Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10472g3.494ON28828815120.0
Suva_7.4203.494ON28728313080.0
Smik_6.2283.494ON28728113020.0
YGR132C (PHB1)3.494ON28728812681e-178
NCAS0E007903.494ON32728512701e-177
NDAI0G009203.494ON29628812641e-177
SAKL0F02728g3.494ON28228712471e-174
Skud_7.4433.494ON28728412431e-174
KLTH0F14872g3.494ON28027612401e-173
TPHA0D032903.494ON28527912391e-173
Kpol_1017.53.494ON28327612251e-171
KAFR0C019803.494ON28328712221e-170
TDEL0D056203.494ON27928512131e-169
TBLA0D029503.494ON28227612041e-168
Kwal_55.212403.494ON28326611861e-165
ZYRO0D09900g3.494ON28327711541e-160
KNAG0B007903.494ON28428011531e-160
Ecym_12353.494ON28328211441e-159
AFR313C3.494ON28328710871e-150
KLLA0D16302g3.494ON2262089571e-131
KAFR0B042505.98ON3102347552e-99
TBLA0H022205.98ON3072317501e-98
Skud_7.5655.98ON3102317483e-98
ADL141W5.98ON3072347449e-98
Kwal_27.127475.98ON3072357422e-97
YGR231C (PHB2)5.98ON3102317422e-97
Kpol_1050.615.98ON3102317405e-97
Suva_7.5235.98ON3102317362e-96
Smik_16.755.98ON3102317352e-96
KLTH0C01672g5.98ON3072317325e-96
NDAI0D025305.98ON3162347336e-96
KNAG0A015805.98ON2882317245e-95
NCAS0F006005.98ON3132317259e-95
ZYRO0B15136g5.98ON3102317249e-95
SAKL0G15510g5.98ON3082317249e-95
TDEL0G012105.98ON3092347232e-94
CAGL0L06490g5.98ON3132317222e-94
TPHA0A050905.98ON3102317195e-94
KLLA0E15731g5.98ON3082317126e-93
TPHA0I013002.117ON37978711.7
YBR208C (DUR1,2)8.520ON1835274693.8
KLTH0F18546g7.518ON277779685.3
YNL137C (NAM9)2.129ON48661667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10472g
         (288 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   587   0.0  
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   508   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   506   0.0  
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   493   e-178
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     493   e-177
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     491   e-177
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   484   e-174
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   483   e-174
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   482   e-173
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   481   e-173
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   476   e-171
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   475   e-170
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   471   e-169
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   468   e-168
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   461   e-165
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   449   e-160
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   448   e-160
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   445   e-159
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   423   e-150
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   373   e-131
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   295   2e-99
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   293   1e-98
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   292   3e-98
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   291   9e-98
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   290   2e-97
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   290   2e-97
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   289   5e-97
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   288   2e-96
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   287   2e-96
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   286   5e-96
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   286   6e-96
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   283   5e-95
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   283   9e-95
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   283   9e-95
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   283   9e-95
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   283   2e-94
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   282   2e-94
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   281   5e-94
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   278   6e-93
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    32   1.7  
YBR208C Chr2 complement(636703..642210) [5508 bp, 1835 aa] {ON} ...    31   3.8  
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    31   5.3  
YNL137C Chr14 complement(368595..370055) [1461 bp, 486 aa] {ON} ...    30   7.5  

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL
Sbjct: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER
Sbjct: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP
Sbjct: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL
Sbjct: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGRS 288
           IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGRS
Sbjct: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGRS 288

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/283 (86%), Positives = 268/283 (94%), Gaps = 1/283 (0%)

Query: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65
           + F+ +ITKVA+P+G+  SGLQYSMYDV+GGSRGVIFDR+ GVK  VVGEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125
           KAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185
           GNEVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGPEFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245
           VEQKQIAQQDAERA+F+VEKAEQERQASVIRAEGEAESAEYISKAL+KVGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 246 ASKEIAQTLANSNNITYLPSNHAG-GDKDDKGSPNTLLLNLGR 287
           ASK+IAQTLANS+N+ YLPS HAG G+ +  GSPN+LLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/281 (86%), Positives = 266/281 (94%), Gaps = 1/281 (0%)

Query: 8   FVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKA 67
            + +ITKVA+P+GI  SG+QYSMYDV+GGSRGVIFDR+ GVK  VVGEGTHFLVPWLQKA
Sbjct: 7   LIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKA 66

Query: 68  IIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGN 127
           IIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSIGN
Sbjct: 67  IIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGN 126

Query: 128 EVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVE 187
           EVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGPEFTKAVE
Sbjct: 127 EVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVE 186

Query: 188 QKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEAS 247
           QKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLLIRRLEAS
Sbjct: 187 QKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEAS 246

Query: 248 KEIAQTLANSNNITYLPSNHAG-GDKDDKGSPNTLLLNLGR 287
           K+IAQTLANS+N+ YLPS H+G G+ +  GSPN+LLLN+GR
Sbjct: 247 KDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  493 bits (1268), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/288 (85%), Positives = 268/288 (93%), Gaps = 2/288 (0%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MS  A   + +ITKVA+P+GI  SG+QYSMYDV+GGSRGVIFDR+ GVK  VVGEGTHFL
Sbjct: 1   MSNSAK-LIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFL 59

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDER
Sbjct: 60  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDER 119

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGP
Sbjct: 120 VLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGP 179

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLL
Sbjct: 180 EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLL 239

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNH-AGGDKDDKGSPNTLLLNLGR 287
           IRRLEASK+IAQTLANS+N+ YLPS H  GG+ +  GSPN+LLLN+GR
Sbjct: 240 IRRLEASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  493 bits (1270), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/285 (83%), Positives = 263/285 (92%), Gaps = 1/285 (0%)

Query: 3   QQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVP 62
           QQ    + +IT+VA+P+GI  +GL+YSMYDV+GGSRGVIFDRL GV+  V+GEGTHFLVP
Sbjct: 44  QQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVP 103

Query: 63  WLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVL 122
           WLQKA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VL
Sbjct: 104 WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVL 163

Query: 123 PSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEF 182
           PSIGNEVLKSIVAQFDAAELITQREIVSQ+I+ ELS RA+EFGIRLEDVSITHMTFGPEF
Sbjct: 164 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEF 223

Query: 183 TKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIR 242
           TKAVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAEYISKAL+KVGDGLLLIR
Sbjct: 224 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 283

Query: 243 RLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           RLEASK+IAQTLANS NITYLP    GG  +D GSPN+LLLN+GR
Sbjct: 284 RLEASKDIAQTLANSPNITYLPGQQ-GGRGNDSGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  491 bits (1264), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 263/288 (91%), Gaps = 3/288 (1%)

Query: 3   QQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVP 62
           QQ   F  L+TKVA+P+G+ V+G+ YSMYDV+GGSRGVIFDRL GVKS VVGEGTHFLVP
Sbjct: 9   QQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVP 68

Query: 63  WLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVL 122
           WLQKA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VL
Sbjct: 69  WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVL 128

Query: 123 PSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEF 182
           PSIGNEVLKSIVAQFDAAELITQREIVSQ+I+ ELS RANEFG+RLEDVSITHMTFGPEF
Sbjct: 129 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEF 188

Query: 183 TKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIR 242
           TKAVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLLIR
Sbjct: 189 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 248

Query: 243 RLEASKEIAQTLANSNNITYLPS-NHAGGDKDDKG--SPNTLLLNLGR 287
           RLEASK+IAQTLANS N+TYLP  N   G   D G  SPN+LLLN+GR
Sbjct: 249 RLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  484 bits (1247), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/287 (82%), Positives = 264/287 (91%), Gaps = 5/287 (1%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MS+ A++  R    +A+P+GIA S LQYSMYDV+GG+R VIFDRL GV+  V+GEGTHFL
Sbjct: 1   MSKLADSLAR----IALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFL 56

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           VPWLQ+AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDER
Sbjct: 57  VPWLQRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDER 116

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLK+IVAQFDAAELITQREIVSQ+IR+ELS RA EF IRLEDVSITHMTFG 
Sbjct: 117 VLPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGR 176

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+YISKALSK GDGLLL
Sbjct: 177 EFTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLL 236

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           IRRLEASKEIAQTLANS+N+TYLPSN AGG  + +GSPN+LLLNLGR
Sbjct: 237 IRRLEASKEIAQTLANSSNVTYLPSNGAGG-AEQQGSPNSLLLNLGR 282

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  483 bits (1243), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 241/284 (84%), Positives = 265/284 (93%), Gaps = 1/284 (0%)

Query: 5   ANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWL 64
           A+  + +ITKVA+P+GI  +G+QY+MYDV+GGSRGVIFDR+ GVK  VVGEGTHFLVPWL
Sbjct: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 65  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPS 124
           QKAIIYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123

Query: 125 IGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTK 184
           IGNEVLKSIVAQFDAAELITQREI+SQKIR+ELS RANEFGI+LEDVSITHMTFGPEFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 185 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRL 244
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLLIRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 245 EASKEIAQTLANSNNITYLPSNH-AGGDKDDKGSPNTLLLNLGR 287
           EASK+IAQTLANS+N+ YLPS H   G  D  GSPN+LLLN+GR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  482 bits (1240), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/276 (83%), Positives = 257/276 (93%), Gaps = 3/276 (1%)

Query: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71
           + K+A+P+G+A S LQYSMYDV+GGSR VIFDRL GV+  VVGEGTHFLVPWLQKA++YD
Sbjct: 8   LAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYD 67

Query: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131
           VRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 68  VRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLK 127

Query: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191
           +IVAQFDAAELITQRE VSQ+IRQELS RA+EF IRLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 128 AIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQI 187

Query: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251
           AQQDAERAR++VE AEQERQASVIRAEGEAESAEYISKAL+K GDGLLLIRR+EASKEIA
Sbjct: 188 AQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIA 247

Query: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           +TLANS+N+TYLPS+H+     ++GSPN+LLLNLGR
Sbjct: 248 KTLANSSNVTYLPSSHSAS---EQGSPNSLLLNLGR 280

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  481 bits (1239), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/279 (83%), Positives = 260/279 (93%), Gaps = 2/279 (0%)

Query: 10  RLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAII 69
           RLI K+A+P+GIAVSG+QY+MYDV+GGSR VIFDRL GVK  V+GEGTHFL PWLQKAI+
Sbjct: 8   RLI-KIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIV 66

Query: 70  YDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEV 129
           +DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV QLP IYQNLGLDYDERVLPSIGNEV
Sbjct: 67  FDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEV 126

Query: 130 LKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQK 189
           LK+IVAQFDAAELITQREIVS KIR+ELS R+NEFGI+LEDVSITHMTFG EFTKAVEQK
Sbjct: 127 LKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQK 186

Query: 190 QIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKE 249
           QIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESAEYISKAL+K GDGLLLIRRLEASKE
Sbjct: 187 QIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLEASKE 246

Query: 250 IAQTLANSNNITYLPS-NHAGGDKDDKGSPNTLLLNLGR 287
           IA+TL+ S+N+TYLPS + + G+ +  G+PN+LLLNLGR
Sbjct: 247 IAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  476 bits (1225), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/276 (82%), Positives = 250/276 (90%)

Query: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71
           + KVA+P+GI VSG+Q+SMYDV+GGSR VIFDR+ GVK +++GEGTHFL+PWLQKAIIYD
Sbjct: 8   VAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYD 67

Query: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131
           VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV+QLP IYQNLGLDYDERVLPSI NEVLK
Sbjct: 68  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLK 127

Query: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191
           +IVAQFDAAELITQRE+VS +IR EL  R+NEFGIRLEDVSITHMTFG EFTKAVE KQI
Sbjct: 128 AIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQI 187

Query: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251
           AQQDAERA+FLVEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLEASKEIA
Sbjct: 188 AQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIA 247

Query: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
            TL+ S+N+TYLP+ H        G+PNTLLLNLGR
Sbjct: 248 ATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/287 (81%), Positives = 262/287 (91%), Gaps = 4/287 (1%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MS +A N V   TK+AIP G+ ++ + YSMYDV+GGSRGVIFDR+ GVK  V+GEGTHFL
Sbjct: 1   MSTRAINVV---TKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFL 57

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           VPWLQKAIIYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+V++LP IYQNLGLDYDER
Sbjct: 58  VPWLQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDER 117

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLKSIVAQFDAAELITQREIVSQ+IR+E+S+RANEFGI+LEDVSITHMTFG 
Sbjct: 118 VLPSIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGA 177

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAE ISKALS+VGDGLLL
Sbjct: 178 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLL 237

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           IRRLEASK+IA+TL+ S+NITYLP    G + D+K  PN+LLLN+GR
Sbjct: 238 IRRLEASKDIARTLSKSSNITYLPGGK-GREGDEKTPPNSLLLNIGR 283

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  471 bits (1213), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/285 (81%), Positives = 256/285 (89%), Gaps = 7/285 (2%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MS+   N  R    VAIP+GI VSG+QYSMYDV+GGSR VIFDRL GV+  VVGEGTHFL
Sbjct: 1   MSRLVENLAR----VAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFL 56

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           VPWLQKAI+YD+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP IYQNLGLDYDER
Sbjct: 57  VPWLQKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDER 116

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLK+IVAQFDAAELITQRE+VSQ+IR ELS+RA+EFGIRLEDVSITHMTFGP
Sbjct: 117 VLPSIGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGP 176

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQDAERA+FLVEKAEQ R+ASVIRAEGEAESAEYISKAL++ GDGLLL
Sbjct: 177 EFTKAVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLL 236

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNL 285
           IRRLEASKEIAQTLA S+NITYLP    G   + +GS N+LLLN+
Sbjct: 237 IRRLEASKEIAQTLAASSNITYLPGKAHG---NTEGSQNSLLLNI 278

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  468 bits (1204), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 224/276 (81%), Positives = 254/276 (92%), Gaps = 3/276 (1%)

Query: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71
           + K+AIP+G+ VS + YSMYDV+GGSR VIFDR+QGVK  VVGEGTHFLVPWLQK++I+D
Sbjct: 10  LAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFD 69

Query: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131
           +RTKPK+I TNTGT+DLQMVSLTLR+LHRPD++QLP+IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 70  IRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLK 129

Query: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191
           SIVAQFDAAELITQREIVSQ+IR+EL++RANEFGIRLEDVSITHMTFGPEFTKAVEQKQI
Sbjct: 130 SIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 189

Query: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251
           AQQDAERA+FLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SKEIA
Sbjct: 190 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIA 249

Query: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           +TLA S ++TYLP    GG++ +  S N+LLLNLGR
Sbjct: 250 ETLAGSPHVTYLP---GGGNQAEDASKNSLLLNLGR 282

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  461 bits (1186), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/266 (83%), Positives = 245/266 (92%)

Query: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65
           + F   + K+A+P+G+A S LQYSMYDV+GGSR VIFDRL GV+  VVGEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125
           KA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185
           GNEVLKSIVAQFDAAELITQRE VSQ+IRQELS RA+EF IRLEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245
           VEQKQIAQQDAERARF+VE AEQERQASVIRAEGEAESAEYISKAL+K GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 246 ASKEIAQTLANSNNITYLPSNHAGGD 271
           ASKEIA+TLANS+N+TYLPSN  G +
Sbjct: 242 ASKEIAKTLANSSNVTYLPSNQQGAE 267

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  449 bits (1154), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/277 (81%), Positives = 253/277 (91%), Gaps = 2/277 (0%)

Query: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71
           + KVAIP+GI  SG+QYSMYDV+GGSR VIFDRL GV+ +VVGEGTHFLVPWLQKA+IYD
Sbjct: 9   VAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYD 68

Query: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131
           VRTKPKSIATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 69  VRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLK 128

Query: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191
           +IVA++DAAELITQRE+VS  IR ELSNRA+EF IRLEDVSITHMTFGPEFTKAVE KQI
Sbjct: 129 AIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQI 188

Query: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251
           AQQDAERA+FLVEKAEQ R+ SVIRAEGEAE+AE ISKAL+K GDGLLLIRRLEASK+IA
Sbjct: 189 AQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLEASKDIA 248

Query: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGRS 288
           QTLANS+N+TYLPS  +GG ++  G+  +LLLNLGR+
Sbjct: 249 QTLANSSNVTYLPSQQSGGGQE--GTSQSLLLNLGRT 283

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  448 bits (1153), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/280 (81%), Positives = 255/280 (91%), Gaps = 1/280 (0%)

Query: 9   VRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAI 68
           + +++K+AIP G+ +    Y+MYDV+GGSRGVIFDR+ GV+  VVGEGTHFLVPWLQKAI
Sbjct: 5   INVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAI 64

Query: 69  IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNE 128
           IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPSIGNE
Sbjct: 65  IYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNE 124

Query: 129 VLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQ 188
           VLKSIVAQFDAAELITQRE+VSQ+IR+ELS RA EFGIRLEDVSITHMTFG EFTKAVEQ
Sbjct: 125 VLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQ 184

Query: 189 KQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASK 248
           KQIAQQDAERA+FLVEKAEQ RQASVIRAEGEAESAE ISKAL+KVGDGLLLIRRLEASK
Sbjct: 185 KQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLEASK 244

Query: 249 EIAQTLANSNNITYLPSNHAGGDKD-DKGSPNTLLLNLGR 287
           EIA+TL+ S+N+TYLPS  AGG    + GS NTLLLN+GR
Sbjct: 245 EIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  445 bits (1144), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 250/282 (88%)

Query: 6   NNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQ 65
           + F+  I  +A+P+G+A+   Q  +YDV+GG+R VIFDRL GV+  VVGEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 66  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSI 125
           KA+IYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV+ LP IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 126 GNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKA 185
           GNEVLK+IVAQFDAAELITQRE+VSQKIRQEL+ RA+ F I+LEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 186 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLE 245
           VE+KQIAQQ++ERA++LV+ AEQER A+VIRAEG+AE+AEYISKAL+K GDGLL+IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 246 ASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           ASK+IAQTLA S+NITYLPS+  GG  D  G+P++LLLNLGR
Sbjct: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  423 bits (1087), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/287 (74%), Positives = 253/287 (88%), Gaps = 4/287 (1%)

Query: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60
           MS+ A++ VRL   +  P+ +A S +Q+SMYDV+GG+R +IFDR+ GVK DVVGEGTHFL
Sbjct: 1   MSRLADSLVRLTLPLT-PIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFL 59

Query: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120
           +PWLQKAII+DVRTKP++IATNTGTKDLQMVSLTLRVLHRPDVM L  IY+ LG DYDER
Sbjct: 60  IPWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDER 119

Query: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180
           VLPSIGNEVLK+IVAQF+A+ELITQRE+VSQ+IR EL+ RA+EF IRLEDVSITHMTFG 
Sbjct: 120 VLPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQ 179

Query: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240
           EFTKAVEQKQIAQQ+++RA+F+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+
Sbjct: 180 EFTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLM 239

Query: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287
           IRRLEASK IA+TLANS N+TYLPS    G   D G+PN+LLLNLGR
Sbjct: 240 IRRLEASKGIAETLANSPNVTYLPSK---GQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  373 bits (957), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/208 (84%), Positives = 196/208 (94%)

Query: 11  LITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIY 70
           ++ ++AIPVG+ VS +QYSMYDV+GG R VIFDRLQGV+  V+GEGTHFLVPWLQK+I++
Sbjct: 7   VMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILF 66

Query: 71  DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVL 130
           DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVMQLP IYQNLG+DYDERVLPSIGNEVL
Sbjct: 67  DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVL 126

Query: 131 KSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQ 190
           K+IVAQFDAAELITQREIVSQ+IR ELS RA+EF I+LEDVSITHMTFG EFTKAVEQKQ
Sbjct: 127 KAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQ 186

Query: 191 IAQQDAERARFLVEKAEQERQASVIRAE 218
           IAQQDAERARFLVEKAEQER+A+VIRAE
Sbjct: 187 IAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  295 bits (755), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 188/234 (80%), Gaps = 1/234 (0%)

Query: 26  LQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 85
           LQ S+++V GG R +++ R+ GV S +  EGTHF++PWL+  I+YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 86  KDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 145
           KDLQMV++T RVL RPDV  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 146 REIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEK 205
           RE VS+ IR+ L  RA++F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 206 AEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA+ LANS N
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPN 285

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  293 bits (750), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           S+++V GG R +++ RL GV S +  EGTHF++PWLQ  IIYDVR KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPD+  LPLIY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ SK+IA+ LA S+N
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  292 bits (748), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 140/231 (60%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV S +  EGTHF+ PWL   IIYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP+IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  291 bits (744), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 138/234 (58%), Positives = 185/234 (79%), Gaps = 1/234 (0%)

Query: 26  LQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 85
           L  S+++V GG R +++ RL GV+  V GEGTHF++PWL+  ++YDVR+KP+++++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 86  KDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 145
            DLQMV++T RVL RPDV  LPLIY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 146 REIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEK 205
           RE VS+ IR  L  RA+ F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEK
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 206 AEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           A+QE+Q+ +++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA  LA S N
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 138/235 (58%), Positives = 186/235 (79%), Gaps = 1/235 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           S+++V GG R +++ RL GV+S +  EGTHF +PWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNNITYL 263
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA  L++S N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV S +  EGTHF+ PWL   IIYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  289 bits (740), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV S +  EGTHF++PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L NRA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA  LA S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPN 289

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  288 bits (736), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 138/231 (59%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ RL GV + +  EGTHF+ PW+   IIYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPN 286

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  287 bits (735), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV + +  EGTHF+ PWL   I+YDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  286 bits (732), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           S+++V GG R +I+ RL GV+S +  EGTHF +PW +  I+YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V QLP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA  L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  286 bits (733), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 181/234 (77%), Gaps = 1/234 (0%)

Query: 26  LQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 85
           L  ++++V GG R +++ R+ GV   +  EGTHF +PW++  IIYDVR KP+++A+ TGT
Sbjct: 59  LNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGT 118

Query: 86  KDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 145
           KDLQMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 119 KDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 178

Query: 146 REIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEK 205
           RE VS+ IR+ L  RAN F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 179 REKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 238

Query: 206 AEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           A QE+Q  V+RA+GEA+SAE I  A+ K  D + L +RL+ ++EIA+ LA S N
Sbjct: 239 ARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPN 291

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  283 bits (724), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV   +  EGTHF++PWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP +Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A GEA+SAE I +A+ K  D + L +RL+ +KEIA  LA S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPN 264

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  283 bits (725), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 180/231 (77%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           S+++V GG R +++ R+ GV   +  EGTHF++PW++  IIYDVR KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  R++ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ ++EIA  LA S N
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPN 288

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  283 bits (724), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV S +  EGTH L+PW +  ++YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RPDV QLP+IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+G+A+SAE I +A+ K  D + L +RL+ ++EIAQ L+ S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  283 bits (724), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ G++  +  EGTHF VPWL+  I+YDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA+ L+ S N
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  283 bits (723), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 183/234 (78%), Gaps = 1/234 (0%)

Query: 26  LQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGT 85
           L  ++++V GG R +++ R+ GV S +  EGTH ++PWL+  ++YDVR KP+++A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 86  KDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 145
           KDLQMV++T RVL RP+V QLP IY+ LG DY ERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 146 REIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEK 205
           RE VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 206 AEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++EIAQ LA S N
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  282 bits (722), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV   +  EGTH ++PW++  I+YDVR KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR  L  RA+ F I L+DVSIT+MTF PEFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I  A+ K  D + L +RL+ +K+IA+ LANS N
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSPN 288

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  281 bits (719), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV + +  EGTHF++PW++  +IYDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +K+IA  LA S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  278 bits (712), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 29  SMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDL 88
           ++++V GG R +++ R+ GV+  +  EGTHF++PW++  ++YDVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 89  QMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 148
           QMV++T RVL RP+V  LP+IY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 149 VSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQ 208
           VS+ IR+ L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 209 ERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNN 259
           E+Q  +++A+GEA+SAE I +A+ K  D + L +RL+ ++EIA  L+ S N
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPN 287

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 59  FLVPWLQKAIIYDVRTKPKSIATN---TGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGL 115
           F +P  +   I +VR +   +  N    G +   +  +  + L R D+   P++Y++L L
Sbjct: 246 FKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVL 305

Query: 116 DYDERVLPSIGNEVLKSI 133
           +    VLP  GN +LK +
Sbjct: 306 NGGTTVLPGFGNRILKEL 323

>YBR208C Chr2 complement(636703..642210) [5508 bp, 1835 aa] {ON}
            DUR1,2Urea amidolyase, contains both urea carboxylase and
            allophanate hydrolase activities, degrades urea to CO2
            and NH3; expression sensitive to nitrogen catabolite
            repression and induced by allophanate, an intermediate in
            allantoin degradation
          Length = 1835

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 110/274 (40%), Gaps = 41/274 (14%)

Query: 32   DVQGGSRGVIFDRLQGVKSDVVGEGTHFL-----VPWLQKAIIYDVRTKPKSIATNTGTK 86
            +V G SR  ++D L   +  V+G G  FL     VP   +      +  P    T  G  
Sbjct: 1564 NVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTERGAV 1623

Query: 87   DLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 146
             +  + + +   + P   Q  L+ + + + +D+  L +  +EV   ++  FD  E     
Sbjct: 1624 GIGGMYMCIYAANSPGGYQ--LVGRTIPI-WDKLCL-AASSEV-PWLMNPFDQVEFYPVS 1678

Query: 147  EIVSQKIRQELSNRANEFGIRLEDVSITHMTF------GPEFTKAVEQKQIAQQDAERAR 200
            E    K+ ++  N    + + +E     H  +        +   A ++ Q+ ++  E A+
Sbjct: 1679 EEDLDKMTEDCDNGV--YKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAK 1736

Query: 201  FLVEKAEQERQASVIRAEGEAES---------AEY---ISKALSKVGD------GLLLIR 242
             L++ A  E + SV     E E          +EY     K+++ VGD      GLL+I 
Sbjct: 1737 -LIQNANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIE 1795

Query: 243  RLEASKEIAQTLANSNNITYLPSNHAGGDKDDKG 276
             ++A  E+  +   S  I  +   H  GD  D G
Sbjct: 1796 AMKA--EMIISAPKSGKIIKI--CHGNGDMVDSG 1825

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 166 IRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAE 225
           I+L DVSI++     + TK++E     Q+ AER+     ++ ++   + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIES-AYQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 226 YISKALSKVGDGLLLIRRL 244
           YI   L K  D + +  R 
Sbjct: 252 YIKSLLLKASDFVTMFDRF 270

>YNL137C Chr14 complement(368595..370055) [1461 bp, 486 aa] {ON}
           NAM9Mitochondrial ribosomal component of the small
           subunit
          Length = 486

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 32/61 (52%)

Query: 127 NEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAV 186
           NE  K  ++    + L + + I+++ ++    N  + F  R+ D+S   +TF P++ K +
Sbjct: 321 NETTKKELSDGAKSALRSGKRIIAESVKLWTKNITDHFKTRMSDISDGSLTFDPKWAKNL 380

Query: 187 E 187
           +
Sbjct: 381 K 381

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,855,880
Number of extensions: 1041175
Number of successful extensions: 3766
Number of sequences better than 10.0: 72
Number of HSP's gapped: 3888
Number of HSP's successfully gapped: 72
Length of query: 288
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 180
Effective length of database: 41,097,471
Effective search space: 7397544780
Effective search space used: 7397544780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)