Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I10450g3.495ON1621628471e-117
Skud_7.4443.495ON1621664348e-55
YGR133W (PEX4)3.495ON1831644281e-53
Smik_6.2293.495ON1651644234e-53
Suva_7.4213.495ON1651644225e-53
NDAI0G009103.495ON1631654131e-51
ZYRO0D09878g3.495ON1531594052e-50
SAKL0F02706g3.495ON1611573991e-49
NCAS0E007803.495ON1711733923e-48
TPHA0D042603.495ON1581583887e-48
TDEL0D056303.495ON1501563808e-47
TBLA0C045003.495ON1651643636e-44
KLTH0F14894g3.495ON1661563619e-44
Kwal_55.212463.495ON1601563488e-42
Kpol_480.133.495ON1571563411e-40
AFR314W3.495ON1551682957e-34
KAFR0C019903.495ON1511572912e-33
Ecym_12343.495ON1611612871e-32
KNAG0B007803.495ON1531512852e-32
KLLA0E04027g3.495ON1581602662e-29
YOR339C (UBC11)7.54ON1561582332e-24
Skud_15.5047.54ON1561582313e-24
Smik_15.5177.54ON1561412296e-24
Suva_8.3897.54ON1561582219e-23
NDAI0E038707.54ON1641462183e-22
TDEL0H039707.54ON1561462081e-20
ZYRO0D04466g7.54ON1591482028e-20
KNAG0A048108.375ON2141362005e-19
TPHA0L008508.375ON2161351962e-18
KLTH0D01760g7.54ON1611601905e-18
KLTH0A07546g8.375ON2151361935e-18
ZYRO0C03784g8.375ON2181361936e-18
KLTH0H06732g6.109ON1601201888e-18
NCAS0B031508.375ON2141361919e-18
NCAS0D032206.109ON1711071899e-18
Kpol_1065.127.54ON1591391889e-18
Kwal_23.64858.375ON2151361911e-17
Kpol_461.86.109ON1671071871e-17
Kwal_14.18286.109ON1521201861e-17
KAFR0C002703.308ON1471511842e-17
ZYRO0C04950g6.109ON1681071853e-17
Suva_4.3263.308ON1481511843e-17
YGL058W (RAD6)6.109ON1721071853e-17
Smik_7.2226.109ON1711071853e-17
Suva_7.2136.109ON1731071853e-17
CAGL0I00352g6.109ON1671381853e-17
TDEL0G036106.109ON1691071853e-17
AAR156C6.109ON1701071853e-17
SAKL0A07260g6.109ON1691071854e-17
Kpol_1030.108.375ON2151361874e-17
Ecym_30776.109ON1701071854e-17
CAGL0E00671g8.375ON2131361874e-17
KNAG0F025706.109ON1511061825e-17
TPHA0J017506.109ON1691071835e-17
KLLA0C18656g8.375ON2281331866e-17
KAFR0A047006.109ON1531071826e-17
TBLA0F024406.109ON1741411836e-17
NDAI0I016506.109ON1761071838e-17
KLLA0C05632g6.109ON1641071828e-17
NDAI0A011608.375ON2161361841e-16
SAKL0B10582g7.54ON1611581801e-16
Kwal_26.70097.54ON1611581802e-16
Skud_2.2073.308ON1481511772e-16
Smik_2.2193.308ON1481511772e-16
YBR082C (UBC4)3.308ON1481511772e-16
Skud_7.2226.109ON1701071783e-16
TBLA0H031308.375ON2141521813e-16
KAFR0B060608.375ON2131361803e-16
ADR169C8.375ON2111371795e-16
Ecym_60388.375ON2111371796e-16
Ecym_74313.308ON1471531748e-16
KLTH0E14300g3.308ON1471531749e-16
SAKL0B06512g3.308ON1471531749e-16
AER173C3.308ON1471531749e-16
SAKL0A00396g8.375ON2151381789e-16
CAGL0E04752g3.308ON1471511749e-16
TDEL0F021003.308ON1471531731e-15
Suva_2.2183.308ON1481511731e-15
Skud_4.3143.308ON1481511731e-15
YDR059C (UBC5)3.308ON1481511731e-15
Suva_2.3438.375ON2151361762e-15
Smik_4.4258.375ON2151361762e-15
Skud_4.4418.375ON2151361762e-15
Smik_4.2973.308ON1481511722e-15
YDR177W (UBC1)8.375ON2151361752e-15
NDAI0A054903.308ON1471511712e-15
KLLA0E12563g3.308ON1481531712e-15
NCAS0A108003.308ON1481511712e-15
TBLA0I021303.308ON1481431712e-15
ZYRO0G12870g3.308ON1471531713e-15
TDEL0F049908.375ON2171361743e-15
ZYRO0B11682g8.230ON1511131703e-15
KNAG0J023403.308ON1611271713e-15
TPHA0A038503.308ON1481431695e-15
Kpol_1052.23.308ON1481531687e-15
KAFR0A024208.230ON1471221677e-15
NDAI0J015408.230ON1541171661e-14
CAGL0G08063g8.230ON1491031661e-14
Kwal_56.234828.230ON1491111661e-14
Suva_2.2538.230ON1431171651e-14
SAKL0H17930g8.230ON1531171652e-14
AGR121C8.230ON1541081652e-14
Smik_4.3358.230ON1431171642e-14
YDR092W (UBC13)8.230ON1531171643e-14
KLTH0G14366g8.230ON1491131624e-14
Kwal_27.124013.308ON2361271675e-14
Skud_4.3528.230ON1431171625e-14
NCAS0B040108.230ON1531161625e-14
KLTH0H13816g1.436ON2331341657e-14
TBLA0A012901.436ON2191391648e-14
Kwal_34.161741.436ON2131291631e-13
KLLA0C17622g8.230ON1591071601e-13
Ecym_55638.230ON1641031601e-13
Kpol_1075.1b8.230ON1521171592e-13
SAKL0D10560g1.436ON2071281612e-13
CAGL0M03399g1.436ON2141291612e-13
TPHA0B034108.230ON1521131582e-13
KLLA0A11198g1.436ON2021231602e-13
TBLA0F037908.230ON1511131573e-13
Kpol_1030.181.436ON2231331604e-13
KNAG0H029808.230ON1521071555e-13
TDEL0A013408.230ON1571031555e-13
TPHA0O009201.436ON2261331586e-13
AEL045W1.436ON2111231586e-13
KAFR0H029601.436ON1871331551e-12
KNAG0H018701.436ON2101291561e-12
NCAS0G031301.436ON2311271561e-12
NDAI0D011401.436ON2451351562e-12
Ecym_13481.436ON2111171542e-12
TDEL0B056701.436ON2031271533e-12
YEL012W (UBC8)1.436ON2181381524e-12
Suva_5.531.436ON2151381524e-12
Smik_5.981.436ON2151381524e-12
ZYRO0E06358g2.569ON1651531496e-12
Skud_5.871.436ON2101381508e-12
ZYRO0E03806g1.436ON2091271508e-12
KAFR0H012303.308ON1101111394e-11
KAFR0F030404.49ON1691211434e-11
TBLA0H026102.569ON1651661419e-11
KNAG0M021502.569ON1701451401e-10
ABR059W2.569ON1651531391e-10
CAGL0M07568g2.569ON1651531382e-10
Kpol_1056.52.569ON1651291373e-10
KLLA0E07745g2.569ON1651531373e-10
TDEL0B065702.569ON1651291364e-10
Ecym_45782.569ON1651531355e-10
TPHA0I024602.569ON1671291356e-10
TBLA0E015704.49ON1941001341e-09
SAKL0D13552g2.569ON1651511321e-09
Suva_13.1892.569ON1651531321e-09
NCAS0A059404.49ON1931291332e-09
Smik_13.1862.569ON1651531312e-09
YMR022W (UBC7)2.569ON1651531312e-09
Skud_13.1762.569ON1651531312e-09
Kwal_26.82242.569ON1651531312e-09
TPHA0B007704.249ON1571331285e-09
NCAS0A127402.569ON1651531285e-09
NDAI0B015202.569ON1651531286e-09
KLTH0D07986g2.569ON1651691278e-09
KAFR0A021602.569ON1651531269e-09
Smik_4.1714.249ON1571361261e-08
YDL064W (UBC9)4.249ON1571331224e-08
Suva_4.1864.249ON1571331215e-08
Skud_4.1914.249ON1571331216e-08
KLTH0H09504g4.49ON1841421217e-08
Skud_12.3894.49ON1871341217e-08
Smik_12.3894.49ON187981209e-08
TDEL0C015507.392ON248961229e-08
SAKL0H24112g4.49ON185901201e-07
TBLA0I029604.249ON1571331181e-07
CAGL0D06468g4.49ON1871141191e-07
KAFR0G032404.249ON1571331172e-07
KNAG0I029404.49ON197881182e-07
SAKL0H03058g4.249ON1571361162e-07
NCAS0I014303.301ON2581741192e-07
TDEL0E055604.49ON1871171172e-07
KLLA0E20395g7.392ON2511191184e-07
KLLA0E05039g4.249ON1571331144e-07
NCAS0D036606.187ON138941134e-07
Skud_5.2257.392ON250961175e-07
YLR306W (UBC12)4.49ON1881101155e-07
SAKL0A05192g6.187ON140971135e-07
KLLA0C17248g4.49ON1841381155e-07
KLLA0D09196g3.301ON2921301166e-07
KNAG0D043904.249ON1571341137e-07
TPHA0K008207.392ON2571161157e-07
CAGL0D00814g4.249ON1571361137e-07
NDAI0D043804.249ON1571361129e-07
Kwal_27.104443.301ON2781581151e-06
ZYRO0G08228g6.187ON138941101e-06
KLTH0C04818g3.301ON2751551141e-06
Ecym_32704.249ON1571361111e-06
KLTH0D14344g4.249ON1571331111e-06
Smik_5.2467.392ON250961131e-06
CAGL0H03157g6.187ON139941101e-06
Ecym_83714.49ON267981132e-06
Kpol_483.164.249ON1221001082e-06
ZYRO0B12386g4.249ON1571361102e-06
TPHA0J022506.187ON1371251092e-06
Kpol_1045.397.392ON253961122e-06
TDEL0E012204.249ON1571481092e-06
Suva_5.2197.392ON249961113e-06
YER100W (UBC6)7.392ON250961113e-06
Kpol_414.2singletonOFF1921151093e-06
Kpol_YGOB_414.24.49ON1931151093e-06
TPHA0F003904.49ON1931001093e-06
Suva_10.4014.49ON1871031084e-06
AER056C4.249ON1571361075e-06
Kwal_23.42274.249ON1221001055e-06
SAKL0F12474g7.392ON2511161086e-06
TDEL0D032603.301ON2891551087e-06
TPHA0M012803.301ON4351491088e-06
NCAS0A143907.392ON240961078e-06
ADL035C4.49ON200971069e-06
TDEL0G015806.187ON138941049e-06
NCAS0A024904.249ON1571331051e-05
NCAS0A107703.301ON2731551071e-05
TBLA0D006007.392ON256921071e-05
AGL203C3.301ON2701551071e-05
Skud_4.3063.301ON2971551071e-05
Smik_4.2903.301ON2971551061e-05
Kpol_1065.453.301ON3231491061e-05
Ecym_46837.392ON243921061e-05
YDR054C (CDC34)3.301ON2951551061e-05
KNAG0B023607.392ON251921061e-05
Suva_7.1826.187ON1371101022e-05
NDAI0A075703.301ON2391131052e-05
NDAI0A055303.301ON2731551052e-05
CAGL0E04598g3.301ON2951551052e-05
SAKL0D02530g3.301ON2721551052e-05
Ecym_26693.301ON2681551052e-05
KLTH0H04796g6.187ON1381091022e-05
NDAI0A016507.392ON2511161042e-05
KAFR0L017507.392ON251921042e-05
TBLA0G032703.301ON3301551052e-05
CAGL0I05478g7.392ON246961042e-05
KNAG0H010403.301ON2961551042e-05
AGR372W7.392ON2421161042e-05
ZYRO0B03344g7.392ON250961043e-05
Suva_2.2113.301ON2971551033e-05
NDAI0I012306.187ON157941013e-05
ZYRO0G12650g3.301ON2851551034e-05
NCAS0E026007.392ON255961024e-05
KAFR0H012703.301ON2871491024e-05
KLTH0C06688g7.392ON2461191024e-05
Kwal_27.108377.392ON246961007e-05
NDAI0D029104.49ON189100999e-05
AFL064W6.187ON138109979e-05
KLLA0E19119g6.187ON13994961e-04
NDAI0E041707.392ON25796991e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I10450g
         (162 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   330   e-117
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   171   8e-55
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   169   1e-53
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   167   4e-53
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   167   5e-53
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   163   1e-51
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   160   2e-50
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   158   1e-49
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   155   3e-48
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   154   7e-48
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   150   8e-47
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   144   6e-44
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   143   9e-44
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   138   8e-42
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   135   1e-40
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   118   7e-34
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   116   2e-33
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   115   1e-32
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   114   2e-32
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   107   2e-29
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    94   2e-24
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    94   3e-24
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    93   6e-24
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    90   9e-23
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    89   3e-22
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    85   1e-20
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    82   8e-20
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    82   5e-19
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    80   2e-18
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    78   5e-18
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    79   5e-18
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    79   6e-18
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    77   8e-18
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      78   9e-18
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      77   9e-18
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    77   9e-18
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    78   1e-17
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    77   1e-17
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    76   1e-17
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    75   2e-17
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    76   3e-17
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    75   3e-17
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    76   3e-17
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    76   3e-17
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    76   3e-17
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    76   3e-17
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    76   3e-17
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    76   3e-17
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    76   4e-17
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    77   4e-17
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    76   4e-17
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    77   4e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    75   5e-17
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    75   5e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    76   6e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   6e-17
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    75   6e-17
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      75   8e-17
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    75   8e-17
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      75   1e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    74   1e-16
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    74   2e-16
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    73   2e-16
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    73   2e-16
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    73   2e-16
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    73   3e-16
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    74   3e-16
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    74   3e-16
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    74   5e-16
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    74   6e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    72   8e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    72   9e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    72   9e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    72   9e-16
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    73   9e-16
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    72   9e-16
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    71   1e-15
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    71   1e-15
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    71   1e-15
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    71   1e-15
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    72   2e-15
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    72   2e-15
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    72   2e-15
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    71   2e-15
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    72   2e-15
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    70   2e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    70   2e-15
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    70   2e-15
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    70   2e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    70   3e-15
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    72   3e-15
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    70   3e-15
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    70   3e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    70   5e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    69   7e-15
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    69   7e-15
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    69   1e-14
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    69   1e-14
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    69   1e-14
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    68   1e-14
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    68   2e-14
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    68   2e-14
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    68   2e-14
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    68   3e-14
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    67   4e-14
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    69   5e-14
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    67   5e-14
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    67   5e-14
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    68   7e-14
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    68   8e-14
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    67   1e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    66   1e-13
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    66   1e-13
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    66   2e-13
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    67   2e-13
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    67   2e-13
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    65   2e-13
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    66   2e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    65   3e-13
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    66   4e-13
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    64   5e-13
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    64   5e-13
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    65   6e-13
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    65   6e-13
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    64   1e-12
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    65   1e-12
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                65   1e-12
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    65   2e-12
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    64   2e-12
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    64   3e-12
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    63   4e-12
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    63   4e-12
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    63   4e-12
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    62   6e-12
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    62   8e-12
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    62   8e-12
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    58   4e-11
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    60   4e-11
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    59   9e-11
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    59   1e-10
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    58   1e-10
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    58   2e-10
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    57   3e-10
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    57   3e-10
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    57   4e-10
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    57   5e-10
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    57   6e-10
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    56   1e-09
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    55   1e-09
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    55   1e-09
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     56   2e-09
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    55   2e-09
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    55   2e-09
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    55   2e-09
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    55   2e-09
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    54   5e-09
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    54   5e-09
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    54   6e-09
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    54   8e-09
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    53   9e-09
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    53   1e-08
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    52   4e-08
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    51   5e-08
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    51   6e-08
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    51   7e-08
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    51   7e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    51   9e-08
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    52   9e-08
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    51   1e-07
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    50   1e-07
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    50   1e-07
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    50   2e-07
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    50   2e-07
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    49   2e-07
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                50   2e-07
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    50   2e-07
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    50   4e-07
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    49   4e-07
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    48   4e-07
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    50   5e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    49   5e-07
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    48   5e-07
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    49   5e-07
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    49   6e-07
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    48   7e-07
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    49   7e-07
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    48   7e-07
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    48   9e-07
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    49   1e-06
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    47   1e-06
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    49   1e-06
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    47   1e-06
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    47   1e-06
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    48   1e-06
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    47   1e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    48   2e-06
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    46   2e-06
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    47   2e-06
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    47   2e-06
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    48   2e-06
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    47   2e-06
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    47   3e-06
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    47   3e-06
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    47   3e-06
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    47   3e-06
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    47   3e-06
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    46   4e-06
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    46   5e-06
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    45   5e-06
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    46   6e-06
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    46   7e-06
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    46   8e-06
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    46   8e-06
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    45   9e-06
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    45   9e-06
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    45   1e-05
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    46   1e-05
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    46   1e-05
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    46   1e-05
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    46   1e-05
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    45   1e-05
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    45   1e-05
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    45   1e-05
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    45   1e-05
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    45   1e-05
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    44   2e-05
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    45   2e-05
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    45   2e-05
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    45   2e-05
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    45   2e-05
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    45   2e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    44   2e-05
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    45   2e-05
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    45   2e-05
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    45   2e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    45   2e-05
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                45   2e-05
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    45   2e-05
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    45   3e-05
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    44   3e-05
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    44   3e-05
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    44   4e-05
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    44   4e-05
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                44   4e-05
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    44   4e-05
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    43   7e-05
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       43   9e-05
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    42   9e-05
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    42   1e-04
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    43   1e-04
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    41   2e-04
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    40   4e-04
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    40   5e-04
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    40   7e-04
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    40   7e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    38   0.002
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    36   0.012
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    35   0.018
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    35   0.018
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    35   0.021
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    35   0.031
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    29   4.8  
SAKL0D06380g Chr4 complement(522001..524490) [2490 bp, 829 aa] {...    28   8.5  

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  330 bits (847), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/162 (100%), Positives = 162/162 (100%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH
Sbjct: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162
           ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP
Sbjct: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  171 bits (434), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 109/166 (65%), Gaps = 12/166 (7%)

Query: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54
           M+RI+KE   I+K L   D         +  L P+D++DLS+W A+I GP  TPY  Y F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114
           ++ I+VP+SYPM PP I+F  +         HCN+   TGEICLDILKPE W+P+WD+LH
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNIL------HCNIKSPTGEICLDILKPEDWTPVWDLLH 114

Query: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
            V AI  LL+EPV DSPLDVDM NI++  D  AY GIIRYFL E D
Sbjct: 115 CVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERD 160

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  169 bits (428), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (67%), Gaps = 12/164 (7%)

Query: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54
           M+RI KE   I K L   D         +  L P+D++DLS+W A+I GP++TPY  ++F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114
           ++ IEVP+SYPM PP I F+ +         HCNV   TGEICL+ILKPE W+P+WD+LH
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNIL------HCNVKSATGEICLNILKPEEWTPVWDLLH 132

Query: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
            V A+  LL+EPV DSPLDVD+ NI++  DMSAY GI++YFL E
Sbjct: 133 CVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  167 bits (423), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54
           M+RI+KE   I K L   D         +  L P+D++DLSRW A I GP+ TPY  Y+F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114
            + I+VP+SYPM PP I F  +         HCNV   TGEICLDILKPE W+P+WD+LH
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDIL------HCNVKSATGEICLDILKPEDWTPVWDLLH 114

Query: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
            V A+  LL+EPV DSPLDVDM NI++  D SAY GI++YFL E
Sbjct: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAE 158

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  167 bits (422), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (64%), Gaps = 12/164 (7%)

Query: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54
           M+RI+KE   IRK L   D         +  L P D++DLS+W A I GP  TPY  Y+F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114
           ++ I+VP SYPM PP I F  DA        HCN++  TGEICLDILK + W+P+WD+LH
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAIL------HCNINSSTGEICLDILKLQDWTPVWDLLH 114

Query: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
            V A+  LL+EPV DSPLDVDM NI++  D  AY GI++YFL E
Sbjct: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  163 bits (413), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 113/165 (68%), Gaps = 14/165 (8%)

Query: 1   MARISKELLKIRKALEHG----DSEF---LVDLAPVD-DSDLSRWFAVIKGPAETPYYPY 52
           M+RI KE   I+K L +     D EF   +V LAP+D D DL++W AVIKGP  TPYY +
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 53  EFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDI 112
            F L I +P  YP VPP  +F        R  PHCNV+  TGEICLDILK + W+P+W++
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQP------RSMPHCNVNYNTGEICLDILKQDHWTPVWNL 114

Query: 113 LHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157
           +  ++AI +LL++PVP+SPL+VD+AN+L+  D+SAYNG+I Y+L 
Sbjct: 115 MSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  160 bits (405), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 11/159 (6%)

Query: 1   MARISKELLKIRKALEHGD---SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLA 57
           M+R +KE   I K L+ GD   S+ +V + P +D  L+RW A+I+GP+ TPY    F+L 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKED--LTRWEALIRGPSGTPYEGCNFRLH 58

Query: 58  IEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ 117
           + +P  YPM PP +KF   A       PH NVD RTGEICLDIL  + WSP WD+LHVVQ
Sbjct: 59  LSLPQEYPMSPPYVKFEPYAM------PHANVDFRTGEICLDILTKQHWSPAWDLLHVVQ 112

Query: 118 AIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156
           AI  LL EPV  SPL+VD+ANILK NDM+AY G++ Y++
Sbjct: 113 AIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  158 bits (399), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (66%), Gaps = 4/157 (2%)

Query: 1   MARISKELLKIRKALEHGDS-EFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + RI+KE   +RK L    S   ++ L P D  ++  W A I GP ETPY    F L +E
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAI 119
           +P  YP+ PP +KF+  ++  I    HCNVD +TGEICLDIL  E WSP+WD++HV+ AI
Sbjct: 63  LPIQYPLEPPRVKFLPGSRNNIC---HCNVDFKTGEICLDILTREHWSPVWDLVHVIHAI 119

Query: 120 HILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156
            ILL EPVP+SPL+VD+AN+LK  D+ AY G+I+Y++
Sbjct: 120 WILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  155 bits (392), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 112/173 (64%), Gaps = 17/173 (9%)

Query: 1   MARISKELLKIRKAL--------EHGDSEF---LVDLAPVDDSDLSRWFAVIKGPAETPY 49
           M+R+ KE  KI+  L         + D EF   +  L P+  SDL+ W A IKGP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 50  YPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPI 109
             +EF+L IE P +YP+ PP I F   +       PHCNV+ +TG ICLDIL+ + W+P 
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSM------PHCNVNFQTGAICLDILEKQHWTPA 114

Query: 110 WDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162
           W+++  ++AI ILL++PVPDSPL+VD+ANIL+ ND SAYNG++ Y+L+   SP
Sbjct: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  154 bits (388), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 77/158 (48%), Positives = 108/158 (68%), Gaps = 7/158 (4%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + R+ KE   I K L  G SE +  L PV   +  +W AV+KGP  TPY+ + FKL IE+
Sbjct: 3   LKRLLKEKRLIEKELS-GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P+ YP+VPP I F   +       PHCNV+  TG+ICL+IL+ E WSP+W++++V+ A++
Sbjct: 62  PSEYPLVPPAITFEPYSM------PHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
            LLQEPV DSPL++D+ANIL+  D SAY+G+I Y+L E
Sbjct: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  150 bits (380), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 99/156 (63%), Gaps = 8/156 (5%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           MARI++E   I+  L   +S  +V L P+D  DLSRW   I+GP  TPY  + F L + +
Sbjct: 1   MARIAREYKHIQATLG-SESSLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVL 58

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
              YP  PP + F        R  PHCNV+  TG ICL+IL PE WSP WD+LHV++AI 
Sbjct: 59  GDRYPTTPPQVTFAR------RSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156
            LL +P PDSPLD+D+ANIL+  D SAY G++ Y+L
Sbjct: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  144 bits (363), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 103/164 (62%), Gaps = 9/164 (5%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDD--SDLSRWFAVIKGPAETPYYPYEFKLAI 58
           M+RI KE   IRK     D+  +  L PV +  SDLS W ++I GP ++PY+   F L I
Sbjct: 1   MSRIIKEYNHIRKLNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58

Query: 59  EVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQA 118
            +P  YP +PP IKF  ++     +PPHCNV+  TGEICL+ILK E WSP+W++L+ VQA
Sbjct: 59  HIPTEYPSIPPVIKFNKNS-----IPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQA 113

Query: 119 IHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162
           I  LL  P P SPL++D++ +L   D  AYN +I+Y+L     P
Sbjct: 114 IIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  143 bits (361), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 100/156 (64%), Gaps = 7/156 (4%)

Query: 3   RISKELLKIRKALEHG-DSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61
           R++KE   + K L    +  +++ LAPV + +L +W ++I GP +TPY+ +EF L IE  
Sbjct: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63

Query: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121
            +YP+ PP ++F +      R  PHCNVD  +G ICL +L    W+P WD+LHVV AI +
Sbjct: 64  EAYPLEPPKVQFQA------RCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWL 117

Query: 122 LLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157
           LL  P PDSPLDVD+A +++  D SA+N +I Y+L 
Sbjct: 118 LLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  138 bits (348), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 99/156 (63%), Gaps = 7/156 (4%)

Query: 3   RISKELLKIRKALEHGDS-EFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61
           R++KE   + K L+   +   +  L PV D +L  W A I GP++TPY  +EF L I +P
Sbjct: 4   RLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIP 63

Query: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121
           ++YP+ PP ++F        R  PHCNVD  +G IC+++L+   WSP WD+LH+V AI +
Sbjct: 64  SAYPLEPPKVQF------NARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWL 117

Query: 122 LLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157
           LL  P PDSPLDVD+A + +  D SA+NG++ Y+L 
Sbjct: 118 LLANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  135 bits (341), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 97/156 (62%), Gaps = 7/156 (4%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KE   ++K L +  +  +  L P+D  DL+ W A I GP  TPY+ + F L I +  
Sbjct: 5   RLLKEYQVVKKELGNHKN-IISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP+ PP + F +         PHCN++ +TG+ICL+IL    WSP+W++L VV AI+ L
Sbjct: 64  EYPLKPPQVTFSAYKM------PHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
           L +PV DSPL++D++NILK  D SAY G+I Y+L  
Sbjct: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  118 bits (295), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 97/168 (57%), Gaps = 19/168 (11%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPV--DDSDLSRWFAVIKGPAETPYYPYEFKLAI 58
           M RI +E  +++K L    +  ++ LAPV  ++ DL RW A  +GP  TPY  + F L I
Sbjct: 1   MRRILREYKQLQKQLALHPA--VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58

Query: 59  EVPASYPMVPPTIKFVSDAKAGIRVPPH--C--NVDRRTGEICLDILKPEGWSPIWDILH 114
            VP +YP  PP   F          PPH  C  N+   TGE+CLD+LK E WSP++++L 
Sbjct: 59  NVPETYPNEPPKCSF----------PPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQ 108

Query: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162
           VV+AI  LL EP  DSPLDVD++  L   D +AY+G++ Y L     P
Sbjct: 109 VVEAISTLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTRPQP 155

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  116 bits (291), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 98/157 (62%), Gaps = 11/157 (7%)

Query: 2   ARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61
           +RI KE  K  ++L+   S++++ L P+   DL+ W   IKGP  +P+  + FKL I++P
Sbjct: 3   SRILKEY-KDSRSLQ---SQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58

Query: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121
            +YP+  P  KF   A       PH NV+  TGEICLDIL    WSP+++I ++V+AI  
Sbjct: 59  QTYPLTTPICKFEPFAM------PHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111

Query: 122 LLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
           LL EP   SPL++D+AN+L+ +D+ AY+ +I Y L  
Sbjct: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNN 148

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  115 bits (287), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (57%), Gaps = 18/161 (11%)

Query: 2   ARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           +R+  E  +IR+ L+  +S  ++ L P  D   LS+W A   GP  TPY  + F L+IE+
Sbjct: 10  SRMLAEYKQIREQLQSHES--ILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPP----HCNVDRRTGEICLDILKPEGWSPIWDILHVV 116
           P  YP  PP  +F          PP    H N+   TGE+CLD+LK E WSP++++L VV
Sbjct: 68  PEMYPNEPPNCRF----------PPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVV 117

Query: 117 QAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157
           +AI  LL EP  DSPLDVD+A  L + D  AY G++ Y L 
Sbjct: 118 EAIRTLLAEPGVDSPLDVDLAK-LYSVDKQAYQGLVTYRLC 157

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  114 bits (285), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 7/151 (4%)

Query: 8   LLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMV 67
           L + R+ +  G +    +L P D +DL+ W A ++GP  TPY  + F L + VP  YP +
Sbjct: 6   LREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTL 65

Query: 68  PPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPV 127
           PP++ F        R  PH NV   TGE+CLD L   GW+P+ D+ + V A+  LL EP 
Sbjct: 66  PPSVCFPK------RTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPN 118

Query: 128 PDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
           P+SPL++++A + +  D  AY+GII+Y L  
Sbjct: 119 PESPLNLELAALSRLGDHKAYDGIIKYRLAH 149

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  107 bits (266), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 94/160 (58%), Gaps = 10/160 (6%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           M+RI KE + ++K L+  +  ++  LAPVDD DLS W    +GP+E+P+  +E  L I +
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60

Query: 61  P-ASYPMV-PPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQA 118
               YP+   P + F        R   H NV   TGEICLD+LK + W+PI+ +L VV A
Sbjct: 61  DLEKYPISGGPRVLFEP------RTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113

Query: 119 IHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158
           I  LL +P  DSPLD+D+A I  + D  AY  I+RY L E
Sbjct: 114 IRDLLADPGLDSPLDLDIAQIY-DADYEAYVQIVRYRLEE 152

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 94.4 bits (233), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 88/158 (55%), Gaps = 15/158 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  ELL++  +     S F     PVDD+DL+ W   I GP +TPY   +FK++++ P 
Sbjct: 12  RLQNELLQLLSSTTESISAF-----PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           +YP  PP IKF+S          H NVD ++G ICLDILK E WS ++++  ++ ++  L
Sbjct: 67  NYPFHPPMIKFLSPMW-------HPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSL 117

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           L EP   SPL+  +A  L + DM  Y   +     EID
Sbjct: 118 LGEPNNRSPLNA-VAAELWDADMEEYRKKVLACYEEID 154

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 93.6 bits (231), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 85/158 (53%), Gaps = 15/158 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  ELL++  +       F     PVDD+DL+ W   I GP  TPY   +FK+++  P 
Sbjct: 12  RLQNELLQLLSSTTQSIGAF-----PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPE 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           +YP  PP +KFVS          H NVD ++G ICLDILK E WS ++++  ++ ++  L
Sbjct: 67  NYPFHPPKVKFVSPMW-------HPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSL 117

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           L EP   SPL+  +A  L + DM  Y   +     EID
Sbjct: 118 LGEPNNRSPLNA-VAAELWDKDMEGYKKKVLMCYEEID 154

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 92.8 bits (229), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  ELL++  +     S F     PVDD+DL+ W   I GP  TPY   +FK+++  P 
Sbjct: 12  RLQNELLQLLSSATQSISAF-----PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPE 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           +YP  PP IKFVS          H NVD ++G ICLDILK E WS ++++  ++ ++  L
Sbjct: 67  NYPFHPPKIKFVSPMW-------HPNVD-KSGNICLDILK-EKWSAVYNVETILLSLQSL 117

Query: 123 LQEPVPDSPLDVDMANILKNN 143
           L EP   SPL+   A +   N
Sbjct: 118 LGEPNNKSPLNAVAAELWDTN 138

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 89.7 bits (221), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 84/158 (53%), Gaps = 15/158 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  ELL++  +     S F     P DD+DL+ W   I GP  TPY   +FK+++  P 
Sbjct: 12  RLQNELLQLLSSTTRSISAF-----PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPE 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           SYP  PP +KFVS          H NVD  +G ICLDILK E WS ++++  ++ ++  L
Sbjct: 67  SYPFHPPKVKFVSPMW-------HPNVD-MSGNICLDILK-EKWSAVYNVETILLSLQSL 117

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           L EP   SPL+  +A  L + DM  Y   +     EI+
Sbjct: 118 LGEPNNRSPLNA-VAAELWDKDMEEYKKKVLACYEEIE 154

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 88.6 bits (218), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 84/146 (57%), Gaps = 15/146 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  EL+++  +   G S F     P D+ DL+ W A+I GP +TPY    FKL+ +   
Sbjct: 20  RLQSELMQLMMSPTPGLSAF-----PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSD 74

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           SYP  PP +KF+S          H NVD  +G ICLDILK + WS ++++  ++ ++  L
Sbjct: 75  SYPYAPPLVKFISPMW-------HPNVD-MSGNICLDILK-DQWSAVYNVETILLSLQAL 125

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAY 148
           L+EP   SPL+  +A  L ++DM+ Y
Sbjct: 126 LEEPNNSSPLNA-VAAELWDDDMNEY 150

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 84.7 bits (208), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 81/146 (55%), Gaps = 15/146 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  EL+++  +   G S F     P  + DL++WF VI GP  TPY   +F+L+++   
Sbjct: 13  RLQNELVQLMMSPTPGLSAF-----PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTD 67

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP + FVS          H NVD  +G ICLDILK + WS ++++  ++ ++  L
Sbjct: 68  QYPYQPPKVTFVSPMW-------HPNVD-MSGNICLDILKDQ-WSAVYNVQTILLSLQAL 118

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAY 148
           L+EP   SPL+  +A  L + DM  Y
Sbjct: 119 LEEPNNGSPLNA-IAAELWDTDMDEY 143

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 82.4 bits (202), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 82/148 (55%), Gaps = 15/148 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + R+  EL+++  +   G S F     P ++ DL  W  +I GP  TPY   +FK+++  
Sbjct: 14  VKRLQSELVQLMMSPTPGLSAF-----PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHF 68

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P SYP VPP +KF+S          H NVD  +G ICLDILK + WS ++++  ++ ++ 
Sbjct: 69  PDSYPYVPPKVKFISPMW-------HPNVD-MSGNICLDILK-DQWSAVYNVQTILLSLQ 119

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAY 148
            L +EP   SPL+  +A  L + DM  Y
Sbjct: 120 SLFEEPNNSSPLNA-VAAELWDKDMVEY 146

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 81.6 bits (200), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D E  + L  V++SD+       +GP ETPY   +F + IEVP 
Sbjct: 6   RIMKEMQAVK-----DDPEAHITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H NV   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 70/135 (51%), Gaps = 13/135 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  +R      D E  +DL  V ++D+        GP ETPY   +F + IEVP 
Sbjct: 6   RIMKEMEAVRD-----DPEANIDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMA 137
           LQ P P+ P D ++A
Sbjct: 113 LQSPEPNDPQDAEVA 127

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 77.8 bits (190), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 15/160 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           ++R+  EL+++  +   G S F     P D+ DL++W  +I GP  TPY    FK+A+E 
Sbjct: 16  VSRLQSELMQLMLSPSPGLSAF-----PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEF 70

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
             +YP   P ++FVS          H NVD  +G ICLDILK + WS ++++  ++ ++ 
Sbjct: 71  AQTYPYTAPKVRFVSPMW-------HPNVD-MSGNICLDILKDQ-WSAVYNVQTILLSLQ 121

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
            LL+EP   SPL+  +A  L + DM  Y   +     EID
Sbjct: 122 SLLEEPNNSSPLNA-VAAELWDKDMREYKKKLIARYEEID 160

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL  I+      D E  VDL  V+++D+        GP  TPY   +F + IEVP 
Sbjct: 6   RVMKELQAIK-----DDPEAKVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H NV   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL  +R      D    + L  + +SD+ R      GP ETPY    F + IEVP 
Sbjct: 6   RLMKELQAVRD-----DPAANITLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (57%), Gaps = 10/120 (8%)

Query: 24  VDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRV 83
           V  +P+ D ++  W A+I GPAETPY    F+L +E    YP  PP +KF+S+       
Sbjct: 20  VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF----- 73

Query: 84  PPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
             H NV    GEICLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 74  --HPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 129

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KEL  ++      D E  ++L  V++SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKELQAVKD-----DPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPMMKF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 77.4 bits (189), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPAETPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 75/139 (53%), Gaps = 14/139 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + R+  EL+++  +   G S F     P  + +L++W   I GP ++PY    FK+++  
Sbjct: 14  IQRLHNELVQLIMSPTPGLSAF-----PDHEENLTKWSGTITGPDDSPYAGLRFKISLTF 68

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP +KFVS          H NVD  +G ICLD+LK E WS ++++  ++ ++ 
Sbjct: 69  PDRYPYEPPKVKFVSPMW-------HPNVD-LSGNICLDVLK-EKWSAVYNVQTILLSLQ 119

Query: 121 ILLQEPVPDSPLDVDMANI 139
            LL EP   SPL+   A +
Sbjct: 120 ALLGEPNNSSPLNAIAAEL 138

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL  I+      D E  VDL  V+++D+        GP  TPY   ++ + IEVP 
Sbjct: 6   RVMKELQAIKD-----DPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF +          H NV   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKFQTKVY-------HPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KFVS+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (57%), Gaps = 10/120 (8%)

Query: 24  VDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRV 83
           V  +P+ D ++  W A+I GPAETPY    F+L +E    YP  PP +KF+S+       
Sbjct: 9   VSASPLPD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF----- 62

Query: 84  PPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
             H NV    GEICLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 63  --HPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 118

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RISKEL  +RK     D        PV D DL  W A I GP ++PY    F L+I  P 
Sbjct: 5   RISKELNDLRK-----DPITSFSAGPVGD-DLFHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 59  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D S Y    R
Sbjct: 110 LTDANPDDPLVPEIAHIYK-TDRSKYETTAR 139

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GPA++PY    F L+I  P 
Sbjct: 6   RIAKELSDLER-----DPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D S Y    R
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRSKYEATAR 140

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 78/138 (56%), Gaps = 11/138 (7%)

Query: 6   KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYP 65
           + L++  K ++  DS   V  +P+ D ++  W A+I GPA+TPY    F+L +E    YP
Sbjct: 7   RRLMRDFKRMKE-DSPPGVSASPLPD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYP 64

Query: 66  MVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQE 125
             PP +KF+S+         H NV    GEICLDIL+   W+P +D+  ++ +I  L  +
Sbjct: 65  NKPPHVKFLSEMF-------HPNV-YANGEICLDILQ-NRWTPTYDVASILTSIQSLFND 115

Query: 126 PVPDSPLDVDMANILKNN 143
           P P SP +V+ A + K++
Sbjct: 116 PNPASPANVEAATLFKDH 133

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    ++L  V +SD+        GP ETPY    F + IEVP 
Sbjct: 6   RIMKEMQAVKD-----DPAANINLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 75.9 bits (185), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KEL  ++      D E  + L  V +SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKELQAVKD-----DPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF S          H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKFDSKVY-------HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 61/106 (57%), Gaps = 9/106 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF-------HPNV-YANGEI 72

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKN 142
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K+
Sbjct: 73  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKD 117

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GP++TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 71/133 (53%), Gaps = 9/133 (6%)

Query: 5   SKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASY 64
           SK +LK  +A++  D E  ++L  V++SD+        GP+ TPY   +F + I +P  Y
Sbjct: 4   SKRILKEIQAVKE-DPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEY 62

Query: 65  PMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQ 124
           P  PP +KF  D K       H NV   TG ICLDILK   W+P+  +   + ++  LLQ
Sbjct: 63  PYKPPQMKF--DTKV-----YHPNVSSVTGAICLDILK-NAWTPVITLKSALISLQALLQ 114

Query: 125 EPVPDSPLDVDMA 137
            P P+ P D  +A
Sbjct: 115 SPEPNDPQDAQVA 127

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF-------HPNV-YANGEI 72

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 73  CLDILQ-NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDH 118

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 75.1 bits (183), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 78/141 (55%), Gaps = 15/141 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ ++  +I+      DS   +  +P+ D ++  W A+I GP++TPY    F+L +E   
Sbjct: 8   RLMRDFKRIK-----SDSPPGISASPLPD-NVMLWNAMIIGPSDTPYEDGTFRLVLEFDE 61

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF+S+         H NV    GEICLDIL+   W+P +D+  ++ +I  L
Sbjct: 62  EYPNKPPHVKFLSEMF-------HPNV-YANGEICLDILQ-NRWTPTYDVSSILTSIQSL 112

Query: 123 LQEPVPDSPLDVDMANILKNN 143
             +P P SP +V+ A + K++
Sbjct: 113 FNDPNPASPANVEAATLFKDH 133

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 75.1 bits (183), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPAETPY    F+L +E    YP+  P +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 74.7 bits (182), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+TPY    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + +++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQDH 133

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KEL  ++      D    + L  V++SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKELQAVKD-----DPTAKIGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKV-----YHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 83/158 (52%), Gaps = 15/158 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  EL+++  +   G S F     P ++ DL++W  +I GP  TPY    FK++++ P 
Sbjct: 18  RLQSELVQLMMSPSPGLSAF-----PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQ 72

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           SYP   P + FVS          H NVD  +G ICLDILK + WS ++++  ++ ++  L
Sbjct: 73  SYPYTAPRVTFVSPMW-------HPNVD-MSGNICLDILK-DQWSAVYNVQTILLSLQSL 123

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           L+EP   SPL+   A +   N M  Y   +     E+D
Sbjct: 124 LEEPNNSSPLNAVAAELWDKN-MEEYKRKLMARYEELD 160

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 84/158 (53%), Gaps = 15/158 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+  EL+++  +   G S F     P  + DL++W  +I GP  TPY    FK+A+E   
Sbjct: 18  RLQSELVQLMMSPSPGLSAF-----PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQ 72

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           +YP   P ++FVS          H NVD  +G ICLDILK + WS ++++  ++ ++  L
Sbjct: 73  TYPYTAPKVRFVSPMW-------HPNVD-MSGNICLDILKDQ-WSAVYNVQTILLSLQSL 123

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           L+EP   SPL+  +A  L + DM  Y   +     EI+
Sbjct: 124 LEEPNNSSPLNA-VAAELWDTDMQEYKKKLYARYEEIE 160

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 72.8 bits (177), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GPA++PY    F L+I  P 
Sbjct: 6   RIAKELSDLER-----DPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D   Y    R
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 72.8 bits (177), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GPA++PY    F L+I  P 
Sbjct: 6   RIAKELSDLER-----DPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D   Y    R
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 72.8 bits (177), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GPA++PY    F L+I  P 
Sbjct: 6   RIAKELSDLER-----DPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D   Y    R
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 140

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 9/107 (8%)

Query: 37  WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           W A+I GPA+T Y    F+L +E    YP  PP +KF+S+         H NV    GEI
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF-------HPNV-YANGEI 87

Query: 97  CLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           CLDIL+   W+P +D+  ++ +I  L  +P P SP +V+ A + K++
Sbjct: 88  CLDILQ-NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDH 133

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 74/152 (48%), Gaps = 16/152 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    + L  V++SD+        GP  TPY    F + IEVP 
Sbjct: 6   RIMKEMQAVKD-----DPAANITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKV-----YHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMA-NILKNNDMSAYNGIIR 153
           LQ P P+ P D ++A + LK  D   +N   R
Sbjct: 113 LQSPEPNDPQDAEVAQHYLK--DKEGFNKTAR 142

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KEL  ++      D E  + L  V +SD+        GP  TPY    F + IEVP 
Sbjct: 6   RIMKELQAVK-----DDPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPQMKF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 73.6 bits (179), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 71/137 (51%), Gaps = 10/137 (7%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           M+R  + + +I+   +  D+   + LA V +SD+        GP  TPY+   F + I+V
Sbjct: 1   MSRAKRLMKEIQSVKDDPDAN--ISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQV 58

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++ 
Sbjct: 59  PLEYPFKPPKMQF--DTKV-----YHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQ 110

Query: 121 ILLQEPVPDSPLDVDMA 137
            LLQ P P+ P D ++A
Sbjct: 111 ALLQSPEPNDPQDAEVA 127

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 73.6 bits (179), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 72/137 (52%), Gaps = 10/137 (7%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           M+R  + + +I+   +  D+   + L+ V +SD+        GP  TPY+  +F + I+V
Sbjct: 1   MSRAKRLMKEIQSVKDDPDAN--ISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQV 58

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++ 
Sbjct: 59  PLEYPFKPPKMQF--DTKV-----YHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQ 110

Query: 121 ILLQEPVPDSPLDVDMA 137
            LLQ P P+ P D ++A
Sbjct: 111 ALLQSPEPNDPQDAEVA 127

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 73.2 bits (178), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 71/138 (51%), Gaps = 10/138 (7%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           M+R  + + +I+ A +  D E  + L+ V +SD+        GP  TPY    F + I+V
Sbjct: 1   MSRAKRIIKEIQAAKD--DPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQV 58

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++ 
Sbjct: 59  PLEYPFKPPKMQF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQ 110

Query: 121 ILLQEPVPDSPLDVDMAN 138
            LLQ P P+ P D ++A 
Sbjct: 111 ALLQSPEPNDPQDAEVAQ 128

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  P 
Sbjct: 5   RIAKELSDLGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 59  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D + Y    R
Sbjct: 110 LTDANPDDPLVPEIAHIYK-TDRAKYEATAR 139

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DIYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKIAFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    R
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAR 139

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP+++PY    F L+I  P 
Sbjct: 6   RIAKELSDLGR-----DPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP + F +          H N++  +G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKVNFTTKIY-------HPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A I K  D + Y    +
Sbjct: 111 LTDANPDDPLVPEIAQIYK-TDKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP+++PY    F L+I  P 
Sbjct: 6   RIAKELSDLGR-----DPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP + F +          H N++  +G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKVNFTTKIY-------HPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A I K  D + Y    +
Sbjct: 111 LTDANPDDPLVPEIAQIYK-TDKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP+++PY    F L+I  P 
Sbjct: 6   RIAKELSDLGR-----DPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP + F +          H N++  +G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKVNFTTKIY-------HPNIN-SSGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A I K  D + Y    +
Sbjct: 111 LTDANPDDPLVPEIAQIYK-TDKAKYEATAK 140

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    + L  V +SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKEIQAVKD-----DPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMQF--DTKV-----YHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    + L  V +SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKEIQAVKD-----DPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMQF--DTKV-----YHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    + L  V +SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKEIQAVKD-----DPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMQF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP+++PY    F L+I  P 
Sbjct: 6   RIAKELSDLGR-----DPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP + F +          H N++  +G ICLDILK + WSP   +  V+ ++  L
Sbjct: 60  DYPFKPPKVNFTTKIY-------HPNIN-SSGNICLDILK-DQWSPALTLSKVLLSVCSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A I K  D + Y    +
Sbjct: 111 LTDANPDDPLVPEIAQIYK-TDKAKYEATAK 140

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    + L  V +SD+        GP  TPY   +F + IEVP 
Sbjct: 6   RIMKEIQAVKD-----DPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP ++F  D K       H N+   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMQF--DTKVY-----HPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 72/151 (47%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  P 
Sbjct: 5   RITKELSDMGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 59  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D   Y    R
Sbjct: 110 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 139

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAGPVGD-DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 58  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A++ K  D + Y    R
Sbjct: 109 SLLTDANPDDPLVPEIAHLYK-TDRAKYEATAR 140

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 72/151 (47%), Gaps = 16/151 (10%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI+KEL  + +     D        PV D DL  W A I GP ++PY    F L+I  P 
Sbjct: 6   RITKELSDMGR-----DPPTSCSAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP I F +          H N++   G ICLDILK + WSP   +  V+ +I  L
Sbjct: 60  DYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           L +  PD PL  ++A+I K  D   Y    R
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 140

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (49%), Gaps = 15/143 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAGPVGD-DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 58  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 ILLQEPVPDSPLDVDMANILKNN 143
            LL +  PD PL  ++A+I K +
Sbjct: 109 SLLTDANPDDPLVPEIAHIYKTD 131

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 3   LKRITKELNDLGR-----DPPTSCSAGPVGD-DVYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 57  PTDYPFKPPKIAFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A+I K  D + Y    R
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEAQAR 139

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           RI KE+  ++      D    ++L  V +SD+        GP  TPY    F + IEVP 
Sbjct: 6   RIMKEMQAVK-----DDPAAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPM 60

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
            YP  PP +KF  D K       H NV   TG ICLDILK   WSP+  +   + ++  L
Sbjct: 61  EYPFKPPKMKF--DTKVY-----HPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LQEPVPDSPLDVDMAN 138
           LQ P P+ P D ++A 
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 65/113 (57%), Gaps = 11/113 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+FAV I+GP E+PY    F+L + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLTRIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA-NILKNNDMS 146
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A   +KN +++
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEEWIKNEELA 136

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 64/127 (50%), Gaps = 11/127 (8%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
            PV D DL  W A I GP ++PY    F L+I  P  YP  PP I F +          H
Sbjct: 38  GPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-------H 89

Query: 87  CNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMS 146
            N++   G ICLDILK + WSP   +  V+ +I  LL +  PD PL  ++A+I K  D S
Sbjct: 90  PNINAN-GNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRS 146

Query: 147 AYNGIIR 153
            Y    R
Sbjct: 147 KYEATAR 153

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 71/143 (49%), Gaps = 15/143 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAGPVGD-DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 58  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 ILLQEPVPDSPLDVDMANILKNN 143
            LL +  PD PL  ++A++ K +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYKTD 131

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 69.3 bits (168), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60
           + RI+KEL  + +     D        PV D D+  W A I GP ++PY    F L+I  
Sbjct: 4   LKRITKELNDLGR-----DPPTSCSAGPVGD-DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIH 120
           P  YP  PP I F +          H N++   G ICLDILK + WSP   I  V+ +I 
Sbjct: 58  PTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 ILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            LL +  PD PL  ++A++ K  D + Y    +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYK-TDRAKYEATAK 140

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 64/122 (52%), Gaps = 10/122 (8%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D R G
Sbjct: 29  RYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTKIY-------HPNID-RLG 80

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRY 154
            ICLDILK   WSP   I  V+ ++  LL  P P+ PL  D+A     N+  A N    +
Sbjct: 81  RICLDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGAKNTAREW 139

Query: 155 FL 156
            L
Sbjct: 140 TL 141

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   ++GP ++PY    FKL + +P  YPM  P ++F++          H N+D
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+ +A
Sbjct: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEAA 136

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 10/103 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP+++PY    FKL + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 11/111 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP ++PY    FKL + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA-NILKNND 144
            ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A + +KN D
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNED 134

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    FKL + +P  YPM  P ++F++          H N+D
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTKIY-------HPNID 71

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 72  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 29  DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 82  -RLGRICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 136

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 60/108 (55%), Gaps = 10/108 (9%)

Query: 32  SDLSRWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
            D  R+F V I+GP ++PY    F+L + +P  YPM PP ++F++          H N+D
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMAN 138
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A 
Sbjct: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 62/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-------HPNID 71

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N++ A
Sbjct: 72  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEVGA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGA 136

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 64/113 (56%), Gaps = 11/113 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA-NILKNNDMS 146
            ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A + ++N D +
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIRNEDAA 136

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 68.9 bits (167), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 64/127 (50%), Gaps = 11/127 (8%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
            PV D DL  W A I GP ++PY    F L+I  P  YP  PP I F +          H
Sbjct: 113 GPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-------H 164

Query: 87  CNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMS 146
            N++   G ICLDILK + WSP   I  V+ +I  LL +  PD PL  ++A+I K  D +
Sbjct: 165 PNINAN-GNICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRA 221

Query: 147 AYNGIIR 153
            Y    +
Sbjct: 222 KYEATAK 228

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTRIY-------HPNID 71

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 72  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 10/116 (8%)

Query: 33  DLSRWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDR 91
           D  R+F V ++GPA +PY    F+L + +P  YPM  P ++F++          H N+D 
Sbjct: 30  DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-------HPNID- 81

Query: 92  RTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
           R G ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A     N+  A
Sbjct: 82  RLGRICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 68.2 bits (165), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 75/134 (55%), Gaps = 13/134 (9%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  VDD+ +  +     GP  TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 21  DVELVDDN-MQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNKIF------ 73

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANI-LKN 142
            H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A + LKN
Sbjct: 74  -HPNIDAASGSICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKN 131

Query: 143 NDMSAYNGIIRYFL 156
            ++  Y   IR F+
Sbjct: 132 KEL--YEQKIREFI 143

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 67.8 bits (164), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 77/139 (55%), Gaps = 11/139 (7%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  V+D ++  +F    GP ETPY    ++L +E+P +YP   P+I FV+         
Sbjct: 21  DVELVND-NMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNKI------- 72

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNN 143
            H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A  L+  
Sbjct: 73  FHPNIDIASGSICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLR 130

Query: 144 DMSAYNGIIRYFLTEIDSP 162
           D   Y   I+ ++ +  +P
Sbjct: 131 DKKLYEEKIKEYIDKYATP 149

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 67.4 bits (163), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 72/129 (55%), Gaps = 12/129 (9%)

Query: 33  DLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRR 92
           ++  +     GP ETPY    ++L +E+P +YP   P+I FV+          H N+D  
Sbjct: 16  NMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-------HPNIDAA 68

Query: 93  TGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANI-LKNNDMSAYNG 150
           +G ICLD++    WSP++D+L++++  I  LL+EP    PL+ + A + LK+ ++  Y  
Sbjct: 69  SGSICLDVINS-AWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKEL--YER 125

Query: 151 IIRYFLTEI 159
            IR F+ + 
Sbjct: 126 KIREFIDQF 134

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 32  SDLSRWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
            D  R+F V I+GP ++PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137
            R G ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A
Sbjct: 82  -RLGRICLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 58/103 (56%), Gaps = 10/103 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP ++ Y    F+L + +P  YPM PP ++F++          H N+D R G
Sbjct: 33  RYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   I+GP ++PY    F L + +P  YPM  P ++F++          H N+D
Sbjct: 29  DDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     ++ SA
Sbjct: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDESSA 136

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (57%), Gaps = 13/128 (10%)

Query: 20  SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKA 79
           S+  VDL  V+DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+    
Sbjct: 6   SDHEVDL--VNDS-MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKI-- 60

Query: 80  GIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMAN 138
                 H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A 
Sbjct: 61  -----FHPNIDAASGSICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT 114

Query: 139 I-LKNNDM 145
           + LKN ++
Sbjct: 115 LQLKNKEL 122

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (55%), Gaps = 11/129 (8%)

Query: 29  VDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCN 88
           V+DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+          H N
Sbjct: 26  VEDS-MQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-------HPN 77

Query: 89  VDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSA 147
           +D  +G ICLD++    WSP++D+L++V+  +  LL+EP    PL+ + AN L+  D   
Sbjct: 78  IDIASGSICLDVINS-TWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKV 135

Query: 148 YNGIIRYFL 156
           Y   +R ++
Sbjct: 136 YEEKVREYI 144

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F+V I+GP  +PY    F L + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNETGA 136

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 66.2 bits (160), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 70/123 (56%), Gaps = 11/123 (8%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  V+D  +  +     GP +TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 22  DVELVEDK-MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKI------- 73

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANI-LKN 142
            H N+D  +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A + LK+
Sbjct: 74  FHPNIDAASGSICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKD 132

Query: 143 NDM 145
            DM
Sbjct: 133 KDM 135

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (53%), Gaps = 10/113 (8%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F+V I+GP ++ Y    F+L + +P  YPM  P ++F++          H N+D R G
Sbjct: 33  RYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLTKIY-------HPNID-RLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A     N+  A
Sbjct: 85  RICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEKGA 136

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 66.2 bits (160), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 11/133 (8%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  V+D+ +  ++    GP +TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 22  DVELVNDN-MQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNKI------- 73

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNN 143
            H N+D  +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A  L+ +
Sbjct: 74  FHPNIDIASGSICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLH 131

Query: 144 DMSAYNGIIRYFL 156
           D + Y   I+ ++
Sbjct: 132 DKTLYEQKIKEYI 144

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 9/107 (8%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D +L  +   ++GP  +PY    F+L + +P  YPM  P ++F++          H N+D
Sbjct: 29  DDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-------HPNID 81

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137
            R G ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A
Sbjct: 82  -RLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 57/103 (55%), Gaps = 10/103 (9%)

Query: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94
           R+F V I+GP ++PY    F L + +P  YPM  P ++F++          H N+D + G
Sbjct: 33  RYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLTKIY-------HPNID-KLG 84

Query: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137
            ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A
Sbjct: 85  RICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 65.5 bits (158), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 75/133 (56%), Gaps = 11/133 (8%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  V+D ++  ++    GP +TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 23  DVRLVND-NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKI------- 74

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNN 143
            H N+D  +G ICLD++    WSP++D+L++++  I  LL+EP    PL+ + A  L+ +
Sbjct: 75  FHPNIDIASGSICLDVINS-TWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLH 132

Query: 144 DMSAYNGIIRYFL 156
           D   Y   I+ ++
Sbjct: 133 DKKIYEEKIKEYI 145

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 65.5 bits (158), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 69/123 (56%), Gaps = 11/123 (8%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  VDD+ +  +     GP  TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 21  DVELVDDN-MQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF------ 73

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANI-LKN 142
            H N+D  +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A + LKN
Sbjct: 74  -HPNIDAASGSICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKN 131

Query: 143 NDM 145
             M
Sbjct: 132 PQM 134

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 10/133 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           + ++  +     GP +TPY    ++L +E+P +YP   P+I FV+          H N+D
Sbjct: 26  NDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-------HPNID 78

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSAYN 149
             +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A  L+  D   Y 
Sbjct: 79  VASGSICLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYE 136

Query: 150 GIIRYFLTEIDSP 162
             I+ ++ +  +P
Sbjct: 137 QKIKEYIDKYATP 149

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 71/129 (55%), Gaps = 11/129 (8%)

Query: 29  VDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCN 88
           ++DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+          H N
Sbjct: 26  INDS-MQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGFVNKIY-------HPN 77

Query: 89  VDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSA 147
           +D  +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A  L+  D   
Sbjct: 78  IDIASGSICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKM 135

Query: 148 YNGIIRYFL 156
           Y   I+ ++
Sbjct: 136 YEEKIKEYI 144

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 69/127 (54%), Gaps = 10/127 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           ++ +  +     GP +TPY    ++L +E+P +YP   P+I FV+          H N+D
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKI-------FHPNID 101

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSAYN 149
             +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A  L+  D   Y 
Sbjct: 102 IASGSICLDVINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELRDKKLYE 159

Query: 150 GIIRYFL 156
             IR ++
Sbjct: 160 EKIREYI 166

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 25  DLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           D+  V+D+ +  ++    GP +TPY    ++L +E+P +YP   P+I FV+         
Sbjct: 39  DVELVNDN-MQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI------- 90

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNN 143
            H N+D  +G ICLD++    WSP++D+L++V+  I  LL+EP    PL+ + A  L+  
Sbjct: 91  FHPNIDIASGSICLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELK 148

Query: 144 DMSAYNGIIRYFLTE 158
           D   Y   I+ ++ +
Sbjct: 149 DKKLYEERIKEYIAK 163

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 65/117 (55%), Gaps = 10/117 (8%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D ++  +     GP  TPY    ++L +E+P +YP   P+I FV+          H N+D
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-------HPNID 78

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANI-LKNNDM 145
             +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A + LKN  M
Sbjct: 79  AASGSICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPKM 134

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 10/127 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           + ++  +    +GP +TPY    ++L +E+P +YP   P+I FV+          H N+D
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKI-------LHPNID 66

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSAYN 149
             +G ICLD++    WSP++D+ ++V+  I  LL+EP    PL+ + A  L+  D   Y 
Sbjct: 67  VASGSICLDVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYE 124

Query: 150 GIIRYFL 156
             I+ ++
Sbjct: 125 EKIKEYI 131

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 13/138 (9%)

Query: 20  SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKA 79
           S+  VDL  ++DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+    
Sbjct: 18  SDHQVDL--INDS-MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI-- 72

Query: 80  GIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMAN 138
                 H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A 
Sbjct: 73  -----FHPNIDIASGSICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA- 125

Query: 139 ILKNNDMSAYNGIIRYFL 156
            L+  D   Y   I+ ++
Sbjct: 126 TLQLRDKKLYEEKIKEYI 143

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 76/138 (55%), Gaps = 13/138 (9%)

Query: 20  SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKA 79
           S+  VDL  V+DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+    
Sbjct: 18  SDHEVDL--VNDS-MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI-- 72

Query: 80  GIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMAN 138
                 H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A 
Sbjct: 73  -----FHPNIDIASGSICLDVINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA- 125

Query: 139 ILKNNDMSAYNGIIRYFL 156
            L+  D   Y   I+ ++
Sbjct: 126 TLQLRDKKLYEEKIKEYI 143

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 13/138 (9%)

Query: 20  SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKA 79
           S+  VDL  ++DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+    
Sbjct: 18  SDHQVDL--INDS-MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI-- 72

Query: 80  GIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMAN 138
                 H N+D  +G ICLD++    WSP++D++++V+  I  LL+EP    PL+ + A 
Sbjct: 73  -----FHPNIDIASGSICLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA- 125

Query: 139 ILKNNDMSAYNGIIRYFL 156
            L+  D   Y   I+ ++
Sbjct: 126 TLQLRDKKLYEEKIKEYI 143

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  ++DL  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLLKELQQLMK-----DSSTGIVAGPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  +VD   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANVDACILWRDN 147

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 62.4 bits (150), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 13/138 (9%)

Query: 20  SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKA 79
           S+  VDL  V+DS +  +     GP +TPY    ++L +E+P +YP   P+I FV+    
Sbjct: 17  SDHQVDL--VNDS-MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI-- 71

Query: 80  GIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMAN 138
                 H N+D  +G ICLD++    WSP++D++++++  I  LL+EP    PL+ + A 
Sbjct: 72  -----FHPNIDIASGSICLDVINS-TWSPLYDLINILEWMIPGLLKEPNGSDPLNNEAA- 124

Query: 139 ILKNNDMSAYNGIIRYFL 156
            L+  D   Y   I+ ++
Sbjct: 125 TLQLRDKKLYEEKIKEYI 142

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 62.4 bits (150), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 68/127 (53%), Gaps = 10/127 (7%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           + ++  +     GP +TPY    ++L +E+P +YP   P+I FV+          H N+D
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNKI-------FHPNID 80

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQ-AIHILLQEPVPDSPLDVDMANILKNNDMSAYN 149
             +G ICLD++    WSP++D+ ++V+  I  LL+EP    PL+ + A  L+  D   Y 
Sbjct: 81  IASGSICLDVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYE 138

Query: 150 GIIRYFL 156
             I+ ++
Sbjct: 139 EKIKEYI 145

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 55/111 (49%), Gaps = 10/111 (9%)

Query: 43  GPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK 102
           GP ++PY    F L+I  P  YP  PP I F +          H N++   G ICLDILK
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-------HPNINAN-GNICLDILK 53

Query: 103 PEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
            + WSP   +  V+ +I  LL +  PD PL  ++A+I K  D   Y    R
Sbjct: 54  -DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRPKYEATAR 102

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 57/121 (47%), Gaps = 9/121 (7%)

Query: 23  LVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIR 82
           L  L P +D+  S    +   P E  Y    FK  +    SYP+ PP++  +        
Sbjct: 32  LTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQKIY---- 87

Query: 83  VPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKN 142
              H N+D   G+ICL+IL+ E WSP  DI  V+  +  L  EP P  PL+ D A+ L  
Sbjct: 88  ---HPNIDL-NGKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTLIR 142

Query: 143 N 143
           N
Sbjct: 143 N 143

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 58.9 bits (141), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 23/166 (13%)

Query: 1   MARIS-KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIE 59
           M+R + K LLK  + L       ++  AP  +SDL  W  ++ GP +TPY    F   ++
Sbjct: 1   MSRTAQKRLLKELQQLTRDPPPGII-AAPKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQ 59

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WS 107
            P  YP+ PPT+ F            H NV    GE+C+ IL   G            WS
Sbjct: 60  FPTDYPLSPPTLTFTPSIL-------HPNV-YPNGEVCISILHAPGSDPNMYELPEERWS 111

Query: 108 PIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
           P+  +  ++ ++  +L EP  +S  ++D A IL  +    +N  ++
Sbjct: 112 PVQSVEKILLSVVSMLSEPNVESGANID-ACILWRDHRDDFNKKVK 156

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 20/145 (13%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
            P D+SDL  W  +++GP ++PY    F+  +  P  YP+ PP + FV           H
Sbjct: 27  GPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVPSVL-------H 79

Query: 87  CNVDRRTGEICLDILKPEG------------WSPIWDILHVVQAIHILLQEPVPDSPLDV 134
            NV    GE+C+ IL   G            WSP+  +  ++ ++  +L EP  +S  ++
Sbjct: 80  PNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANI 138

Query: 135 DMANILKNNDMSAYNGIIRYFLTEI 159
           D   + ++N       + R  L  +
Sbjct: 139 DACVLWRDNRPEFERQVKRNVLKSL 163

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 71/153 (46%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ +     DS   +   PV + +L  W  +I+GPA++PY    F   ++ P 
Sbjct: 8   RLMKELQQLLR-----DSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPR 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H NV    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  D +L  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLYKELQQLIK-----DSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 20/129 (15%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
            P +++DL  W  +I+GP +TPY    F   +  P  YP+ PPT+ F            H
Sbjct: 27  GPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRDYPLSPPTLTFTPAIL-------H 79

Query: 87  CNVDRRTGEICLDILKPEG------------WSPIWDILHVVQAIHILLQEPVPDSPLDV 134
            N+    GE+C+ IL   G            WSP+  +  ++ ++  +L EP  +S  ++
Sbjct: 80  PNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANI 138

Query: 135 DMANILKNN 143
           D   + ++N
Sbjct: 139 DACILWRDN 147

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 72/153 (47%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL K+ K     DS   +  +P+DDS+L +W  +I GP ++ Y    F   ++ P 
Sbjct: 8   RLLKELEKLTK-----DSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLNPPKLTFQPSIL-------HPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEMILLSVMSILSEPNIESGANIDACILWRDN 147

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 20/129 (15%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
           AP  +S+L  W  +I+GP +TPY    F   ++ P  YP+ PP + F            H
Sbjct: 27  APKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFPKDYPLSPPKLTFTPSIL-------H 79

Query: 87  CNVDRRTGEICLDILKPEG------------WSPIWDILHVVQAIHILLQEPVPDSPLDV 134
            N+    GE+C+ IL   G            WSP+  +  ++ ++  +L EP  +S  +V
Sbjct: 80  PNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANV 138

Query: 135 DMANILKNN 143
           D   + ++N
Sbjct: 139 DACILWRDN 147

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KE+ ++ K    G     +   PV++ ++  W  +I GP ++PY    F   ++ P 
Sbjct: 8   RLMKEMQQLLKDCPEG-----IVAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPT 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H NV    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 20/129 (15%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
            P D++++  W  +I GP ETPY    F   +  P  YP+ PP + F            H
Sbjct: 29  GPSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSPPKLTFTPSLL-------H 81

Query: 87  CNVDRRTGEICLDILKPEG------------WSPIWDILHVVQAIHILLQEPVPDSPLDV 134
            N+    GE+C+ IL   G            WSP+  +  ++ ++  +L EP  +S  ++
Sbjct: 82  PNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANI 140

Query: 135 DMANILKNN 143
           D + + ++N
Sbjct: 141 DASILYRDN 149

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E  Y    F  ++    SYP+ PP +KF+           H N+D   G+ICL+IL+ 
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKKIY-------HPNIDL-NGKICLNILR- 125

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           E WSP+ D+  ++  +  L  EP P  PL++    +LK N
Sbjct: 126 EDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKEN 165

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 21/151 (13%)

Query: 5   SKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASY 64
            K LLK  + L     E +V   P  + +L  W  +I GP ++PY    F   +E P  Y
Sbjct: 6   QKRLLKELQQLARDSPEGIV-AGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDY 64

Query: 65  PMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIWDI 112
           P+ PP + F            H N+    GE+C+ IL   G            WSP+  +
Sbjct: 65  PLSPPRLTFTPSIL-------HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSV 116

Query: 113 LHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
             ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 117 EKILLSVTSMLSEPNVESGANIDACILWRDN 147

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  ++++  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 64/129 (49%), Gaps = 11/129 (8%)

Query: 26  LAPVDDSDLSR-WFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           ++P D S L      VI  P E  Y    F+ ++E   +YPM PP  K V   +      
Sbjct: 58  ISPTDPSSLDNPLLDVIISPDEGYYKNGHFRFSLEFNDNYPMEPP--KVVCRNRIY---- 111

Query: 85  PHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNND 144
            H N+D + G++CL+IL+ E WSP  D+  ++  +  L  EP    PL+ D A +  + D
Sbjct: 112 -HPNIDVQ-GKVCLNILR-EDWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKD 167

Query: 145 MSAYNGIIR 153
            +A+   +R
Sbjct: 168 SNAFAKFVR 176

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  ++++  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  ++++  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  ++++  W  +I+GP +TPY    F   +E P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  + +L  W  +I GP ++PY    F   +E P 
Sbjct: 8   RLFKELQQLLK-----DSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLLFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 63/133 (47%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H  S F   L   D + DL  W A I G A T +    + ++IE
Sbjct: 6   LQRLQEERKKWRK--DHPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAVYPISIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +V  
Sbjct: 64  YPDEYPSKPPKVKF----PAGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P ++++L  W  +++GP +T Y    F   +E P 
Sbjct: 8   RLLKELQQLTK-----DSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            I  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SIEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P ++++L  W  +++GP +T Y    F   ++ P 
Sbjct: 8   RLLKELQQLNK-----DSPPGIVAGPANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 72/169 (42%), Gaps = 25/169 (14%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  + +L  W  +I GP ++PY    F   +E P 
Sbjct: 8   RLFKELQQLLK-----DSPEGIVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLLFTPSIL-------HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEI 159
            +  ++ ++  +L EP  +S  ++D   + +++       + R  L  +
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANIDACILWRDSREEFEKQVKRSILKSL 163

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ KEL ++ K     DS   +   P  + ++ +W  +++GP ++PY    F   ++ P 
Sbjct: 8   RLLKELQQLMK-----DSPPGIVAGPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPK 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG------------WSPIW 110
            YP+ PP + F            H N+    GE+C+ IL   G            WSP+ 
Sbjct: 63  DYPLSPPKLTFTPSIL-------HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQ 114

Query: 111 DILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            +  ++ ++  +L EP  +S  ++D   + ++N
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANIDACILWRDN 147

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 61/136 (44%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     PV  SD    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFYAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
           ++E P  YP  PP +KF     AG     H NV   +G ICL IL   + W P   +  +
Sbjct: 61  SVEYPNEYPSKPPKVKFP----AGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
           V  +  LL  P P+SP
Sbjct: 113 VLGVQDLLDSPNPNSP 128

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    +   +   D S DL +W A I G   T +    + + +E
Sbjct: 6   LQRLQEERKKWRK--DHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H NV   +G ICL IL   + W P   +  +V  
Sbjct: 64  YPNEYPSKPPKVKF----PAGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    +   +   D S DL +W A I G   T +    + + +E
Sbjct: 6   LQRLQEERKKWRK--DHPFGFYAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYPITVE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H NV   +G ICL IL   + W P   +  +V  
Sbjct: 64  YPNEYPSKPPKVKF----PAGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    +   +   D S DL +W A I G   T +    + + +E
Sbjct: 6   LQRLQEERKKWRK--DHPFGFYAKPVKKADGSMDLQKWEAGIPGKDATNWAGGVYPITVE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H NV   +G ICL IL   + W P   +  +V  
Sbjct: 64  YPNEYPSKPPKVKF----PAGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQIVLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 2   ARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVP 61
           A +S   L++RK L   D    V +   +    SR +  I  P E  Y    FK      
Sbjct: 27  APVSACQLRLRKDLASLDIPPCVSIDVSECESNSRLYINIT-PDEGYYKCGHFKFCATFK 85

Query: 62  ASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHI 121
            +YP+ PP +  +S          H N+D + G +CL+IL+ E WSP+ D+  ++  + +
Sbjct: 86  DTYPIEPPKVTLLSKIF-------HPNIDLQ-GNVCLNILR-EDWSPVLDVQSILIGLLM 136

Query: 122 LLQEPVPDSPLDVDMANILKNN 143
           L  EP    PL+   A++L  N
Sbjct: 137 LFLEPNATDPLNKVAADVLAAN 158

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 26  LAPVDDSD--LSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRV 83
           + P D +D   S    V   P E  Y        ++    YP+ PP +       A ++ 
Sbjct: 49  ITPPDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKV-------ACLKK 101

Query: 84  PPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
             H N+D + G +CL+IL+ E WSP  D+  ++  +  L  EP P+ PL+ D A +   N
Sbjct: 102 IFHPNIDLK-GNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLFCQN 159

Query: 144 DMSAYNGIIRYFLT 157
           +   +  I+R  ++
Sbjct: 160 E-KKFAEIVRSTMS 172

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 50.8 bits (120), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 9/98 (9%)

Query: 43  GPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK 102
            P E  Y       +++    YP+ PP +       A ++   H N+D + G +CL+IL+
Sbjct: 68  NPDEGYYTHGSINFSLDFNEVYPIEPPKV-------ACLKRIFHPNIDFK-GNVCLNILR 119

Query: 103 PEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
            E WSP  D+  +V  +  L  EP P+ PL+ D A +L
Sbjct: 120 -EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  +++++  W  +I GPA+TPY+  ++   +  P+ YP  PP I+ V+         P
Sbjct: 26  LARPNENNILEWHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAIRMVT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +    R    +CL +    P  W+P W +  ++  +
Sbjct: 77  NGRF-RENTRLCLSMSDYHPNTWNPSWSVSTILNGL 111

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E  Y P  F+ ++    +YP+ PP +K V+          H N+D + G +CL+IL+ 
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCVNKIY-------HPNIDTQ-GNVCLNILR- 118

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLD 133
           E WSP+ D+  VV  +  L  EP    PL+
Sbjct: 119 EDWSPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    F      VD S +L  W A I G   T ++   + + IE
Sbjct: 6   LQRLQEERKKWRK--DHPFGFFAKPTKKVDGSMNLQLWEAGIPGKESTIWHGALYPITIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +V  
Sbjct: 64  YPDEYPSKPPKVKF----PAGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDTPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E  Y   +F+       +YP+ PP  K + + K       H N+D   G+ICL+IL+ 
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPP--KVICNNKIF-----HPNIDPH-GKICLNILR- 121

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLT 157
           E WSP  D+  +V  +  L QEP  + PL+ + A +L N D   +  ++R  ++
Sbjct: 122 EDWSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVL-NKDKLEFGNLVRLAMS 174

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    F       D S +L RW A I G   T ++   + L IE
Sbjct: 6   LQRLQEERKKWRK--DHPFGFFAKPTKKQDGSLNLQRWEAGIPGKEGTLWHEGVYPLTIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +K      AG     H NV   +G ICL IL   + W P   +  +   
Sbjct: 64  YPDEYPSKPPKVKLP----AGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQICLG 115

Query: 119 IHILLQEPVPDSP 131
           I  LL  P P+SP
Sbjct: 116 IQDLLDSPNPNSP 128

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 9/88 (10%)

Query: 53  EFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDI 112
            F+    +  +YP+ PP +  ++          H N++R TGEICL+IL+ E WSP  D+
Sbjct: 90  HFRFQFTINENYPIEPPKVVCLTKIY-------HPNINR-TGEICLNILR-EDWSPALDL 140

Query: 113 LHVVQAIHILLQEPVPDSPLDVDMANIL 140
             V+  +  L  EP P  PL+   A+ L
Sbjct: 141 QSVIIGLLFLFIEPNPKDPLNKQAADTL 168

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P   +D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFWAKPTRKADGSMNLQKWEAGIPGKEGTIWKEGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
            IE P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  TIEYPDDYPSKPPKVKF----PAGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
           V  +  LL  P PDSP
Sbjct: 113 VLGVQDLLNSPNPDSP 128

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 80/174 (45%), Gaps = 34/174 (19%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   ++A+      F ++L   DDS++  W   V+    ++ Y+   F+  ++
Sbjct: 19  LLRQYRELTDPKRAI----PSFHIELE--DDSNIFTWNIGVMVLNKDSIYHGGYFQSQMK 72

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPP--HCNVDRRTGEICLDILKPEG-----------W 106
            P  +P  PP  KF+         PP  H NV  R G++C+ IL   G           W
Sbjct: 73  FPKDFPFSPPQFKFI---------PPIYHPNV-YRDGKLCISILHQSGDAMTSEPDNETW 122

Query: 107 SPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID 160
           SP+  +  V+ +I  LL++P   SP +VD A   + N    YN   +  L +++
Sbjct: 123 SPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKN----YNEYKKKVLQQVE 172

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 27  APVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPH 86
           AP D S       +I  P E  Y    F   +     YP+ PP ++ ++          H
Sbjct: 53  APTDQSRDPPLLRLIVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCMNQIF-------H 105

Query: 87  CNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
            N+D + G+ICL+IL+ E WSP  D+  V+  I  L  E     PL+   A++L  N
Sbjct: 106 PNIDLQ-GKICLNILR-EDWSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDEN 160

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 14/119 (11%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           + +K L K  K + +    F++  AP +D+ L  W  VI GP  TPY   ++   +  P+
Sbjct: 5   QANKRLTKEYKNIVNNPPPFII-AAPHEDNIL-EWHYVITGPPSTPYENGQYHGTLTFPS 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
            YP  PP I+ ++         P+      T  +CL +    PE W+P W ++ ++  +
Sbjct: 63  DYPFNPPAIRMIT---------PNGRFKENT-RLCLSMSDYHPEAWNPAWSVVTILNGL 111

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    F       D S +L +W A I G   T +    + L IE
Sbjct: 6   LQRLQEERKKWRK--DHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H NV   +G ICL IL   + W P   +  ++  
Sbjct: 64  YPDDYPSKPPKVKFP----AGFY---HPNV-YPSGTICLSILNEDQDWRPAITLKQLLLG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 48.1 bits (113), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 9/94 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       LA  DD  +++W   I GP  + +    + +AI    
Sbjct: 9  RLLEELEKGEKGL--GPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSVAIHCGP 66

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           YP  PPTIKFVS     I +P  C VD +TGE+
Sbjct: 67 HYPDAPPTIKFVSK----INLP--C-VDEKTGEV 93

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GPAETPY   ++   +  P+ YP  PP I+ V+      R  P
Sbjct: 26  LARPNEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIRMVT---PNGRFKP 82

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +         +CL +    P+ W+P W +  ++  +
Sbjct: 83  NT-------RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 31  DSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVD 90
           D   S    VI  P E  Y        ++    YP+ PP +         ++   H N+D
Sbjct: 57  DRSQSPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKV-------VCLKKIFHPNID 109

Query: 91  RRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
            + G +CL+IL+ E WSP  D+  ++  +  L  EP P+ PL+ D A +L
Sbjct: 110 LK-GNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL 157

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 140

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       LA  DD  ++ W   I GP  + +    + +AIE  A
Sbjct: 11 RLLEELEKGEKGL--GPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIECGA 68

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLD 99
          +YP  PP IKFVS     I +P  C VD+ TGE+  D
Sbjct: 69 NYPDEPPLIKFVSK----INLP--C-VDQTTGEVKHD 98

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 4   ISKELLKIRKALEHGD-SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           I   L++++K LE+ D SE + +     D +  R    IK P    Y    +   + +  
Sbjct: 27  IKPSLIRLKKDLENIDLSEQICEYTTYLDENPMRVNLAIK-PDIGYYAGGTYYFNVFIKD 85

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122
           +YPM PP +K +          P+ ++D   G +CL++L+ E W+P  DI  ++  I  L
Sbjct: 86  TYPMEPPVVKCMHRIYH-----PNIDID---GNVCLNLLR-EDWTPALDIQSIIIGILFL 136

Query: 123 LQEPVPDSPLDVDMANIL 140
             EP    PL+ D A  L
Sbjct: 137 FHEPNGRDPLNKDAAKTL 154

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 59/130 (45%), Gaps = 20/130 (15%)

Query: 26  LAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVP 84
           +A  DDS++  W   V+    E+ Y+   FK  ++ P  +P  PPT +F           
Sbjct: 30  IALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPDDFPFSPPTFRFTP-------AI 82

Query: 85  PHCNVDRRTGEICLDILKPEG-----------WSPIWDILHVVQAIHILLQEPVPDSPLD 133
            H NV  R G +C+ IL   G           WSP+  +  V+ +I  LL++P   SP +
Sbjct: 83  YHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQTVESVLISIVSLLEDPNISSPAN 141

Query: 134 VDMANILKNN 143
           VD A   K N
Sbjct: 142 VDAAVDYKKN 151

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 48.1 bits (113), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 56/134 (41%), Gaps = 14/134 (10%)

Query: 1   MARISKELLKIRKALEHGDSEFLVD--LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAI 58
           + R+ +E  K RK    G   F       P    DL RW A I G   T +    + L I
Sbjct: 6   LQRLQEERKKWRKDHPFG---FFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYPLTI 62

Query: 59  EVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQ 117
           E P  YP  PP +K  ++         H NV   +G ICL IL   + W P   +  +  
Sbjct: 63  EYPDEYPSKPPKVKLPANFY-------HPNV-YPSGTICLSILNEDQDWRPAITLKQICL 114

Query: 118 AIHILLQEPVPDSP 131
            I  LL  P P+SP
Sbjct: 115 GIQDLLDSPNPNSP 128

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query: 6   KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYP 65
           K L K  K +    + F+  +A  +++++  W  +I GP ++PY+  ++   +  P+ YP
Sbjct: 8   KRLTKEYKMMNENPTPFI--MARPNEANILEWHYIINGPPDSPYFEGQYHGTLTFPSDYP 65

Query: 66  MVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
             PP I+ ++         P+      T  +CL +    P+ W+P W +  ++  +
Sbjct: 66  YKPPAIRMIT---------PNGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGL 111

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 48.1 bits (113), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P    D    L +W A I G   T +    F +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
            +E P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  TVEYPDEYPSKPPKVKF----PAGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
           V  +  LL  P P+SP
Sbjct: 113 VLGVQDLLDSPNPNSP 128

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 57/136 (41%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P   +D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFFAKPTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG-WSPIWDILHV 115
            IE P  YP  PP +K      AG     H NV   +G ICL IL  E  W P   +  +
Sbjct: 61  TIEYPNEYPSKPPKVKLP----AGFY---HPNV-YPSGTICLSILNEEQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
              I  LL  P P+SP
Sbjct: 113 CLGIQDLLDSPNPNSP 128

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 71/158 (44%), Gaps = 27/158 (17%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDAKKAI----PSFHIELD--DDSNIFLWNVGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG-----------WSP 108
            P  +P  PPT +F            H NV  R G +C+ IL   G           WSP
Sbjct: 66  FPEDFPFSPPTFRFTPAIY-------HPNV-YRDGRLCISILHTSGDPTSEEPDSETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMA-NILKNNDM 145
           +  +  V+ +I  LL++P   SP +VD A +  KN D 
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNADQ 155

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
          bp, 138 aa] {ON} similar to uniprot|P28263
          Saccharomyces cerevisiae YEL012W UBC8
          Ubiquitin-conjugating enzyme that negatively regulates
          gluconeogenesis by mediating the glucose-induced
          ubiquitination of fructose-1 6-bisphosphatase (FBPase)
          cytoplasmic enzyme that catalyzes the ubiquitination of
          histones in vitro
          Length = 138

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       LA  DD  ++ W   I GP  + +    + L+IE   
Sbjct: 9  RLLEELEKGEKGL--GPESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
          +YP  PPTIKF+S     I +P  C VD +TG++
Sbjct: 67 NYPDHPPTIKFISK----INLP--C-VDSKTGQV 93

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDAKKAI----PSFHIELD--DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEG-----------WSP 108
            P  +P  PPT +F            H NV  R G +C+ IL   G           WSP
Sbjct: 66  FPEDFPFSPPTFRFTP-------AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P    D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDAVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
            IE P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  TIEYPDDYPSKPPKVKFP----AGFY---HPNI-YPSGTVCLSILNEDQDWKPAITMKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
           +  +  LL  P PDSP
Sbjct: 113 LLGVQDLLTSPNPDSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    F       D S +L +W A I G   T +    F + IE
Sbjct: 6   LQRLQEERKKWRK--DHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +   
Sbjct: 64  YPDDYPSKPPKVKFP----AGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQIALG 115

Query: 119 IHILLQEPVPDSP 131
           +  LL  P P+SP
Sbjct: 116 VQDLLDSPNPNSP 128

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GPA+TPY   ++   +  P+ YP  PP I+ V+      R  P
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRMVT---PNGRFKP 82

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +         +CL +    P+ W+P W +  ++  +
Sbjct: 83  NT-------RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
          bp, 139 aa] {ON} highly similar to uniprot|P53152
          Saccharomyces cerevisiae YGL087c MMS2 part of the
          error-free postreplication repair pathway
          Length = 139

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 9/94 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       LA  DD  ++RW   I GP  + +    + ++IE   
Sbjct: 9  RLLEELEKGEKGL--GPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIECGP 66

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           YP  PPTI F+S     I +P  C VD+ TGE+
Sbjct: 67 KYPDEPPTITFISK----INLP--C-VDQSTGEV 93

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 9/98 (9%)

Query: 43  GPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK 102
            P E  Y    F  ++    SYP+ PP +K ++          H N+D   G ICL++L+
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTTIY-------HPNIDYN-GNICLNVLR 200

Query: 103 PEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
            E W+P+ D+  +V  +  L  EP P  PL+   A+ +
Sbjct: 201 -EDWTPVLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query: 33  DLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRR 92
           DL RW A I G   T +    + + IE P  YP  PP + F            H NV   
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPKGFY-------HPNV-YP 53

Query: 93  TGEICLDILKPEG-WSPIWDILHVVQAIHILLQEPVPDSP 131
           +G ICL IL  E  W P   +  +V  +  LL  P P+SP
Sbjct: 54  SGTICLSILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P   +D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFYAKPCKKADGSMNLQKWEAGIPGKEGTIWQDGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
            IE P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  TIEYPDEYPSKPPKVKFP----AGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
              +  LL  P P+SP
Sbjct: 113 ALGVQDLLDSPNPNSP 128

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 17/125 (13%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ +EL K  K +  G       LA  DD  ++ W   I GP  + +    + L+IE   
Sbjct: 9   RLLEELEKGEKGM--GPESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIECGP 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPI--WDILHVVQAIH 120
           SYP  PPT+KF+S      ++  +C VD  TG     ++KP+ ++PI  W   + ++ I 
Sbjct: 67  SYPDEPPTLKFIS------KINLNC-VDSATG-----VVKPD-FNPIKNWKRSYTMETIL 113

Query: 121 ILLQE 125
           + L++
Sbjct: 114 LELRK 118

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           +A  ++S++  W  VI GP ++PY+  ++   +  P+ YP  PP I+ V+         P
Sbjct: 26  IARPNESNILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPYKPPAIRMVT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +      T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  NGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGL 111

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P  ++D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFFAKPTRNADGTMNLQKWEAGIPGREGTLWDHGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
           +IE P  YP  PP ++F     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  SIEYPDEYPSKPPKVRF----PAGFY---HPNI-YPSGTVCLSILNEDQDWRPAITLKQI 112

Query: 116 VQAIHILLQEPVPDSPLDVDMANILKNN 143
           V  +  LL  P P+SP         + N
Sbjct: 113 VIGVQDLLDTPNPNSPAQEPAWKAFQRN 140

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GPA+TPY   ++   +  P+ YP  PP I+ ++      R  P
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAIRMIT---PNGRFKP 82

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +         +CL +    P+ W+P W +  ++  +
Sbjct: 83  NT-------RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GPA+TPY   ++   +  P+ YP  PP I+ ++      R  P
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRMIT---PNGRFKP 82

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +         +CL +    P+ W+P W +  ++  +
Sbjct: 83  NT-------RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           L+ + D   S    ++  P E  Y   +FK  ++   +YP+ PP +  ++         P
Sbjct: 58  LSVLSDLKESPHLTLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKI-----FHP 112

Query: 86  HCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
           + ++D   G+ICL+IL+ E WSP  D+  ++  +  L  E     PL+ + ANIL
Sbjct: 113 NIDLD---GKICLNILR-EDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 163

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           L+ + D   S    ++  P E  Y   +FK  ++   +YP+ PP +  ++         P
Sbjct: 59  LSVLSDLKESPHLTLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKI-----FHP 113

Query: 86  HCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
           + ++D   G+ICL+IL+ E WSP  D+  ++  +  L  E     PL+ + ANIL
Sbjct: 114 NIDLD---GKICLNILR-EDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 164

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E PY    FK  ++    YP+ PP+   ++          H N+D   G+ICL+IL+ 
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIF-------HPNIDL-NGKICLNILR- 127

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           E WSP  D+  +V  +  L  +     PL+   A +L N+
Sbjct: 128 EDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLAND 167

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 38  FAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEIC 97
             V+  P E  Y       +++    YP+ PP +         ++   H N+D   G +C
Sbjct: 63  LEVVVSPDEGYYNHGSISFSLDFNEVYPIEPPKV-------TCLKKIFHPNIDL-NGNVC 114

Query: 98  LDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
           L+IL+ E WSP  D+  ++  +  L  EP P+ PL+ D A + 
Sbjct: 115 LNILR-EDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF 156

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSD----LSRWFAVIKGPAETPYYPYEFKL 56
           + R+ +E  K RK     D  F     P    D    L +W A I G   T +    + +
Sbjct: 6   LQRLQEERKKWRK-----DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPI 60

Query: 57  AIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHV 115
            IE P  YP  PP +KF     AG     H N+   +G +CL IL   + W P   +  +
Sbjct: 61  TIEYPDDYPSKPPRVKFP----AGFY---HPNI-YPSGTVCLSILNEDQDWKPAITMKQI 112

Query: 116 VQAIHILLQEPVPDSP 131
           +  +  LL  P P+SP
Sbjct: 113 LLGVQDLLTSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 33  DLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRR 92
           +L +W A I G   T +    F + IE P  YP  PP +KF     AG     H N+   
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF----PAGFY---HPNI-YP 53

Query: 93  TGEICLDILKP-EGWSPIWDILHVVQAIHILLQEPVPDSP 131
           +G +CL IL   + W P   +  +   +  LL  P P+SP
Sbjct: 54  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 14/116 (12%)

Query: 6   KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYP 65
           K L K  KA+     +F ++  P +D+ L  W  +I GP +TPY   ++   +  PA YP
Sbjct: 8   KRLTKEYKAIIENPPQF-INAQPNEDNILE-WHYIITGPPDTPYTDGQYHGTLVFPADYP 65

Query: 66  MVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
             PP I+ ++         P+      T  +C+ +    P+ W+P W +  ++  +
Sbjct: 66  FKPPAIRMIT---------PNGRFKENT-RLCMTMSDYHPDTWNPAWSVATILMGL 111

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    E+ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFVWNIGVMVLNEESIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 26/149 (17%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +K++      F ++L   DDS++  W   V+    E+ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKSI----PSFHINLE--DDSNIFVWNIGVMVLNEESIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPDDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMA 137
           +  +  V+ +I  LL++P   SP +VD A
Sbjct: 118 VQSVESVLISIVSLLEDPNISSPANVDAA 146

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  +++++  W  +I GP +TPY   ++   +  P+ YP  PP I+ ++         P
Sbjct: 26  LARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIRMIT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +      T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  NGRFKENT-RLCLSMSDYHPDLWNPGWSVATILNGL 111

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 45.4 bits (106), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E  Y    F+ ++    +YP+ PPT+K ++          H N+D  +G ICL++L+ 
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIY-------HPNIDY-SGNICLNVLR- 133

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANIL 140
           E WSP+ D+  VV  +  L  EP    PL+   A+ +
Sbjct: 134 EDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
          {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       LA  DD  ++ W   I GP  + +    + ++IE   
Sbjct: 9  RLLEELEKGEKGL--GPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECGP 66

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
          +YP  PP IKFVS     + VP  C VD  TGE+
Sbjct: 67 NYPDEPPKIKFVSK----VNVP--C-VDSTTGEV 93

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 12/133 (9%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDS-DLSRWFAVIKGPAETPYYPYEFKLAIE 59
           + R+ +E  K RK  +H    F       D S +L +W A I G   T +    + + IE
Sbjct: 6   LQRLQEERKKWRK--DHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIE 63

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-EGWSPIWDILHVVQA 118
            P  YP  PP +K  ++         H NV   +G ICL IL   + W P   +  +   
Sbjct: 64  YPNEYPSKPPKVKLPANFY-------HPNV-YPSGTICLSILNEDQDWRPAITLKQICLG 115

Query: 119 IHILLQEPVPDSP 131
           I  LL  P P+SP
Sbjct: 116 IQDLLDSPNPNSP 128

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS+L  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELD--DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK-----------PEGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQGGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 30  DDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNV 89
           ++S++  W  +I GP +TPY   ++   +  P+ YP  PP I+ ++         P+   
Sbjct: 30  NESNILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRMIT---------PNGRF 80

Query: 90  DRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
              T  +CL +    P+ W+P W +  ++  +
Sbjct: 81  KENT-RLCLSMSDYHPDTWNPGWSVATILNGL 111

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELD--DDSNIFSWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK-----------PEGWSP 108
            P  +P  PP+ +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPSFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P  +SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P  +SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 26/149 (17%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTNPKKAI----PSFHINLE--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPDDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMA 137
           +  +  V+ +I  LL++P   SP +VD A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 30  DDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNV 89
           +D ++  W  VI GP +TPY   ++   +  P  YP  PP I+  +         P+   
Sbjct: 30  NDENILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIRIST---------PNGRF 80

Query: 90  DRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
            + T  +CL +    P+ W+P W +  ++  +
Sbjct: 81  KQHT-RLCLSMSDYHPDTWNPSWSVATILNGL 111

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P  +SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 12/92 (13%)

Query: 30  DDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNV 89
           ++ ++  W  VI GP ETPY   ++   +  P+ YP  PP I+ V+         P+   
Sbjct: 30  NEDNILEWHYVITGPPETPYEGGQYHGTLTFPSDYPYKPPAIRMVT---------PNGRF 80

Query: 90  DRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
              T  +CL +    P+ W+P W +  ++  +
Sbjct: 81  KENT-RLCLSMSDYHPDLWNPGWSVSTILTGL 111

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 9/110 (8%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ +EL K  K    G       LA  DD  +++W   I GP  + +    + L+IE   
Sbjct: 9   RLLEELEKGEKGF--GPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDI 112
           +YP  PP + F+S     I +P  C V++ TGEI  D      W   + +
Sbjct: 67  NYPDSPPKVTFISK----INLP--C-VNQTTGEIQTDFHTLRDWKRAYTM 109

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 24/113 (21%)

Query: 54  FKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP--HCNVDRRTGEICLDILKPEG------ 105
           FK  ++ P+++P  PP  KFV         PP  H NV  + G++C+ IL   G      
Sbjct: 61  FKSEMKFPSNFPYSPPHFKFV---------PPIYHPNV-YKDGKLCISILHQSGDSMTSE 110

Query: 106 -----WSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIR 153
                WSP+  +  V+ +I  LL++P   SP +VD A++    +   Y   +R
Sbjct: 111 PDNETWSPVQSVESVLISIISLLEDPNISSPANVD-ASVEYRKNFQEYKRKVR 162

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS+L  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELD--DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPDDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  ++
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELD--DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMK 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK-----------PEGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPNFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELD--DDSNIFLWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK-----------PEGWSP 108
            P  +P  PP+ +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPSFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPTSDEPDSETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 14/109 (12%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ +EL K  K +  G       LA  DD  ++ W   I GP  + +    + +AIE   
Sbjct: 9   RLLEELEKGEKGM--GPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSVAIECGE 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWD 111
           +YP  PP I+F+S     + +P  C VD+ TGE+     K E +S + D
Sbjct: 67  AYPDQPPKIRFLSK----VNLP--C-VDQNTGEV-----KKEQFSTLRD 103

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 14/116 (12%)

Query: 6   KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYP 65
           K L K  K L      F+  LA  ++ ++  W  +I GP +TPY   ++   +  P  YP
Sbjct: 8   KRLTKEYKLLVESSPPFI--LARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYP 65

Query: 66  MVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
             PP I+ ++         P+      T  +CL +    P+ W+P W +  ++  +
Sbjct: 66  YKPPAIRMIT---------PNGRFKENT-RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 30  DDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNV 89
           ++ ++  W  VI GP++TPY   ++   +  P+ YP  PP I+ ++         P+   
Sbjct: 30  NEDNILEWHYVITGPSDTPYSSGQYHGTLTFPSDYPYKPPAIRMIT---------PNGRF 80

Query: 90  DRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
              T  +CL +    P+ W+P W +  ++  +
Sbjct: 81  KENT-RLCLSMSDYHPDLWNPGWSVSTILTGL 111

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   RKA+      F ++L   D+S+L  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPRKAI----PSFHIELE--DESNLFIWNIGVMVLNEDSIYHGGYFKSQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           +A  ++ ++  W  VI GP +TPY   ++   +  P+ YP  PP I+ ++         P
Sbjct: 26  IARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRMIT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +      T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  NGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGL 111

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 67/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   RK +      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPRKCI----PSFNIELE--DDSNIFVWNVGVMVLNEDSLYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK-----------PEGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 6   KELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYP 65
           K L K  K +      ++V  AP +D+ L  W  VI GP ETPY   ++   +  P  YP
Sbjct: 8   KRLSKEYKMMTENPPPYIV-AAPKEDNILV-WHYVITGPPETPYEDGQYHGTLVFPNDYP 65

Query: 66  MVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
             PP I+ ++         P+    R    +CL +    P+ W+P W +  ++  +
Sbjct: 66  FNPPAIRMLT---------PNGRF-RENTRLCLSMSDYHPDTWNPSWSVATILTGL 111

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           +A  ++S++  W  +I GP  TPY   ++   +  P+ YP  PP I+ V+         P
Sbjct: 26  MARPNESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRMVT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
                  T  +CL +    P  W+P W +  ++  +
Sbjct: 77  SGRFQENT-RLCLSMSDYHPTTWNPGWSVSTILNGL 111

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFIWNIGVMVLNEDSIYHGGFFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTPAIY-------HPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P  +SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
           {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 9/94 (9%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ +EL K  K    G       LA  DD  ++ W   I GP  + +    + +AI    
Sbjct: 28  RLLEELEKGEKG--KGPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAITCGP 85

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
           +YP VPPTIKF+S     I +P    VD  TGE+
Sbjct: 86  NYPDVPPTIKFISK----INLPC---VDDVTGEV 112

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 26/155 (16%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFHIELE--DDSNIFVWNIGVMVLNEDSIYHGGFFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPEDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           +  +  V+ +I  LL++P   SP +VD A   + N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GP +TPY   ++   +  P+ YP  PP I+ ++         P
Sbjct: 26  LARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYKPPAIRMIT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +      T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  NGRFKENT-RLCLSMSDYHPDLWNPGWSVNTILNGL 111

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 26/149 (17%)

Query: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRW-FAVIKGPAETPYYPYEFKLAIE 59
           + R  +EL   +KA+      F ++L   DDS++  W   V+    ++ Y+   FK  + 
Sbjct: 12  LLRQYRELTDPKKAI----PSFNIELD--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQMR 65

Query: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP-----------EGWSP 108
            P  +P  PP  +F            H NV  R G +C+ IL             E WSP
Sbjct: 66  FPDDFPFSPPQFRFTP-------AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 IWDILHVVQAIHILLQEPVPDSPLDVDMA 137
           +  +  V+ +I  LL++P   SP +VD A
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 14/119 (11%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           +  K L K  K++      F++  A  ++ ++  W  VI GP +TPY   ++   +  P+
Sbjct: 5   QAQKRLTKEYKSMVENPPPFII--AQPNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPS 62

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
            YP  PP I+ V+         P       T  +CL +    P+ W+P W +  ++  +
Sbjct: 63  DYPFKPPAIRMVT---------PSGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGL 111

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           +A  ++ ++  W  VI GP +TPY   ++   +  P+ YP  PP I+ V+         P
Sbjct: 26  IAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAIRMVT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
                  T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  SGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGL 111

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 9/100 (9%)

Query: 44  PAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKP 103
           P E  Y    F   +E   +YP+ PPT+   S          H N+D   G++CL+IL+ 
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTVICTSKLY-------HPNIDI-DGKVCLNILR- 123

Query: 104 EGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNN 143
           E WSP  D+  ++  +  LL EP    PL+ D A +L  +
Sbjct: 124 EDWSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTD 163

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL087C
           (MMS2); 1-intron
          Length = 138

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 14/109 (12%)

Query: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
           R+ +EL K  K +  G       LA  DD  ++ W   I GP  + +    + + IE  A
Sbjct: 9   RLLEELEKGEKGM--GPESCSYGLADGDDISMTHWNGTILGPPHSSHENRIYSVVIECGA 66

Query: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWD 111
            YP  PP ++F+S     I +P  C VD  TGE+     +PE +  + D
Sbjct: 67  EYPDRPPKVRFISR----INLP--C-VDPSTGEV-----RPEAFHALRD 103

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
          [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
          Saccharomyces cerevisiae YGL087C MMS2 Protein involved
          in error-free postreplication DNA repair forms a
          heteromeric complex with Ubc13p that has a
          ubiquitin-conjugating activity cooperates with
          chromatin-associated RING finger proteins Rad18p and
          Rad5p
          Length = 139

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 3  RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62
          R+ +EL K  K L  G       L+  DD  +++W   I GP  + +    + + IE   
Sbjct: 9  RLLEELEKGEKGL--GPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECGP 66

Query: 63 SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEI 96
          SYP  PP +KFVS     I +P  C V+  TGE+
Sbjct: 67 SYPDEPPKVKFVSK----INLP--C-VNSTTGEV 93

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 26  LAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPP 85
           LA  ++ ++  W  +I GP ++PY   ++   +  P  YP  PP I+ ++         P
Sbjct: 26  LARPNEDNILEWHYIITGPPDSPYSEGQYHGTLTFPTDYPYKPPAIRMIT---------P 76

Query: 86  HCNVDRRTGEICLDI--LKPEGWSPIWDILHVVQAI 119
           +      T  +CL +    P+ W+P W +  ++  +
Sbjct: 77  NGRFKENT-RLCLSMSDYHPDLWNPSWSVSTILTGL 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.140    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,367,253
Number of extensions: 760532
Number of successful extensions: 2216
Number of sequences better than 10.0: 268
Number of HSP's gapped: 1902
Number of HSP's successfully gapped: 268
Length of query: 162
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 61
Effective length of database: 41,900,133
Effective search space: 2555908113
Effective search space used: 2555908113
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)