbjct: 308 VHDEEDEKSEQSSVEEHGEETSTPETSE----AESVEDKAPIDPSKAPKVPFKERPKKER 363

Query: 385 GKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDK 444
              F+ +     ++        P          P+ATPENPELI KT+E+GY+SK +YDK
Sbjct: 364 TGIFALWKSPTSSSAQKGGVTAP--------SNPVATPENPELIVKTKEHGYLSKAVYDK 415

Query: 445 VVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIE 504
           + YDE  H+ WL   K  EKAKYD     Y+  L++LQ +ID I  SM+ ++KET++KIE
Sbjct: 416 INYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIE 475

Query: 505 VSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRK 564
           VS+N LVK+I + NT HN +K  IFK+T              L K   V+ EI +LN  K
Sbjct: 476 VSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELNSAK 535

Query: 565 KEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAK 624
             V++EF+ WTTN++ L QQLDA+I K+ QI +KQ + Q EI+ L+ +K++  AQ +  K
Sbjct: 536 TNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENK 595

Query: 625 KEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKITXXXXXX 684
           K HE   + +ES ENKEYLP+I+ IDNQ+S LLN++ II+QENANE+TELS IT      
Sbjct: 596 KLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDE 655

Query: 685 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEEQVRKMKEQY-------- 736
                                                   HE+Q+ ++K+ Y        
Sbjct: 656 RRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQ 715

Query: 737 ------ENELNNVKKQKESLETEKLVEEHNR----NENIKKEVLDKQRKQAEAQHAAQTK 786
                 E EL  VK+++  L+ EK +EE  R    +E +K+E+L KQ KQAE  HAA+  
Sbjct: 716 DKLAAEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKH 775

Query: 787 SIATNAA--NDM---QDNSLYEFKTEEEIMYV 813
           +I  + +  N++   +D+SLYE+ TEE++MY 
Sbjct: 776 NIPNSHSPKNEILVPKDDSLYEYHTEEDVMYA 807

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 56/99 (56%), Gaps = 8/99 (8%)

Query: 105 VNPFT--------NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIK 156
           V+PF         N   Y  +AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+
Sbjct: 54  VSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIR 113

Query: 157 FPVYLTENEFRQQTIXXXXXXXXXXXXXXXDSQKIIDLT 195
           FP YLT+NE RQ  +               + QKI DLT
Sbjct: 114 FPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLT 152

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  301 bits (771), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 262/472 (55%), Gaps = 35/472 (7%)

Query: 369 PYD--KVPRIPYTEQPESGKK--FSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPEN 424
           P D  K P++P+ E+P  GK   F+ +     ++     T  P          P+ATPE 
Sbjct: 376 PIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAP--------SNPVATPEK 427

Query: 425 PELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKE 484
           PELI KT+E+GY+SK +YDK+ YDE  H+ WL   +  EKAKYD K +EY  +L++LQ +
Sbjct: 428 PELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQ 487

Query: 485 IDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXX 544
           ID + +SM+ ++KET++KIEVS+N LVK+I + N  HN +K  IFK+T            
Sbjct: 488 IDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKN 547

Query: 545 XXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQK 604
             L+K   V+ +I +LN  K  V+++F+ WTTN++ L QQLDA+I K+ QI +KQ + Q 
Sbjct: 548 VVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQD 607

Query: 605 EIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIK 664
           EI+ LE +K     Q    +K HE+  +V+ES EN+EYLP+I+ IDNQIS LLNE+ IIK
Sbjct: 608 EIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIK 667

Query: 665 QENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 724
           QENANE+T+LS IT                                              
Sbjct: 668 QENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLD 727

Query: 725 HEEQVRKMKEQY--------------ENELNNVKKQKESLETEKLVEEHNRNEN----IK 766
           HEEQ+ ++K+ Y              E EL  VK++K  L+ EK +EE  R  N    +K
Sbjct: 728 HEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALK 787

Query: 767 KEVLDKQRKQAEAQHAAQTKSIAT-----NAANDMQDNSLYEFKTEEEIMYV 813
           +E+L KQ KQAE  HAA+   I       N     +D+SLYE+ TEE++MY 
Sbjct: 788 QEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 52/86 (60%)

Query: 110 NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQ 169
           N   Y ++AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+FP YLT+NE RQ 
Sbjct: 68  NNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQY 127

Query: 170 TIXXXXXXXXXXXXXXXDSQKIIDLT 195
            +                 QKI DLT
Sbjct: 128 QLLTELELKEKHLQYLKKCQKITDLT 153

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  299 bits (765), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 191/494 (38%), Positives = 277/494 (56%), Gaps = 39/494 (7%)

Query: 345 SVKDTSSALASEDLESYMTVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVIT 404
           S  +TS A +  D+       TP    K P++P+ E+P+  K+ + FF        P  +
Sbjct: 352 STPETSEAESDGDI-------TPIDPSKAPKVPFQERPQ--KERTGFFAL---WKSPTSS 399

Query: 405 DVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEK 464
                   + L+ P+ATPENPELI KT+E+GY+SK +YDK+ YDE  H+ WL   +  EK
Sbjct: 400 SAKKGAATAPLN-PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREK 458

Query: 465 AKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQ 524
           AKYD K  EY  +L++LQ +ID I  SM+ L++ET+ KIEV++N LVK+I + NT HN +
Sbjct: 459 AKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNK 518

Query: 525 KNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQ 584
           K  IFK+T              L+K   V+ EI +LN  K  V++EF+ WTTN+++L QQ
Sbjct: 519 KLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQ 578

Query: 585 LDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLP 644
           LDA+I K+ QI +KQ + Q EI+ LE QKK+   Q +  KK HE+  +V+ES ENKEYLP
Sbjct: 579 LDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLP 638

Query: 645 KIHTIDNQISELLNELAIIKQENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXX 704
           +I+ ID QIS LLN++ II+QENANE+T LS IT                          
Sbjct: 639 QINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEE 698

Query: 705 XXXXXXXXXXXXXXXXXXXXHEEQVRKMKEQYENELN--------------NVKKQKESL 750
                               HEEQ+ ++K+ Y ++L                VK+++  L
Sbjct: 699 NLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQDKLAAEEEELEAVKRERTKL 758

Query: 751 ETEKLVEEHNRNEN----IKKEVLDKQRKQAEAQHAAQTKSIATNAANDMQ-------DN 799
           + EK +EE  R +N    +K+ +LDKQ KQA   HAA+ + + T ++N  +       ++
Sbjct: 759 QGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENR-VNTPSSNLQESKRAVPKND 817

Query: 800 SLYEFKTEEEIMYV 813
           SLYE+ TEE++MY 
Sbjct: 818 SLYEYHTEEDVMYA 831

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 52/92 (56%)

Query: 104 AVNPFTNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTE 163
           A++   N   Y  +AK  KFPTVSATS  + Q P++LG+K + K  KRAKDIKFP YLT+
Sbjct: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118

Query: 164 NEFRQQTIXXXXXXXXXXXXXXXDSQKIIDLT 195
           NE RQ  +                 QKI DLT
Sbjct: 119 NEERQYQLLTELELKEKHLKYLKKCQKITDLT 150

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  296 bits (758), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 184/467 (39%), Positives = 261/467 (55%), Gaps = 33/467 (7%)

Query: 372 KVPRIPYTE--QPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIA 429
           K P++P+ E  + E    F+ +     ++     T  P          P+ATPENPELI 
Sbjct: 358 KAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAP--------SNPVATPENPELIV 409

Query: 430 KTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMIN 489
           KT+E+GY+SK +YDK+ YDE  H+ WL   +  EK KYD K +EY  +L++LQ +ID I 
Sbjct: 410 KTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIE 469

Query: 490 ESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDK 549
            SM+ +++ET++KIEVS+N LVKKI + N  HN +K  I K+T              LDK
Sbjct: 470 NSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDK 529

Query: 550 HAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKL 609
              V+ EI  LN+ K  V++EF+ WTTN++ L QQLDA+I K+ QI +KQ + Q EI+ L
Sbjct: 530 QTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNL 589

Query: 610 ETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENAN 669
           E +K++   Q +  KK HE+  +V+ES ENKEYLP+I+ IDNQIS LLNE+ IIKQENAN
Sbjct: 590 EKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENAN 649

Query: 670 EQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEEQV 729
           E+T+LS IT                                              HE+Q+
Sbjct: 650 EKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQI 709

Query: 730 RKMKEQY--------------ENELNNVKKQKESLETEKLVEEHNRNEN----IKKEVLD 771
            ++K+ Y              E EL  VK+++  L+ EK +EE  R +N    +K+E+L 
Sbjct: 710 TQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILS 769

Query: 772 KQRKQAEAQHAAQTKSIAT-----NAANDMQDNSLYEFKTEEEIMYV 813
           +Q KQAE  HAA+   I       N +   +D+SLYE+ TEE++MY 
Sbjct: 770 RQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 57/99 (57%), Gaps = 8/99 (8%)

Query: 105 VNPFT--------NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIK 156
           V+PF         N  AY ++AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+
Sbjct: 54  VSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIR 113

Query: 157 FPVYLTENEFRQQTIXXXXXXXXXXXXXXXDSQKIIDLT 195
           FP YLT+NE RQ  +                 QKI DLT
Sbjct: 114 FPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLT 152

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  248 bits (633), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 148/425 (34%), Positives = 231/425 (54%), Gaps = 29/425 (6%)

Query: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477
           P+A+P N E I KT ++GY+SK +YDK+ YDE  H++WL  ++  +  KY+ KM+EY   
Sbjct: 268 PVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKS 327

Query: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXX 537
           L+++  ++  +N+ +E  + +T +KI+V    LVKK+F++  +    K KIF ET     
Sbjct: 328 LQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKL 387

Query: 538 XXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITM 597
                    L+ +  V+  I +L + K +VR E+D WTTNMT +G +LDAK+ K++QI +
Sbjct: 388 EKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINV 447

Query: 598 KQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELL 657
            Q   Q +I+ L +QK   Q +I   K  H+   K+VES +NKEYLPK++ IDN+I+ LL
Sbjct: 448 TQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLL 507

Query: 658 NELAIIKQENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 717
           N++ I+KQENANE+ +L++IT                                       
Sbjct: 508 NQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAK 567

Query: 718 XXXXXXXHEEQVRKMKEQYE--------------NELNNVKKQKESLETEKLVEEHNRNE 763
                  H++++  +K  YE              ++L+ VK+QK  LE EK ++E  R +
Sbjct: 568 ANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQK 627

Query: 764 N----IKKEVLDKQRKQAEAQHAAQTKS-----------IATNAANDMQDNSLYEFKTEE 808
           +    +K E+ +KQ KQAEA  AAQ K            I   A    +DNSLY+++TEE
Sbjct: 628 DADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETEE 687

Query: 809 EIMYV 813
           ++MYV
Sbjct: 688 DVMYV 692

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 47/83 (56%)

Query: 116 KNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTIXXXX 175
           +N K  +FPTVSATS    ++PK+ GF T+ K    AKDI FP YLTENE RQQ      
Sbjct: 87  QNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNYLTENEQRQQAELLIL 146

Query: 176 XXXXXXXXXXXDSQKIIDLTIRQ 198
                      DSQ IIDLT +Q
Sbjct: 147 EKKEKDLKYLQDSQNIIDLTKKQ 169

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  221 bits (563), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 161/475 (33%), Positives = 249/475 (52%), Gaps = 51/475 (10%)

Query: 368 QPYD--KVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENP 425
           QP D  K PR+P+  + ++G    + + R+D                   D P+ATP++P
Sbjct: 319 QPIDPNKAPRVPF--KAKTG--VFALWTRSDKQ-----------------DQPLATPQDP 357

Query: 426 ELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEI 485
           E I +T++ GYMSK IYDK+ YDE  H+  L  F K +  KYD   +EYN++L  LQ +I
Sbjct: 358 EYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQI 416

Query: 486 DMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXXX 545
           D +  +ME L+ +T +KI+VSE+ L KK+ + N  H   KN IFKET             
Sbjct: 417 DELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDE 476

Query: 546 XLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKE 605
              KH  V+ EI +LN  KK+V  EF+++   +  L  QLD+K+ K+ ++  KQ E    
Sbjct: 477 ITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGL 536

Query: 606 IEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQ 665
           I +L  +K E + +   A++ H+E   ++ES +NKEYLPKI+ ID+Q++ LL  L +IKQ
Sbjct: 537 IAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQ 596

Query: 666 ENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 725
           ENAN++TE + IT                                              H
Sbjct: 597 ENANQKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKH 656

Query: 726 EEQVRKMKEQYENELNNVKKQ--------------KESLETEKLVEEHNRNEN----IKK 767
           EE++R++KE++E  LN+   Q              K  L  EK ++E  R +     +K+
Sbjct: 657 EEELRQIKEEHEKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQ 716

Query: 768 EVLDKQRKQAEAQHAA--------QTKSIATNAANDM-QDNSLYEFKTEEEIMYV 813
           E+++K+RKQAEA  AA        Q KS+ +N + ++ +++SLY+++T EEI+ V
Sbjct: 717 ELMEKRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITV 771

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 116 KNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTIXXXX 175
           KN K  KFPTVSATS  A+    +LG+K +D + +RAKDI  P YL   + +Q+      
Sbjct: 59  KNVKAKKFPTVSATSGTAS--AADLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKL 116

Query: 176 XXXXXXXXXXXDSQKIIDL 194
                      DSQKI+D+
Sbjct: 117 EFKENHLQYLKDSQKIVDV 135

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  215 bits (548), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 147/463 (31%), Positives = 220/463 (47%), Gaps = 17/463 (3%)

Query: 334 AEPESQEKMAPSVKDTSSALASEDLESYMTVETPQ-PYDKVPRIPYTEQPESGKKFSSFF 392
            EPES E    +  D++     +D+ S ++V +P   Y  VPR+    + E  +   S F
Sbjct: 416 GEPESYEGAGVTENDSTPGPMVDDVHSDVSVTSPPVDYAAVPRVVTFPEVEKKRSIFSIF 475

Query: 393 KRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNH 452
            R   +             Q++   P+ATPENPE++ KT+  G++SK +YDKV Y+   H
Sbjct: 476 GRKKKS-------------QNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKH 522

Query: 453 RRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVK 512
             WL  F  SEK +Y++K  +Y+N LEEL+KE++ + ESM+ +K +  + IE+    L K
Sbjct: 523 SEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSK 582

Query: 513 KIFERNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFD 572
           K  E    + E+KN IF ET                +   VQ EI  LN  K  +  EF 
Sbjct: 583 KFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFI 642

Query: 573 KWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQK 632
            WT  +      LDAK+  +  +  K  +TQ +I++L  +K   + ++ A K+ H +  K
Sbjct: 643 GWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTK 702

Query: 633 VVESYENKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKITXXXXXXXXXXXXXX 692
            VE + NKEYLPK+H ID++IS LL EL++IKQE+ANE+ +L  IT              
Sbjct: 703 AVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQL 762

Query: 693 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEEQVRKMKEQYENELNNVK--KQKESL 750
                                           HEE++RKMK+ YE  L  +K  + K++ 
Sbjct: 763 KLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQTA 822

Query: 751 ETEKLVEEHNRNENIKKEVLDKQRKQAEAQHAAQTKSIATNAA 793
           E E        NE     V     K + A  A+ T  I +  A
Sbjct: 823 EAEATKARAAENET-HGGVATHSVKSSGASGASGTDGIKSTGA 864

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (76%)

Query: 122 KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQ 168
           +FPTVS  S  +   PKELG++T+ + ++RAKDI+FP+YL ENE RQ
Sbjct: 89  RFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYLRENEARQ 135

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  204 bits (519), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 150/431 (34%), Positives = 230/431 (53%), Gaps = 37/431 (8%)

Query: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477
           P ATP + E I KT+++G +SK IYD++ YD+  H ++L  +K   + KYD KM+EY NE
Sbjct: 228 PKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENE 287

Query: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXX 537
           L+ L ++I   NE +E  KK+T  K+++    LVK++F+  ++  + K KIF ET     
Sbjct: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347

Query: 538 XX--XXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQI 595
                      LD   V   EI QLN  K++V +EF++WT NMT + +QLDAK+ K+ QI
Sbjct: 348 EKIDEKINVEELDDQVV--GEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQI 405

Query: 596 TMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISE 655
            + Q   Q +I+ L  +K     +I+A K  H    + +E+ +NK+YLPK++ ID+QI++
Sbjct: 406 NITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQIND 465

Query: 656 LLNELAIIKQENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 715
           LLN+L +IKQENANE+ +LS++T                                     
Sbjct: 466 LLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELE 525

Query: 716 XXXXXXXXXHEEQVRKMKEQYENEL--------------NNVKKQKESLETEKLVEEHNR 761
                    HE ++  +K  YE +L              +++K QK  LE  K +E+ +R
Sbjct: 526 QKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDR 585

Query: 762 NEN----IKKEVLDKQRKQAEAQHA---AQTKSIATNAANDM------------QDNSLY 802
            +     +K E+L KQ +QAEA +A   AQ K  A+  A D+            +D+SL+
Sbjct: 586 QKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLF 645

Query: 803 EFKTEEEIMYV 813
           E++TEEEIMYV
Sbjct: 646 EYETEEEIMYV 656

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 50/90 (55%)

Query: 106 NPFTNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENE 165
           N  TN  AY +N K  +FPTVSATS   N+  KE+GFK + K    AKDI FP YLT+NE
Sbjct: 75  NLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFPSYLTQNE 134

Query: 166 FRQQTIXXXXXXXXXXXXXXXDSQKIIDLT 195
            RQQ                 DSQ IIDLT
Sbjct: 135 QRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  197 bits (500), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/256 (42%), Positives = 158/256 (61%), Gaps = 1/256 (0%)

Query: 423 ENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQ 482
           ENPE + KT++ GY++K IYDK+   +  H  W+  +KK E+ K+DDK  E N ++  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 483 KEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXX 542
            +I  I   M  L+ +T  KIEVSEN L +K FE   +H ++KN++FK+T          
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 543 XXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDET 602
               LDK   VQ EI +LN  K++V EE  KWT ++  L  ++DAK+  + ++ +KQ  T
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 603 QKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAI 662
           Q+EI KL+ QK +   QI+     H E +KV+E  +NK YLPK++ +DNQIS LL +L  
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 663 IKQENANEQTELSKIT 678
           I+Q  ANE+TELS IT
Sbjct: 585 IRQHCANERTELSAIT 600

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%)

Query: 122 KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQ 168
           +FPT SA SA  N  P+ELG+K +    KRAKDI FPVYL E E +Q
Sbjct: 60  RFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYLEEIEKKQ 106

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  171 bits (432), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 165/314 (52%), Gaps = 24/314 (7%)

Query: 365 ETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPEN 424
           E P+   + PR+P+           + + R+D  G PV                 A+P +
Sbjct: 346 EKPKDIKETPRVPF------ATGIFALWTRSDKRGQPV-----------------ASPND 382

Query: 425 PELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKE 484
           PE I K ++ GYMSK +YD + Y+E  H+R +  + K   AKY+ K  EY + L  L+ +
Sbjct: 383 PEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQ 441

Query: 485 IDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXX 544
           I  +  +ME L+K+T +KIE+SE  L  ++ + N  H+  KN IFKET            
Sbjct: 442 IAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKE 501

Query: 545 XXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQK 604
               K   V+ E+ +L   + E+  E  +    +  L  +LDAK+  + ++  +Q E Q 
Sbjct: 502 GVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQA 561

Query: 605 EIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIK 664
            I+ L+ QK    ++ +AA ++H     V+ES ENKEYLPK++ ID +ISELL  L ++K
Sbjct: 562 SIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVK 621

Query: 665 QENANEQTELSKIT 678
           QE AN +TE + ++
Sbjct: 622 QETANHKTEFAAVS 635

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 100 EQKIAVNPF--TNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKF 157
           EQ    +PF  +   A  +  K  KFPTVSA+ +  +    ++G+K +D + +RAKDI  
Sbjct: 37  EQSAYNSPFRTSQSLAAAQKRKMQKFPTVSASVSAHSS--SDMGYKVIDAARRRAKDIAV 94

Query: 158 PVYLTENEFRQQTIXXXXXXXXXXXXXXXDSQKIIDL 194
           P YL  N+ RQ+                 DSQ+I+D+
Sbjct: 95  PRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  163 bits (412), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 158/262 (60%), Gaps = 1/262 (0%)

Query: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477
           P+++PENPE + KT+++GY+SK +YDKV YD++ H+RWL   + +E+ KY +K  EY + 
Sbjct: 356 PMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDN 415

Query: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXX 537
           L ++Q +ID I++ M+ LK +T+ KIEV E  LVK I +    HN+ KNKIFKET     
Sbjct: 416 LADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKL 475

Query: 538 XXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITM 597
                    + K A ++ EI  L++ +  V ++F++W + +  +  QLDAKI  +     
Sbjct: 476 EKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQ 535

Query: 598 KQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYE-NKEYLPKIHTIDNQISEL 656
           ++ + ++E+ KL   K E + +I   ++ H+   +++      K YLP+I+ IDN+I+  
Sbjct: 536 QKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGR 595

Query: 657 LNELAIIKQENANEQTELSKIT 678
           L +L+ IK+E   E   L+ +T
Sbjct: 596 LEKLSTIKKETIEENNRLTILT 617

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (62%), Gaps = 5/72 (6%)

Query: 105 VNPF---TNKPA--YNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPV 159
           V+PF   +N  A  Y K  K  +FPTVSA+S  +   P ELG+K + KSTKRAKDI FP 
Sbjct: 39  VSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPS 98

Query: 160 YLTENEFRQQTI 171
           +L  NE RQ  I
Sbjct: 99  FLIANERRQGGI 110

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 146/542 (26%), Positives = 244/542 (45%), Gaps = 76/542 (14%)

Query: 330 MDSEAEPESQEKMAPSVKDTSSALASEDLESYMTVETPQPYDKVPRIPYTEQPESGKKFS 389
           +D EAEP  +E  A      + A+A+E+ E+   +  P   +  PR+P+T  P    K  
Sbjct: 347 VDPEAEPSPEE--AVEAFQEAEAIATENPEA---ISPPPDINSAPRVPFT--PSGANKAG 399

Query: 390 --------------SFFKR------------NDNAGHPVITDVPVIPDQSQLDFPIATPE 423
                         + FKR            N  AG  V  D          D P+ATPE
Sbjct: 400 TAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVVPGD----------DAPVATPE 449

Query: 424 NPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQK 483
           +PELI +T+E GY+SK +YDK+ YDE  H+  L  + K +  +Y+ K +EY  +++ +Q 
Sbjct: 450 DPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQA 508

Query: 484 EIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXX 543
           EI  ++  ME ++ E  +K+++ +    + + E N  H   K  ++K+T           
Sbjct: 509 EIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDK 568

Query: 544 XXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQ 603
                 H  VQ EI +L   K EV +E  +  + +  L  +LD K   + +   K+DET 
Sbjct: 569 EDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETN 628

Query: 604 KEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAII 663
            EI+ LE +K   + +I  A++ H++    +ES +NKEYLPK++ I+ +IS LL  L +I
Sbjct: 629 AEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLI 688

Query: 664 KQENANEQTELSKITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 723
           +QE AN++ E S +T                                             
Sbjct: 689 QQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRTEYEKQAEEARL 748

Query: 724 XHEEQVRKMKEQYENELNNVKKQKES---------------------LETEKLVEEHNR- 761
            HEE++  +K+ ++  L   + Q+E+                     L+ EK +E   R 
Sbjct: 749 KHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQGEKAIEAQQRG 808

Query: 762 ---NENIKKEVLDKQRKQAEAQHAAQT-------KSIATNAANDMQDNSLYEFKTEEEIM 811
              ++ ++ E  +K R+QAEA  A +        K+ A     +  ++SLY+++T EE++
Sbjct: 809 NPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKKTKAAVPPANTTNSSLYDYETVEEVI 868

Query: 812 YV 813
            V
Sbjct: 869 TV 870

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 116 KNAKQMKFPTVSATSALANQDPKELGFKTL-DKSTKRAKDIKFPVYLTENEFRQQTIXXX 174
           +  +Q KFPT+S        DP+++G+  + DKS K+AKDI  P  L + E  Q+     
Sbjct: 75  RQVRQEKFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTA 132

Query: 175 XXXXXXXXXXXXDSQKIIDLT 195
                        SQKI+DLT
Sbjct: 133 LEKKEKQLRYWRKSQKIVDLT 153

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 166/322 (51%), Gaps = 36/322 (11%)

Query: 363 TVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATP 422
           T++ P+     PR+P+           + + R+D  G PV                 A+P
Sbjct: 316 TLQKPKNIKDTPRVPF------ATGIFALWTRSDKRGQPV-----------------ASP 352

Query: 423 ENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQ 482
           ++PE I K ++ GYMSK +YD + Y+E  H++ +  + K    KYD K +EY + L  L+
Sbjct: 353 DDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLK 411

Query: 483 KEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXX 542
            +I  +  +ME L+ +T DKI +S   L  ++ E N  H+  KN IFKET          
Sbjct: 412 SQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKID- 470

Query: 543 XXXXLDKHAVV--QDEITQLNDRKKEVREEFD----KWTTNMTTLGQQLDAKIMKVTQIT 596
                +K AVV  QDE+   N+  +  R E D    +  + +  L  QLD+K   + ++ 
Sbjct: 471 -----EKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELN 525

Query: 597 MKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISEL 656
            +Q E Q  I+ LE QK    A   AA + H     ++E   NK+YLPKI+ +D+QIS+L
Sbjct: 526 DQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINALDSQISQL 585

Query: 657 LNELAIIKQENANEQTELSKIT 678
           L+ LA++KQE AN+ TE + ++
Sbjct: 586 LSSLALVKQETANQHTEFAAVS 607

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 119 KQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTIXXXXXXX 178
           K  +FPTVSA+S   +    E+GFK +D + KRAKDI  P YL  N+ RQ+         
Sbjct: 57  KVQRFPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERK 114

Query: 179 XXXXXXXXDSQKII 192
                   DSQKI+
Sbjct: 115 EDSLQYKKDSQKIV 128

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  148 bits (373), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 165/302 (54%), Gaps = 20/302 (6%)

Query: 384 SGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYD 443
           SG K S+   +   AG   +T    +P+       +A+PENPE + +T EY  +SK +YD
Sbjct: 287 SGAKGSN---KTAKAGASNMTLGVAVPET----HAVASPENPEYLVRTNEYNIVSKAVYD 339

Query: 444 KVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINE--SMENLKKETAD 501
           ++ Y++  H  WLK F  +E  KY+ K +EY ++L ELQK++D I E   + N+KK+   
Sbjct: 340 QMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQ--Q 397

Query: 502 KIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLN 561
           KIE+ E  LVK + +  + +N  K K+ KET              L K   V++EI +LN
Sbjct: 398 KIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLN 457

Query: 562 DRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQID 621
           + K+ +  E++ W  N+  L   LD KI K+  I       QK+IE L+ +K   + +I 
Sbjct: 458 NEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEI- 516

Query: 622 AAKKEHEEGQK----VVESYE-NKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSK 676
              K+HEE  K    V++     K+YLP+++ ID QI+   ++LAIIK E  +E  +LS 
Sbjct: 517 ---KDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSI 573

Query: 677 IT 678
           +T
Sbjct: 574 LT 575

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 105 VNPFTN-----KPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPV 159
           ++PF N     +  Y K+ K+ KFPT SATS      P E+G+ +L K+ KRAKDI+FP 
Sbjct: 38  ISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPK 97

Query: 160 YLTENEFRQ 168
           YL +NE RQ
Sbjct: 98  YLLDNEKRQ 106

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  125 bits (313), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 150/284 (52%), Gaps = 6/284 (2%)

Query: 401 PVITDVPVIPDQSQLDFPI----ATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWL 456
           P  T V V   Q  +D P+    AT + PEL+ K  +YG++S  +++KV+YD+  H+  +
Sbjct: 277 PGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEM 336

Query: 457 KGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFE 516
             +++ +++K+  K++EY  +L ++      +   M + K +   K EV EN  +K++F+
Sbjct: 337 ADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFD 396

Query: 517 RNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTT 576
            N   N+ K K+  E                 K  ++Q E+ QL   K    +++  WTT
Sbjct: 397 SNATFNDSKVKVLHEAQLVKLQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTT 456

Query: 577 NMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVES 636
           N+T + ++LDA++ K++Q   KQD+  ++I  L  +K E +A+IDA +       + +  
Sbjct: 457 NLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLAD 516

Query: 637 YENKEYLP--KIHTIDNQISELLNELAIIKQENANEQTELSKIT 678
            E  ++L   ++  + + I   L+ LA++KQE + E+ +L  IT
Sbjct: 517 LETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGIT 560

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 105 VNPFTNKPAYNKNAKQM------KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFP 158
           V+PF        + KQ+      KFPTVSATS   + + +ELGF  +    +RA+DI FP
Sbjct: 49  VSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFP 108

Query: 159 VYLTENEFRQQTIXXXXXXXXXXXXXXXDSQKIIDLTIR 197
            YL ENE RQ+ I                 Q ++D T +
Sbjct: 109 EYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCK 147

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 139/263 (52%), Gaps = 12/263 (4%)

Query: 420 ATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELE 479
           ATPE+PE I  TE+ GYMSK IYD++ Y+E  H+  L    ++  AKY+D    Y  +L 
Sbjct: 323 ATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 480 ELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXX 539
            L  EI  ++ +M+ LK +T ++++  E +L + + +    H+EQK  + KE        
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 540 XXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQ 599
                   +K   V+ E+  L   + E + E  ++ + +  L  +LDA++ ++  ++ +Q
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 600 DETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVV----ESYENKEYLPKIHTIDNQISE 655
            E    +  LE    E + QI+   K+  E   VV    E  +N E  P I  +DNQ+SE
Sbjct: 502 TEVNLSMAALE----ERRVQIE---KDISESNAVVANNKELLQNLENHPSIAALDNQVSE 554

Query: 656 LLNELAIIKQENANEQTELSKIT 678
           +   ++ ++QE+A ++ EL++++
Sbjct: 555 VTRTVSAVEQEHAAQKDELTELS 577

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 145/278 (52%), Gaps = 15/278 (5%)

Query: 405 DVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEK 464
           D P +   ++  FP+A+PEN E + K      +SK +YDK+ +D   + +++  ++  + 
Sbjct: 234 DYPKVQSTTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQL 293

Query: 465 AKYDDKMEEYNNELEELQKE-IDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNE 523
            K +    EYN +++ +Q E    +NE +ENL  E+ +  EV +N LVK + +     ++
Sbjct: 294 NKLNKLKSEYNEKIKSIQLEKFKTLNE-IENLNLESFNNFEVIQNKLVKNLMDSTATFSD 352

Query: 524 QKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQ 583
            K KI ++T                K  +++ E   +N  K   +  F+    ++  + Q
Sbjct: 353 NKVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQ 412

Query: 584 QLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAA--KKEH-EEGQKVVESYENK 640
           +LDAK+ K++Q  ++ +  + EI KL+++K+    +ID+   KK H ++  K +E     
Sbjct: 413 ELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----- 467

Query: 641 EYLPKIHTIDNQISELLNELAIIKQENANEQTELSKIT 678
                ++ +D QI+  L+ L +IKQE  NE+ ++SK+T
Sbjct: 468 -----LNEMDEQINSKLSNLNLIKQEIINEKLKISKLT 500

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 107 PFTNKPAYNKNAKQM------KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVY 160
           PF N     +  KQ+      KFP VSATS   N D K++ +K LD     A+DIKFP  
Sbjct: 54  PFRNNAPSREQKKQLQDLKTAKFPLVSATST-YNTDTKDV-YKDLDPKKNFARDIKFPSR 111

Query: 161 LTENEFRQQTIXXXXXXXXXXXXXXXDSQKIIDL 194
           L +NE RQ  I               DS ++ID+
Sbjct: 112 LIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 30/174 (17%)

Query: 363 TVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATP 422
            V  P    KVP+IPY+E  +                           ++++   P+ATP
Sbjct: 92  VVREPVDIQKVPKIPYSEYGQC--------------------------NEAEFRNPVATP 125

Query: 423 ENPELIAKTEEYG----YMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNEL 478
           E PE +   +         SK I+D +  D  NH  WL   +     +   KMEEYN +L
Sbjct: 126 ETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQL 185

Query: 479 EELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKET 532
             L  +I     +M NL+++    I+++EN L K    +      +KNKI+KET
Sbjct: 186 AVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKET 239

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 124 PTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTI 171
           P  +  S+     P+ELG+K      K A++I FP  LTENE RQ+ I
Sbjct: 14  PISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAI 60

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 70/149 (46%), Gaps = 11/149 (7%)

Query: 119 KQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTIXXXXXXX 178
           K  ++PT+SATS  +N  P++LG+K +  STKRAKDI FPV L ENE RQ  +       
Sbjct: 76  KNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEK 135

Query: 179 XXXXXXXXDSQKIIDL--TIRQPDSXXXXXXXXXXXXXXXXXXNVDAENQQAHTKDNDTI 236
                    SQK+I +    ++P S                    + +  +A  K   +I
Sbjct: 136 ESQLDYLQKSQKLIKVEPIGQRPVSKSKQKDSKLK---------TNTDKPKATKKTQSSI 186

Query: 237 TDKEDMASQDAPEKEMSPREDSLPHPDAA 265
           +DK  +A  DAP+ ++    ++   PD  
Sbjct: 187 SDKTSIAKLDAPKGKLKKEANTEEKPDIG 215

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 119/261 (45%), Gaps = 45/261 (17%)

Query: 379 TEQPESGKKFSSFF---KRNDN----AGHPV--------ITDV--PVIPDQSQLDFPIAT 421
           T +P   +  SSFF   KRN N    +  P         +T++    + + + +  P AT
Sbjct: 321 TREPTPSRSTSSFFTVFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKAT 380

Query: 422 PENPELIAKTEEYG---YMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNEL 478
           P+NPEL+ KT        +SK +YD V Y+   H + +K +      KY +K EE+NN +
Sbjct: 381 PKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSI 440

Query: 479 EELQKEI-----DMIN--ESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFK- 530
            EL  +I     D+I+    +++L  +  +K ++   N  +K+  +       KN+I K 
Sbjct: 441 NELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIK-------KNQIIKK 493

Query: 531 --ETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAK 588
             E               LD     +D +T+ +D    +++    W +  + L +Q+D+K
Sbjct: 494 NDEITYILQSSPPTAAISLD----TKDAVTKQSDCTPLIKD----WKSEQSKLNEQIDSK 545

Query: 589 IMKVTQITMKQDETQKEIEKL 609
           +  + Q+     + +++I +L
Sbjct: 546 VNVIKQLNKNLADVKQKITEL 566

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 131/293 (44%), Gaps = 16/293 (5%)

Query: 385 GKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDK 444
           G K    FK +D               + QL  P  TPE PE++  T   GYMSK +YD+
Sbjct: 261 GGKLGGLFKHHD---------------KEQLLVPNGTPEEPEVVLLTNR-GYMSKAVYDR 304

Query: 445 VVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIE 504
           +  +E  H   L    +     Y    + Y  E+ +L  EI  +   +  L+ ET  +I+
Sbjct: 305 LNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQID 364

Query: 505 VSENNLVKKIFERNTLHNEQKNKIFKETXXXXXXXXXXXXXXLDKHAVVQDEITQLNDRK 564
             E +L K I +    + ++++ + ++               + ++  +Q EI +L   K
Sbjct: 365 GLEASLSKNIQDMKAENADKQHVLHEQAEAQRAEQLADKEEIVHQNQELQPEIDRLRKLK 424

Query: 565 KEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAK 624
           +    E  +    +  L QQLDA+  ++  +T +Q E    +  L+ QK + + ++  + 
Sbjct: 425 ENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSN 484

Query: 625 KEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKI 677
           +  +  ++ +E     +Y   +  ID + SE+L E+A I+QE   ++ EL  +
Sbjct: 485 EFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVAL 537

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 68/124 (54%), Gaps = 18/124 (14%)

Query: 417 FPIATPENPELIAKTEEY--GYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEY 474
           +PIATP+NPE++ +  E     +SK  YD++V  ++ H  WLK +     A Y+ + + Y
Sbjct: 179 YPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWY 238

Query: 475 NNELEELQKEIDMINESMENLKKET----ADKIEVSENN----LVKKIFERNTLHNEQKN 526
                  QK+ID+++E +   ++ +    AD + VSE N    LVK+ F+ N L  E+K 
Sbjct: 239 -------QKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKR-FQINKLIGEEKI 290

Query: 527 KIFK 530
            + K
Sbjct: 291 LLMK 294

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 2/117 (1%)

Query: 410 PDQSQLDFPIATPENPELIAK-TEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYD 468
           P   QL+ PIAT  NPE++ K  ++   ++K  YDK++    +H  W+          Y+
Sbjct: 377 PFNPQLN-PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYN 435

Query: 469 DKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQK 525
            K + Y  +L +L ++I+  N  +  +KK+T    E+++  L  K F+  +L N +K
Sbjct: 436 TKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEK 492

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 33/186 (17%)

Query: 353 LASEDLESYMTVETPQPYDKVPRIP---YTEQPESGKKFSSFFKRNDNAGHPVITDVPVI 409
           ++ E    Y  +E P     VP+IP   +T+ P + KK                      
Sbjct: 142 ISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKK---------------------- 179

Query: 410 PDQSQLDFPIATPENPE-LIAKTEEYG---YMSKPIYDKVVYDETNHRRWLKGFKKSEKA 465
               +L   +ATP+N E +I   ++ G   Y SK ++D + Y+   H   LK        
Sbjct: 180 ----ELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDE 235

Query: 466 KYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQK 525
           ++  K+ EY+ ++  L  +ID+ NE +  L  + +   + S+    K    + T +N  K
Sbjct: 236 RHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTK 295

Query: 526 NKIFKE 531
            +++ E
Sbjct: 296 TRLYGE 301

>Smik_4.757 Chr4 (1338682..1339653) [972 bp, 323 aa] {ON} YDR480W
           (REAL)
          Length = 323

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 341 KMAPSVKDTSSALASEDLESYMTVETPQPYDKVPRIPY 378
           ++APSV+D SS + +    S MT   P PY  +P +PY
Sbjct: 146 RLAPSVQDYSSPITN----SCMTATYPYPYTGLPSVPY 179

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 12/97 (12%)

Query: 578 MTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESY 637
           MT L ++L   I++  ++T  +D+   E  KL+          D    +HEE  K+   Y
Sbjct: 762 MTGLDRKLSEVILQNKELTTSRDQLFTEYSKLK----------DEHASKHEELTKMEREY 811

Query: 638 ENKEYLPKIHTIDNQISELLNELAIIKQENANEQTEL 674
             +  +  +H   N + +L NE+  ++QEN+  +++L
Sbjct: 812 --RSVIDSVHNSGNAMEKLQNEIIKLRQENSRLKSDL 846

>CAGL0K11726g Chr11 (1128486..1129862) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P07284 Saccharomyces cerevisiae
           YDR023w SES1 seryl-tRNA synthetase
          Length = 458

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 50/84 (59%), Gaps = 12/84 (14%)

Query: 424 NPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQK 483
           NPELI ++++  Y S  + D+++ D   ++ W+K        +++  ++E N +L +LQK
Sbjct: 14  NPELIRQSQKARYASVELVDEIIAD---YKDWVK-------TRFE--LDELNKKLNKLQK 61

Query: 484 EIDMINESMENLKKETADKIEVSE 507
           +I M  ++ E+  +  A+K ++SE
Sbjct: 62  DIGMKFKAKEDASELLAEKDKLSE 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,261,677
Number of extensions: 2985945
Number of successful extensions: 24810
Number of sequences better than 10.0: 1015
Number of HSP's gapped: 24283
Number of HSP's successfully gapped: 1792
Length of query: 813
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 695
Effective length of database: 39,950,811
Effective search space: 27765813645
Effective search space used: 27765813645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 70 (31.6 bits)