Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10494g3.493ON1721727881e-108
CAGL0L08448g3.493ON1731745834e-77
YPR149W (NCE102)3.493ON1731745688e-75
Skud_16.4443.493ON1731745662e-74
Smik_16.4023.493ON1731745601e-73
NDAI0G009303.493ON1761775175e-67
NCAS0E008003.493ON1741755141e-66
KAFR0C019703.493ON1791805021e-64
KNAG0B008003.493ON1821775012e-64
KNAG0A079503.493ON1821835002e-64
Suva_7.4193.493ON1741754845e-62
YGR131W (FHN1)3.493ON1741754837e-62
Suva_16.4783.493ON1661744802e-61
Smik_6.2273.493ON1741754742e-60
TDEL0D056103.493ON1751764742e-60
ZYRO0D09966g3.493ON1781794663e-59
KAFR0G037003.493ON1861874648e-59
Kpol_1017.63.493ON1871884622e-58
NDAI0B058803.493ON1821834603e-58
Skud_7.4423.493ON1741754576e-58
NCAS0F035603.493ON1831844533e-57
SAKL0F02750g3.493ON1701724332e-54
TPHA0D032803.493ON1841704256e-53
KLLA0D16280g3.493ON1691724221e-52
KLTH0F14850g3.493ON1711734046e-50
Kwal_55.212383.493ON1701724002e-49
TBLA0D029603.493ON1891553813e-46
TBLA0C044903.493ON1861543604e-43
Ecym_12363.493ON1691723482e-41
AFR312W3.493ON1681723421e-40
KLLA0C05478g6.102ON13561671.4
NCAS0C039508.61ON51960681.9
NDAI0E045707.436ON110334672.8
Suva_8.214.15ON186863663.9
KLLA0D08646g2.61ON286149654.0
NDAI0A004701.47ON38049637.9
TDEL0H00180singletonON25732629.4
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CAGL0I10494g
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   308   e-108
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   229   4e-77
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   223   8e-75
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   222   2e-74
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   220   1e-73
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   203   5e-67
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   202   1e-66
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   197   1e-64
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   197   2e-64
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   197   2e-64
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   191   5e-62
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   190   7e-62
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   189   2e-61
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   187   2e-60
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   187   2e-60
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   184   3e-59
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   183   8e-59
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   182   2e-58
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   181   3e-58
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   180   6e-58
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   179   3e-57
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   171   2e-54
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   168   6e-53
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   167   1e-52
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   160   6e-50
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   158   2e-49
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   151   3e-46
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   143   4e-43
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   138   2e-41
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   136   1e-40
KLLA0C05478g Chr3 (490633..491040) [408 bp, 135 aa] {ON} highly ...    30   1.4  
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    31   1.9  
NDAI0E04570 Chr5 (1031014..1034325) [3312 bp, 1103 aa] {ON} Anc_...    30   2.8  
Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W (R...    30   3.9  
KLLA0D08646g Chr4 complement(734915..735775) [861 bp, 286 aa] {O...    30   4.0  
NDAI0A00470 Chr1 (82257..83399) [1143 bp, 380 aa] {ON} Anc_1.47 ...    29   7.9  
TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON}                  28   9.4  

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  308 bits (788), Expect = e-108
 Identities = 159/172 (92%), Positives = 159/172 (92%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FFEPLAWP             TFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
           AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  229 bits (583), Expect = 4e-77
 Identities = 118/174 (67%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML+V DNLLRIVN VF++ICIGL S LI TR RHSSRVN+C+FAAAYGIATDSLYG+FAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FFE LAWP               TAG VLAVGIRAHSCNN  Y E   KI+QGS  RCR+
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRE-NNKIIQGSERRCRE 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL--RRKHHTEVGVPSISQV 516
           +QA VAFF+FSMAIFLAKMIMS++++ SNGAFG K   RR+++ EVGVPS+SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  223 bits (568), Expect = 8e-75
 Identities = 113/174 (64%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML++ADN+LRI+N +FL+I IGL SSL+NT+ RHSSRVN+C+FA AYGI TDSLYG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F EPLAWP             TFTAGTVLAVGIRAHSCNN  Y++   KI QGSGTRCRQ
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVD-SNKITQGSGTRCRQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 516
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  222 bits (566), Expect = 2e-74
 Identities = 114/174 (65%), Positives = 137/174 (78%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML+ ADN+LRI+N +FL+I IGL SSL+NT+ R+SSRVNFC+FAAAYGI TDSLYG+FAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FFEPLAWP             TFTAGTVLAVGIRAHSCNN+ Y++    I QGSGTRCRQ
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVD-SNGITQGSGTRCRQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 516
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  220 bits (560), Expect = 1e-73
 Identities = 112/174 (64%), Positives = 135/174 (77%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML++ADN+LRI+N +FL+I I L SSL+NT+ +HSSRVN+C+FA AYGI TDSLYG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F EPLAWP             TFTAGTVLAVGIRAHSCNN  Y++   KI QGSGTRCRQ
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVD-SNKITQGSGTRCRQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 516
           AQA VAF YFS AIFLAK +MSI +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  203 bits (517), Expect = 5e-67
 Identities = 104/177 (58%), Positives = 130/177 (73%), Gaps = 5/177 (2%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLSVADNLLR++NA+FL+ICIGL S+L+NT++ H+SR+N+C+F   Y + TDS +GI AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FFE L++P             TF AGTVLA GIR+HSCNN+ YL+R  KI QGSG RCR+
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDR-NKITQGSGNRCRE 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAF-----GAKLRRKHHTEVGVPSISQV 516
           +QALVAFFYFSM IFL K+ MS +S++ NGAF       + RR    EVGVPSISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  202 bits (514), Expect = 1e-66
 Identities = 103/175 (58%), Positives = 130/175 (74%), Gaps = 3/175 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML VADNLLRI+NAVFL+ICIGL S+L+NT+  ++SR+N+C+F  AY + TDS+YGIFAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FF+ LA P             TF AGTVLA GIRAHSC ++ Y+    KI QG   RCR+
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYV-NSNKITQGFKNRCRE 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG---AKLRRKHHTEVGVPSISQV 516
           +QALVAFFYFSMAIFLAK+IMS ++++ NGAF     + RR++  E+GVPSISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  197 bits (502), Expect = 1e-64
 Identities = 106/180 (58%), Positives = 131/180 (72%), Gaps = 8/180 (4%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 177
           ML VADN+LR++NAVFLII I L S+LINT+   H+SRVN+C+FA A+G+  DS+YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 178 NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
           NFF+ LAWP             TF+A T LAVGIRAHSC N+ YL+   KIV+GSG RCR
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLD-SNKIVRGSGQRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA------KLRRKHHTEV-GVPSISQV 516
           +AQALVAF YFS AIF+AKMIMS +++  NGAF +        R+KH T+V GVP+ISQV
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  197 bits (501), Expect = 2e-64
 Identities = 104/177 (58%), Positives = 123/177 (69%), Gaps = 5/177 (2%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML VADNLLR++N  FL+IC+   S+LINT+K H SRVN+C+FAAAYGIATD LYG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F+EPLAWP             T TAG VLAVGIRAHSC N RY ER   I+QGS  RCR 
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRER-NHIIQGSENRCRI 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK-----LRRKHHTEVGVPSISQV 516
           +QA  AFF+FSM IF+AKM+MS +++ SNGAF         RR+H   VGVP  S V
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGV 176

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  197 bits (500), Expect = 2e-64
 Identities = 103/183 (56%), Positives = 126/183 (68%), Gaps = 11/183 (6%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML++AD  LR+VN VFL+IC+GL S+L+NT+  HSSR+N+C+F AAYGI TDS YG+ AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F+EPL+WP             T TAG VLAVGIRAHSC N  Y   + KIVQGS  RCRQ
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAY-RNKNKIVQGSENRCRQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG-----------AKLRRKHHTEVGVPSI 507
           AQA VAFF+FSMAIFLAK IMS+V++ +NG FG           +K +R      GVP+I
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179

Query: 508 SQV 516
           S V
Sbjct: 180 STV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  191 bits (484), Expect = 5e-62
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 3/175 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLSVADN++RI+NA+FLII IGL S LI+++ +HSSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
            +  L +P             TF AGT LAVGIR HSC+NK YL+   KI QGSG+RC Q
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLD-NNKITQGSGSRCHQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG---AKLRRKHHTEVGVPSISQV 516
           A+A V FFYFS  +FL K+++SI ++V NG FG   +  RR+   ++G+P+ISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  190 bits (483), Expect = 7e-62
 Identities = 97/175 (55%), Positives = 122/175 (69%), Gaps = 3/175 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS ADNL+RI+NAVFLII IGL S LI T+ +HSSRVNFC+FAA YG+ TDSLYG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F+  L +P             TF A T LAVGIR HSC NK YLE + KI+QGS +RC Q
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKIIQGSSSRCHQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 516
           +QA VAFFYFS  +FL K+ ++ + ++ NG FG+     RR+   ++G+P+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  189 bits (480), Expect = 2e-61
 Identities = 99/174 (56%), Positives = 123/174 (70%), Gaps = 2/174 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML+  DN+LRI+N +FL+I IGL SSL+NT+  +SSR+N+C+FA AY I TDSLYG+FAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           FFEPLAWP             TFTA       IRAHSC N+ YL     I QGSG RCR+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYL-ASNSITQGSGNRCRE 112

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 516
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  187 bits (474), Expect = 2e-60
 Identities = 97/175 (55%), Positives = 118/175 (67%), Gaps = 3/175 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS ADNL+RI+NAVFLII IGL S LI+T+ +HSSRVNFC+F AAYG+ TDSLYG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F+  L +P             TF A T LAVGIR HSC NK YLE + KI Q S +RC Q
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKITQASSSRCHQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 516
           +QA VAFFYFS  +FL K+ ++    + NG FG      RR+   ++GVP+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  187 bits (474), Expect = 2e-60
 Identities = 96/176 (54%), Positives = 119/176 (67%), Gaps = 4/176 (2%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML++ DN LR+VN  FL+I +GL   LI++   HSSRVNFC+FAAA+GI TDS YGI AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
            +E  AWP             TF+A T LAVGIR HSC N+ YL+    I QGS  RCR 
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLD-SNNITQGSTQRCRL 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL----RRKHHTEVGVPSISQV 516
           AQA VAFFYFS  IFLAKMIMS++ +++NG F ++     RR+   +VGVP+ISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  184 bits (466), Expect = 3e-59
 Identities = 97/179 (54%), Positives = 120/179 (67%), Gaps = 7/179 (3%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 177
           ML++ DN+LR VN  F +I +GL   LI + K  H+SRVNFC+FAAA+GI  DS YGI A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 178 NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
           N F P A+P             TFTA T LAVGIR HSC N+ YL+   KI QGS +RCR
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLD-SNKITQGSTSRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG------AKLRRKHHTEVGVPSISQV 516
           +AQA+VAFFYF+  IFL KM+MS +S++SNGAFG      ++ RR     VGVP+ISQV
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  183 bits (464), Expect = 8e-59
 Identities = 99/187 (52%), Positives = 124/187 (66%), Gaps = 15/187 (8%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSS-RVNFCLFAAAYGIATDSLYGIFA 177
           ML++ADN LR+VN  F++I +   + L+NTR+ H+S RVN+C+FA A+GI TDS+YG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 178 NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
           NFFE LAWP              FTAGTVLAVGIRAH+CNN+ Y     KIV+GS TRCR
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAY-RNSNKIVRGSETRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA------KLRRKHH--------TEVG 495
            AQA VAFFYFSMAIFL K + SI+  +S G FG+        RRK          T  G
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTG 179

Query: 496 VPSISQV 516
           VP++S+V
Sbjct: 180 VPTVSEV 186

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  182 bits (462), Expect = 2e-58
 Identities = 94/188 (50%), Positives = 122/188 (64%), Gaps = 16/188 (8%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ADN++R +N  F +IC+GL  SL+ T K HSSRVN+C+F   + + TDS YGI AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 181 FF-EPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
            +  P AWP             TFTAGTVL+VGIR HSC N+ Y++   KI+QGS  RCR
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYID-NNKIIQGSTDRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL----RRKHHT-----------EV 492
           +AQA +AFFYFS  IF  K++MS ++++SNGA G       RR+HHT           +V
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQV 179

Query: 493 GVPSISQV 516
           GVP+ISQV
Sbjct: 180 GVPNISQV 187

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  181 bits (460), Expect = 3e-58
 Identities = 95/183 (51%), Positives = 123/183 (67%), Gaps = 11/183 (6%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS  DN+LR++NA+FL++ +   S+L+NT++ +SSR+NFC+FAAA+G+ TDS +G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 181 FFEPLA-WPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
            F+ LA WP             TFTAGTVLAV IRAHSC N+RY+     I QGS  RCR
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYV-NSNSITQGSENRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA----------KLRRKHHTEVGVPSI 507
            +QA VAFFYFS  IFLAKMIMS +++ SNG FG+          +  R    EVGVP+I
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 508 SQV 516
           SQV
Sbjct: 180 SQV 182

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  180 bits (457), Expect = 6e-58
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 3/175 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS ADNL+RIV+AVFLII IGL   L+ T+   SSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F+  L +P             TF A T LAVGIR HSC NK YLE +  I QGS +RC Q
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLE-QNNITQGSSSRCHQ 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 516
           +QA VAFFYFS  +FL K+ +S+  ++ NG FG      RR+   ++GVP+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  179 bits (453), Expect = 3e-57
 Identities = 98/184 (53%), Positives = 123/184 (66%), Gaps = 12/184 (6%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS  DN LR  N +FL++ I   S+L++T+   SSRVN+C+FAAA+G+ TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 181 FFEPL-AWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
             + L +WP             TFTAGTVLAVGIR HSCNN+RYLE   KI+QGSG RCR
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLE-SNKIIQGSGIRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA---KLRRKHH--------TEVGVPS 504
            +QA VAFFYF+  +FLAKMIMS +S+ SNGAFG+     RRK          T  GVP+
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPT 179

Query: 505 ISQV 516
           IS+V
Sbjct: 180 ISEV 183

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  171 bits (433), Expect = 2e-54
 Identities = 89/172 (51%), Positives = 110/172 (63%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ DN LR+VN  FL+I +GL  SLI T+  HS RVNF +F AA+ + TDS Y +FAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
            F   AWP             TF+A T LAVGIR HSC N+ YL     I QGS  RCR+
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYL-FSNNITQGSTDRCRK 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
           AQA VAF YFS  IFL K+++S+++V S+GAFG+         VGVP+ISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSG-SGSRRANVGVPTISQV 170

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  168 bits (425), Expect = 6e-53
 Identities = 88/170 (51%), Positives = 111/170 (65%), Gaps = 3/170 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           ML +ADN+LR VN  F +IC+GL  SL+ T+ +HSSRVN+C+F   + + TD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 181 FFE-PLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
            +  PLAWP             TFTAGTVLAVG R HSC N+ YL+    I QGS  RCR
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLD-SNNITQGSTDRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL--RRKHHTEVGVP 501
           +AQA  AFFYFS  IFLAK+IMS +++ +NGA G+    RR+    VGVP
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVP 169

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  167 bits (422), Expect = 1e-52
 Identities = 92/172 (53%), Positives = 110/172 (63%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ DN LR VN VFLII +GL  +LI T+   SSRVNF +FAA +GI  DSLY + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F   LAWP             TF+A T LAVGIR  SC N  +     KI +GS  RCR+
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTS-GNKIAEGSKDRCRK 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
           AQA   F YFS AIFL K I+SIV+ +++GAFG    RK  T+VGVP+ISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK--TQVGVPTISQV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  160 bits (404), Expect = 6e-50
 Identities = 90/173 (52%), Positives = 112/173 (64%), Gaps = 1/173 (0%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSS-RVNFCLFAAAYGIATDSLYGIFA 177
           MLS+ DN LR +N  FL+I +GL  SL  T K H++ +VNF +F AA+G+  DSLY I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 178 NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 357
           NF   LAWP             TF A T LAV IR HSC N+ YL+  T + QGS  RCR
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNT-VTQGSTDRCR 119

Query: 358 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
           +AQA VAF YFS  IFLAK+ +S+V+++S GAFGA   R+    VGVP+ISQV
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRR-TGNVGVPTISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  158 bits (400), Expect = 2e-49
 Identities = 86/172 (50%), Positives = 107/172 (62%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ DN LR  N VFL+I +GL  SL  TR  ++ +VNF +FAAA+G+  D+LY I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F   LAWP             TF A T LAV IR HSC N  Y++   K+ QGS  RCR+
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVD-NNKVTQGSSDRCRK 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
           AQA VAF YF+  +FL K+ +S+V+V S GAF     RK    VGVP+ISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRK-SANVGVPTISQV 170

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  151 bits (381), Expect = 3e-46
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 177
           ML + DN+ RI N  F +I  G+  +L+NT    HSSRVN+C+F  A+G+ +DS YGI A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 178 NFF-EPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 354
           N   EP A+P             TFTAGTVLAVGIR HSC NK Y  RE  I+QGS  RC
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEY-RRENYIIQGSERRC 119

Query: 355 RQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG 459
           R+AQA +AFFYFSM +FL K+++++V+  + G  G
Sbjct: 120 REAQACIAFFYFSMFLFLVKVLITLVTYFTGGELG 154

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  143 bits (360), Expect = 4e-43
 Identities = 78/154 (50%), Positives = 97/154 (62%), Gaps = 2/154 (1%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 177
           MLS   N+LRI+N  FL+I  G+   LI + KR HS RVN+C+FAA + + TDS Y I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 178 NFF-EPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 354
           NF+  P AWP             TFTAGTVL+VGIR HSC NK YL    KI QGS  RC
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYL-FSNKITQGSTERC 119

Query: 355 RQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAF 456
           R AQA +AF+YFS  I+L +++ S + +  NG F
Sbjct: 120 RLAQASIAFYYFSFFIYLVQLVKSSLLMWENGLF 153

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  138 bits (348), Expect = 2e-41
 Identities = 80/172 (46%), Positives = 99/172 (57%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ DN LR  N +FLII + L  SLIN + R  SRVNF LF A + +  DSLY + AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F   LAWP             TF A T L   I  HSC+N  +L R   I +G   RCR+
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFL-RGNDISEGREGRCRK 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
            QA   F +FS  IFLAK ++S +++VS GAF +   RK  T  GVP+ISQV
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRK--TGGGVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  136 bits (342), Expect = 1e-40
 Identities = 78/172 (45%), Positives = 101/172 (58%)
 Frame = +1

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 180
           MLS+ DN LR VN VFLII +GL  SLI+ ++   SRVNF LF A + + TDS Y I AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 181 FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 360
           F    AWP             TF A T L   I AHSC+N+ +L+  T I + S  RCR+
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNT-ISEQSTDRCRK 119

Query: 361 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 516
            QA   F +FS  IFLAK + S +++ S+GAF +   ++     GVP+ISQV
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNIFSSGAFSSGGSKRGG---GVPTISQV 168

>KLLA0C05478g Chr3 (490633..491040) [408 bp, 135 aa] {ON} highly
           similar to uniprot|P53173 Saccharomyces cerevisiae
           YGL054C ERV14 Protein localized to COPII-coated vesicles
           involved in vesicle formation and incorporation of
           specific secretory cargo required for the delivery of
           bud-site selection protein Axl2p to cell surface related
           to Drosophila cornichon
          Length = 135

 Score = 30.4 bits (67), Expect = 1.4
 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 262 VLAVGIRAHSCNN---KRYLERETKIVQGSGTRCRQAQALVAFFYFSMAIFLAKMIMSIV 432
           +L +GI A++ N    K+ L   T+I +  G   R++   +AF+ F    +L +MIMS++
Sbjct: 72  LLNLGILAYNGNKFYKKQQLLDATEIFRTLGKHKRESFIKLAFYLFLFFFYLYRMIMSLI 131

Query: 433 S 435
           +
Sbjct: 132 A 132

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 30.8 bits (68), Expect = 1.9
 Identities = 15/60 (25%), Positives = 31/60 (51%)
 Frame = -1

Query: 189 LEEVSEDTVEGVGSDTVRSGKQTEVDTGGVSLPGVDQRRGQTNTDNQENSINYTQKVVSN 10
           +++ S  +    G DT ++GK+ E  +   +    D+  G T+ D + N++   +K +SN
Sbjct: 452 MQQSSGTSTTSPGKDTTKTGKEDETSSATHTKKSEDESTGTTDPD-EPNALGRLEKFISN 510

>NDAI0E04570 Chr5 (1031014..1034325) [3312 bp, 1103 aa] {ON}
           Anc_7.436 YBL101C
          Length = 1103

 Score = 30.4 bits (67), Expect = 2.8
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = -2

Query: 278 IPTARTVPAVKVNTKFKKSRTNRTRGQANGSKKL 177
           +P+AR    ++V TKFK       RG+ N S KL
Sbjct: 495 LPSARVSYKIRVGTKFKNRVNQNNRGRHNNSDKL 528

>Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W
           (REAL)
          Length = 1868

 Score = 30.0 bits (66), Expect = 3.9
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = +1

Query: 16  DNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFANFFEPL 195
           D LL+  NA+F  +C G+A++  N  K+ S       F       + +L    A F +  
Sbjct: 229 DQLLKFKNAIFRFVCHGMAAA--NCDKQPSKNTELMKFLCVVSTDSSTLSDSAAQFMKRF 286

Query: 196 AWP 204
           A P
Sbjct: 287 AVP 289

>KLLA0D08646g Chr4 complement(734915..735775) [861 bp, 286 aa] {ON}
           weakly similar to uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W
          Length = 286

 Score = 29.6 bits (65), Expect = 4.0
 Identities = 32/149 (21%), Positives = 59/149 (39%), Gaps = 4/149 (2%)
 Frame = +1

Query: 7   SVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAA----AYGIATDSLYGIF 174
           S+  N++R + ++F  + + L ++ I       S+ NF L  +     Y +A    +G F
Sbjct: 73  SLFHNIVRGLQSMFTSLVLSLTATSIAKASWGDSKTNFGLAVSVMTFVYFLAGGIFWG-F 131

Query: 175 ANFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 354
           A+     A P              +    V+     +HSCN   +    +     S   C
Sbjct: 132 ASASARSAVPVSVFFGLEAFFVLMWFCAFVVLADNFSHSCNYGSFFWTSSSSDDWS-VSC 190

Query: 355 RQAQALVAFFYFSMAIFLAKMIMSIVSVV 441
           +  +A  AF  F+   F+   I+ I +V+
Sbjct: 191 KAGKAAAAFAAFAWLFFVVSFIIYIFNVL 219

>NDAI0A00470 Chr1 (82257..83399) [1143 bp, 380 aa] {ON} Anc_1.47
           YCL028W
          Length = 380

 Score = 28.9 bits (63), Expect = 7.9
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = -1

Query: 168 TVEGVGSDTVRSGKQTEVDTGGVSLPGVDQRRGQTNTDNQENSINYTQK 22
           T+  +    + SGKQ +    G    G  Q +GQ N++ Q+   NY  +
Sbjct: 180 TLASMAQSYMSSGKQNQHQQQGQGQHGYGQNQGQYNSNQQQGYNNYNNQ 228

>TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 28.5 bits (62), Expect = 9.4
 Identities = 10/32 (31%), Positives = 22/32 (68%)
 Frame = +1

Query: 346 TRCRQAQALVAFFYFSMAIFLAKMIMSIVSVV 441
           +RCR+A+A +A   F+M ++ A + + +++ V
Sbjct: 122 SRCREAKAAIAMCAFNMVLYAASLTLLVLNCV 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,737,464
Number of extensions: 596534
Number of successful extensions: 1667
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1609
Number of HSP's successfully gapped: 37
Length of query: 173
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 71
Effective length of database: 41,785,467
Effective search space: 2966768157
Effective search space used: 2966768157
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)