Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10494g3.493ON1721728181e-113
CAGL0L08448g3.493ON1731746024e-80
Skud_16.4443.493ON1731745842e-77
YPR149W (NCE102)3.493ON1731745826e-77
Smik_16.4023.493ON1731745764e-76
NDAI0G009303.493ON1761775366e-70
NCAS0E008003.493ON1741755289e-69
KAFR0C019703.493ON1791805105e-66
KNAG0B008003.493ON1821835002e-64
Suva_16.4783.493ON1661744922e-63
YGR131W (FHN1)3.493ON1741754914e-63
NDAI0B058803.493ON1821834672e-59
Suva_7.4193.493ON1741754645e-59
Smik_6.2273.493ON1741754551e-57
KNAG0A079503.493ON1821834542e-57
KAFR0G037003.493ON1861874482e-56
TDEL0D056103.493ON1751764446e-56
KLLA0D16280g3.493ON1691724314e-54
Skud_7.4423.493ON1741754281e-53
Kpol_1017.63.493ON1871884213e-52
SAKL0F02750g3.493ON1701724133e-51
ZYRO0D09966g3.493ON1781794003e-49
TBLA0D029603.493ON1891553926e-48
NCAS0F035603.493ON1831843918e-48
TPHA0D032803.493ON1841853882e-47
KLTH0F14850g3.493ON1711733707e-45
TBLA0C044903.493ON1861593717e-45
Kwal_55.212383.493ON1701723655e-44
Ecym_12363.493ON1691722951e-33
AFR312W3.493ON1681232701e-29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10494g
         (172 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   319   e-113
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   236   4e-80
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   229   2e-77
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   228   6e-77
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   226   4e-76
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   211   6e-70
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   207   9e-69
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   201   5e-66
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   197   2e-64
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   194   2e-63
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   193   4e-63
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   184   2e-59
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   183   5e-59
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   179   1e-57
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   179   2e-57
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   177   2e-56
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   175   6e-56
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   170   4e-54
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   169   1e-53
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   166   3e-52
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   163   3e-51
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   158   3e-49
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   155   6e-48
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   155   8e-48
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   154   2e-47
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   147   7e-45
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   147   7e-45
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   145   5e-44
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   118   1e-33
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   108   1e-29

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  319 bits (818), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 159/172 (92%), Positives = 159/172 (92%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FFEPLAWP             TFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  236 bits (602), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 118/174 (67%), Positives = 136/174 (78%), Gaps = 3/174 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML+V DNLLRIVN VF++ICIGL S LI TR RHSSRVN+C+FAAAYGIATDSLYG+FAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FFE LAWP               TAG VLAVGIRAHSCNN  Y E   KI+QGS  RCR+
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRE-NNKIIQGSERRCRE 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL--RRKHHTEVGVPSISQV 172
           +QA VAFF+FSMAIFLAKMIMS++++ SNGAFG K   RR+++ EVGVPS+SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  229 bits (584), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 114/174 (65%), Positives = 137/174 (78%), Gaps = 3/174 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML+ ADN+LRI+N +FL+I IGL SSL+NT+ R+SSRVNFC+FAAAYGI TDSLYG+FAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FFEPLAWP             TFTAGTVLAVGIRAHSCNN+ Y++    I QGSGTRCRQ
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVD-SNGITQGSGTRCRQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  228 bits (582), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 113/174 (64%), Positives = 136/174 (78%), Gaps = 3/174 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML++ADN+LRI+N +FL+I IGL SSL+NT+ RHSSRVN+C+FA AYGI TDSLYG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F EPLAWP             TFTAGTVLAVGIRAHSCNN  Y++   KI QGSGTRCRQ
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVD-SNKITQGSGTRCRQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  226 bits (576), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (77%), Gaps = 3/174 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML++ADN+LRI+N +FL+I I L SSL+NT+ +HSSRVN+C+FA AYGI TDSLYG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F EPLAWP             TFTAGTVLAVGIRAHSCNN  Y++   KI QGSGTRCRQ
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVD-SNKITQGSGTRCRQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172
           AQA VAF YFS AIFLAK +MSI +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  211 bits (536), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 104/177 (58%), Positives = 129/177 (72%), Gaps = 6/177 (3%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLSVADNLLR++NA+FL+ICIGL S+L+NT++ H+SR+N+C+F   Y + TDS +GI AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FFE L++P             TF AGTVLA GIR+HSCNN+ YL+R  KI QGSG RCR+
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRN-KITQGSGNRCRE 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL-----RRKHHTEVGVPSISQV 172
           +QALVAFFYFSM IFL K+ MS +S++ NGAF         RR    EVGVPSISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  207 bits (528), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 103/175 (58%), Positives = 130/175 (74%), Gaps = 4/175 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML VADNLLRI+NAVFL+ICIGL S+L+NT+  ++SR+N+C+F  AY + TDS+YGIFAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FF+ LA P             TF AGTVLA GIRAHSC ++ Y+    KI QG   RCR+
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVN-SNKITQGFKNRCRE 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172
           +QALVAFFYFSMAIFLAK+IMS ++++ NGAF   +   RR++  E+GVPSISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  201 bits (510), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 106/180 (58%), Positives = 131/180 (72%), Gaps = 9/180 (5%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 59
           ML VADN+LR++NAVFLII I L S+LINT+   H+SRVN+C+FA A+G+  DS+YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
           NFF+ LAWP             TF+A T LAVGIRAHSC N+ YL+   KIV+GSG RCR
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLD-SNKIVRGSGQRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA------KLRRKHHTEV-GVPSISQV 172
           +AQALVAF YFS AIF+AKMIMS +++  NGAF +        R+KH T+V GVP+ISQV
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  197 bits (500), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 122/183 (66%), Gaps = 12/183 (6%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML VADNLLR++N  FL+IC+   S+LINT+K H SRVN+C+FAAAYGIATD LYG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F+EPLAWP             T TAG VLAVGIRAHSC N RY ER   I+QGS  RCR 
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERN-HIIQGSENRCRI 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRR-----------KHHTEVGVPSI 169
           +QA  AFF+FSM IF+AKM+MS +++ SNGAF     +                 GVPSI
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 170 SQV 172
           SQV
Sbjct: 180 SQV 182

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  194 bits (492), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 124/174 (71%), Gaps = 10/174 (5%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML+  DN+LRI+N +FL+I IGL SSL+NT+  +SSR+N+C+FA AY I TDSLYG+FAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           FFEPLAWP             TFTA       IRAHSC N+ YL   + I QGSG RCR+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNS-ITQGSGNRCRE 112

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  193 bits (491), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 122/175 (69%), Gaps = 4/175 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS ADNL+RI+NAVFLII IGL S LI T+ +HSSRVNFC+FAA YG+ TDSLYG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F+  L +P             TF A T LAVGIR HSC NK YLE + KI+QGS +RC Q
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKIIQGSSSRCHQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172
           +QA VAFFYFS  +FL K+ ++ + ++ NG FG+     RR+   ++G+P+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  184 bits (467), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 124/183 (67%), Gaps = 12/183 (6%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS  DN+LR++NA+FL++ +   S+L+NT++ +SSR+NFC+FAAA+G+ TDS +G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FFEPLA-WPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
            F+ LA WP             TFTAGTVLAV IRAHSC N+RY+   + I QGS  RCR
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNS-ITQGSENRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA----------KLRRKHHTEVGVPSI 169
            +QA VAFFYFS  IFLAKMIMS +++ SNG FG+          +  R    EVGVP+I
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 170 SQV 172
           SQV
Sbjct: 180 SQV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  183 bits (464), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 94/175 (53%), Positives = 122/175 (69%), Gaps = 4/175 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLSVADN++RI+NA+FLII IGL S LI+++ +HSSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
            +  L +P             TF AGT LAVGIR HSC+NK YL+   KI QGSG+RC Q
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLD-NNKITQGSGSRCHQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVS---NGAFGAKLRRKHHTEVGVPSISQV 172
           A+A V FFYFS  +FL K+++SI ++V     G   +  RR+   ++G+P+ISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  179 bits (455), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 94/175 (53%), Positives = 115/175 (65%), Gaps = 4/175 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS ADNL+RI+NAVFLII IGL S LI+T+ +HSSRVNFC+F AAYG+ TDSLYG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F+  L +P             TF A T LAVGIR HSC NK YLE + KI Q S +RC Q
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKITQASSSRCHQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMS---IVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           +QA VAFFYFS  +FL K+ ++    +     G      RR+   ++GVP+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  179 bits (454), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 126/183 (68%), Gaps = 12/183 (6%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML++AD  LR+VN VFL+IC+GL S+L+NT+  HSSR+N+C+F AAYGI TDS YG+ AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F+EPL+WP             T TAG VLAVGIRAHSC N  Y   + KIVQGS  RCRQ
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAY-RNKNKIVQGSENRCRQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG-----------AKLRRKHHTEVGVPSI 169
           AQA VAFF+FSMAIFLAK IMS+V++ +NG FG           +K +R      GVP+I
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179

Query: 170 SQV 172
           S V
Sbjct: 180 STV 182

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  177 bits (448), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 123/187 (65%), Gaps = 16/187 (8%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRH-SSRVNFCLFAAAYGIATDSLYGIFA 59
           ML++ADN LR+VN  F++I +   + L+NTR+ H S+RVN+C+FA A+GI TDS+YG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
           NFFE LAWP              FTAGTVLAVGIRAH+CNN+ Y     KIV+GS TRCR
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAY-RNSNKIVRGSETRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGA------FGAKLRRKHH--------TEVG 165
            AQA VAFFYFSMAIFL K + SI+  +S G       FG   RRK          T  G
Sbjct: 120 VAQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTG 179

Query: 166 VPSISQV 172
           VP++S+V
Sbjct: 180 VPTVSEV 186

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  175 bits (444), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 96/176 (54%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML++ DN LR+VN  FL+I +GL   LI++   HSSRVNFC+FAAA+GI TDS YGI AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
            +E  AWP             TF+A T LAVGIR HSC N+ YL+    I QGS  RCR 
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLD-SNNITQGSTQRCRL 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL----RRKHHTEVGVPSISQV 172
           AQA VAFFYFS  IFLAKMIMS++ +++NG F ++     RR+   +VGVP+ISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  170 bits (431), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 110/172 (63%), Gaps = 3/172 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ DN LR VN VFLII +GL  +LI T+   SSRVNF +FAA +GI  DSLY + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F   LAWP             TF+A T LAVGIR  SC N  +     KI +GS  RCR+
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSF-TSGNKIAEGSKDRCRK 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           AQA   F YFS AIFL K I+SIV+ +++GAFG    RK  T+VGVP+ISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK--TQVGVPTISQV 169

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  169 bits (428), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 116/175 (66%), Gaps = 4/175 (2%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS ADNL+RIV+AVFLII IGL   L+ T+   SSRVNFC+FAAAYG+ TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F+  L +P             TF A T LAVGIR HSC NK YLE +  I QGS +RC Q
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLE-QNNITQGSSSRCHQ 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172
           +QA VAFFYFS  +FL K+ +S+  ++ NG FG      RR+   ++GVP+ISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  166 bits (421), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 122/188 (64%), Gaps = 17/188 (9%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ADN++R +N  F +IC+GL  SL+ T K HSSRVN+C+F   + + TDS YGI AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FF-EPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
            +  P AWP             TFTAGTVL+VGIR HSC N+ Y++   KI+QGS  RCR
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNN-KIIQGSTDRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL----RRKHHT-----------EV 164
           +AQA +AFFYFS  IF  K++MS ++++SNGA G       RR+HHT           +V
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQV 179

Query: 165 GVPSISQV 172
           GVP+ISQV
Sbjct: 180 GVPNISQV 187

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  163 bits (413), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 111/172 (64%), Gaps = 2/172 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ DN LR+VN  FL+I +GL  SLI T+  HS RVNF +F AA+ + TDS Y +FAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
            F   AWP             TF+A T LAVGIR HSC N+ YL     I QGS  RCR+
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYL-FSNNITQGSTDRCRK 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           AQA VAF YFS  IFL K+++S+++V S+GAFG+    +    VGVP+ISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSR-RANVGVPTISQV 170

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  158 bits (400), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/179 (53%), Positives = 119/179 (66%), Gaps = 8/179 (4%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59
           ML++ DN+LR VN  F +I +GL   LI + K  H+SRVNFC+FAAA+GI  DS YGI A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
           N F P A+P             TFTA T LAVGIR HSC N+ YL+   KI QGS +RCR
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLD-SNKITQGSTSRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGA------FGAKLRRKHHTEVGVPSISQV 172
           +AQA+VAFFYF+  IFL KM+MS +S++SNGA      F ++ RR     VGVP+ISQV
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  155 bits (392), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 3/155 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 59
           ML + DN+ RI N  F +I  G+  +L+NT    HSSRVN+C+F  A+G+ +DS YGI A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFF-EPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 118
           N   EP A+P             TFTAGTVLAVGIR HSC NK Y  RE  I+QGS  RC
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEY-RRENYIIQGSERRC 119

Query: 119 RQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG 153
           R+AQA +AFFYFSM +FL K+++++V+  + G  G
Sbjct: 120 REAQACIAFFYFSMFLFLVKVLITLVTYFTGGELG 154

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  155 bits (391), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 123/184 (66%), Gaps = 13/184 (7%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS  DN LR  N +FL++ I   S+L++T+   SSRVN+C+FAAA+G+ TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FFEPL-AWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
             + L +WP             TFTAGTVLAVGIR HSCNN+RYLE   KI+QGSG RCR
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLE-SNKIIQGSGIRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA---KLRRKHHT--------EVGVPS 168
            +QA VAFFYF+  +FLAKMIMS +S+ SNGAFG+     RRK  +          GVP+
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPT 179

Query: 169 ISQV 172
           IS+V
Sbjct: 180 ISEV 183

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  154 bits (388), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 115/185 (62%), Gaps = 14/185 (7%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           ML +ADN+LR VN  F +IC+GL  SL+ T+ +HSSRVN+C+F   + + TD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FFE-PLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
            +  PLAWP             TFTAGTVLAVG R HSC N+ YL+    I QGS  RCR
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSN-NITQGSTDRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA------------KLRRKHHTEVGVP 167
           +AQA  AFFYFS  IFLAK+IMS +++ +NGA G+             +      ++GVP
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVP 179

Query: 168 SISQV 172
           +ISQV
Sbjct: 180 NISQV 184

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  147 bits (370), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSS-RVNFCLFAAAYGIATDSLYGIFA 59
           MLS+ DN LR +N  FL+I +GL  SL  T K H++ +VNF +F AA+G+  DSLY I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119
           NF   LAWP             TF A T LAV IR HSC N+ YL+  T + QGS  RCR
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNT-VTQGSTDRCR 119

Query: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           +AQA VAF YFS  IFLAK+ +S+V+++S GAFGA   R+    VGVP+ISQV
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTG-NVGVPTISQV 171

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  147 bits (371), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 79/159 (49%), Positives = 99/159 (62%), Gaps = 3/159 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59
           MLS   N+LRI+N  FL+I  G+   LI + KR HS RVN+C+FAA + + TDS Y I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFFE-PLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 118
           NF+  P AWP             TFTAGTVL+VGIR HSC NK YL    KI QGS  RC
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLF-SNKITQGSTERC 119

Query: 119 RQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLR 157
           R AQA +AF+YFS  I+L +++ S + +  NG F  + R
Sbjct: 120 RLAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEER 158

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  145 bits (365), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 107/172 (62%), Gaps = 2/172 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ DN LR  N VFL+I +GL  SL  TR  ++ +VNF +FAAA+G+  D+LY I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F   LAWP             TF A T LAV IR HSC N  Y++   K+ QGS  RCR+
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNN-KVTQGSSDRCRK 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
           AQA VAF YF+  +FL K+ +S+V+V S GAF     RK    VGVP+ISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRK-SANVGVPTISQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  118 bits (295), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 99/172 (57%), Gaps = 3/172 (1%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ DN LR  N +FLII + L  SLIN + R  SRVNF LF A + +  DSLY + AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F   LAWP             TF A T L   I  HSC+N  +L R   I +G   RCR+
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFL-RGNDISEGREGRCRK 119

Query: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172
            QA   F +FS  IFLAK ++S +++VS GAF +   RK  T  GVP+ISQV
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRK--TGGGVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  108 bits (270), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 71/123 (57%), Gaps = 1/123 (0%)

Query: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60
           MLS+ DN LR VN VFLII +GL  SLI+ ++   SRVNF LF A + + TDS Y I AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FFEPLAWPXXXXXXXXXXXXXTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120
           F    AWP             TF A T L   I AHSC+N+ +L+  T I + S  RCR+
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNT-ISEQSTDRCRK 119

Query: 121 AQA 123
            QA
Sbjct: 120 VQA 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,364,295
Number of extensions: 390365
Number of successful extensions: 1060
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1005
Number of HSP's successfully gapped: 33
Length of query: 172
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 70
Effective length of database: 41,785,467
Effective search space: 2924982690
Effective search space used: 2924982690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)