Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I09372g1.318ON1031035251e-70
NDAI0B047701.318ON1131143013e-36
Kpol_1035.251.318ON1061102752e-32
Ecym_62891.318ON1031022673e-31
TPHA0O014701.318ON1001012647e-31
TDEL0D018701.318ON1001052622e-30
Kwal_14.25861.318ON1061042595e-30
NCAS0B074401.318ON1101102596e-30
ZYRO0G20702g1.318ON140992591e-29
SAKL0D06952g1.318ON1071052526e-29
KLTH0H10714g1.318ON1061062492e-28
YBR268W (MRPL37)1.318ON1051052483e-28
AEL167C1.318ON101972473e-28
KLLA0F01683g1.318ON98852404e-27
Suva_4.5291.318ON1051052396e-27
KNAG0C017701.318ON1011022389e-27
Smik_2.4111.318ON1051052371e-26
Skud_2.4001.318ON1051052362e-26
TBLA0F013201.318ON111802283e-25
KAFR0C042101.318ON1011052092e-22
Ecym_55594.28ON101464605.7
Suva_9.1537.233ON88383606.4
Smik_9.842.284ON80864606.5
TBLA0H016202.477ON72369596.8
NDAI0F005405.665ON27460598.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I09372g
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...   206   1e-70
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...   120   3e-36
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   110   2e-32
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   107   3e-31
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   106   7e-31
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   105   2e-30
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   104   5e-30
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...   104   6e-30
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   104   1e-29
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   101   6e-29
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   100   2e-28
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...   100   3e-28
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   100   3e-28
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...    97   4e-27
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    97   6e-27
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    96   9e-27
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    96   1e-26
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    96   2e-26
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    92   3e-25
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    85   2e-22
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...    28   5.7  
Suva_9.153 Chr9 complement(253920..256571) [2652 bp, 883 aa] {ON...    28   6.4  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    28   6.5  
TBLA0H01620 Chr8 (368544..370715) [2172 bp, 723 aa] {ON}               27   6.8  
NDAI0F00540 Chr6 (125324..126148) [825 bp, 274 aa] {ON} Anc_5.665      27   8.0  

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score =  206 bits (525), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MLRLLFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTV 60
           MLRLLFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTV
Sbjct: 1   MLRLLFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTV 60

Query: 61  LDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           LDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL
Sbjct: 61  LDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score =  120 bits (301), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 67/114 (58%), Positives = 80/114 (70%), Gaps = 12/114 (10%)

Query: 1   MLRLLFTKRLLSSSV-VLRNEAK-------QIKSSCLAGTPLSLNVKKTGKDPVALEDSE 52
           MLRL F KR  S+S+ VL  E K       +IKSSCLAGTPL+LN+KKTGK+P+ALED E
Sbjct: 1   MLRL-FVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKE 59

Query: 53  YPEWLWTVLDQ---TNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           YPEWLWTVLD       A + K    EESL ARK+Q+R   R+KIKQ NFL+Q+
Sbjct: 60  YPEWLWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  110 bits (275), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 79/110 (71%), Gaps = 11/110 (10%)

Query: 1   MLRLLFTKRLLSSSVVLRNE-------AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEY 53
           ML+ +F KRLLSSS +L  E       + +I+SSC AG+ L+LN+KK GKDPVALED+EY
Sbjct: 1   MLKQIFQKRLLSSSRLLWQETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEY 60

Query: 54  PEWLWTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           P WLWTVLD+   A A    +S++ L  RKK++RQ+NR+ IKQ NFL Q+
Sbjct: 61  PTWLWTVLDKEAQAEA----LSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  107 bits (267), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 75/102 (73%), Gaps = 6/102 (5%)

Query: 4   LLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVL 61
           L+  KRL+S+++ L  +  +K I SSC AGTPL+L +KKTGK+PVAL +SEYPEWLW VL
Sbjct: 6   LIINKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVL 65

Query: 62  DQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           D    AA     ++E+   ARKKQ+R+ NREKIKQ NFL+++
Sbjct: 66  DPQVEAAK----LNEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  106 bits (264), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 68/101 (67%), Gaps = 6/101 (5%)

Query: 5   LFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLD 62
           +F KR  S   +L  E  A  +KSSC AGTPL +NV KTGKDP+ALEDSEYP WLWTVLD
Sbjct: 4   VFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLD 63

Query: 63  QTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           +     A  A +  + LK R+K++R+ NR  IKQ NFL Q+
Sbjct: 64  K----GAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  105 bits (262), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 71/105 (67%), Gaps = 7/105 (6%)

Query: 1   MLRLLFTKRLLSSSVVLRNEAKQ--IKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           M R +  KRL S+  V   E     +KSSC AGT LS+NVKK+GKDPVALEDSEYP WLW
Sbjct: 1   MFRFV-PKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLW 59

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
            VLD    A      ++E+ +K RKKQIR++NR +IKQ NFL QL
Sbjct: 60  EVLDPEARARK----LAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  104 bits (259), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 74/104 (71%), Gaps = 7/104 (6%)

Query: 3   RLLFTKRLLSSSVVLRNE---AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWT 59
           RL+  K   + S +L+++      IKSSC+AGTPL+L +KK+GK+PVALED EYPEWLW+
Sbjct: 7   RLVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWS 66

Query: 60  VLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           VLD      A    + E+ LK RKKQ+R +NR+KIKQ NFL+++
Sbjct: 67  VLDDK----AQLKKLQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score =  104 bits (259), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 74/110 (67%), Gaps = 8/110 (7%)

Query: 1   MLRLLFTKRLLSSSVVLRNEAKQ-------IKSSCLAGTPLSLNVKKTGKDPVALEDSEY 53
           MLRL+F + L +S  VL  EA         IKSSCLAGT L+LN+KK GKDP+ALED+EY
Sbjct: 1   MLRLVFKRSLSTSFRVLTAEAATTANASTNIKSSCLAGTSLNLNIKKNGKDPIALEDNEY 60

Query: 54  PEWLWTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           P WLW VL+      A+     +E L  RKKQ+R+ NR+KIKQ NFL+QL
Sbjct: 61  PAWLWKVLESKAPKEASDLS-EQEVLAMRKKQLRKENRKKIKQNNFLSQL 109

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  104 bits (259), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 7/99 (7%)

Query: 5   LFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQT 64
           LF +R +S+S VL    + +KSSC AGT +++N KK+GKDPVALED+EYP+WLW VLD  
Sbjct: 49  LFPRRFVSTSPVL---GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLD-- 103

Query: 65  NTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
               A    +  + +K RKKQ+R+ NREKIKQ NFL Q+
Sbjct: 104 --PEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  101 bits (252), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 76/105 (72%), Gaps = 10/105 (9%)

Query: 5   LFTKRLLSSS-VVLRNEA-----KQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           L ++R LS++ + L+ +A      ++KSSC AGTPL+L +KK+GK+ VALED EYPEWLW
Sbjct: 7   LASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWLW 66

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           TVLD+     A  A ++++  K +KKQ+R+ NREKIKQ NFL ++
Sbjct: 67  TVLDE----KAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  100 bits (249), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/106 (53%), Positives = 71/106 (66%), Gaps = 8/106 (7%)

Query: 2   LRLLFTKRLLSSSVVLRNEAKQ----IKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWL 57
           LR L +KR LS S       K     + SSC AGTPL+L +KK+GK+PVALED EYPEWL
Sbjct: 5   LRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWL 64

Query: 58  WTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           WTVLD    + A    + E+ LK RKKQ+R +NR KIKQ NFL+++
Sbjct: 65  WTVLD----SRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score =  100 bits (248), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           ML      RL+S+S +L N+   K + SSC AGT L+LN+ K+GKD VALED EYP WLW
Sbjct: 1   MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           +VLD  +    A      ++L  R+K IR++NR++IKQ NFL+QL
Sbjct: 61  SVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score = 99.8 bits (247), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 70/97 (72%), Gaps = 5/97 (5%)

Query: 8   KRLLSSSV-VLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNT 66
           +RL S S  V   +A++  SSC AGTPL+L +KK GK+P+ALEDS+YPEWLW VLD    
Sbjct: 9   RRLFSVSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQ 68

Query: 67  AAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           AA     ++E+ +KARKK +R+ NRE IKQ+NFL ++
Sbjct: 69  AAK----LAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score = 97.1 bits (240), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (72%), Gaps = 4/85 (4%)

Query: 19  NEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEES 78
            +A +I SSC AGTPL+L +KK+GK+PVALEDSEYPEWLWTVLD    A      ++ + 
Sbjct: 18  GQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEK----LAADP 73

Query: 79  LKARKKQIRQSNREKIKQRNFLNQL 103
           +K RKKQ+R +NR  IKQ NFL ++
Sbjct: 74  IKLRKKQLRIANRANIKQNNFLAKI 98

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 96.7 bits (239), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           ML    + R LS+S V  N+   K + SSC AGT L+LN+ K+GKD  ALED EYP WLW
Sbjct: 1   MLARSVSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLW 60

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           +VLD       A      E+L  RKK IR++NR++IKQ NFL+QL
Sbjct: 61  SVLDAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 96.3 bits (238), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 69/102 (67%), Gaps = 7/102 (6%)

Query: 5   LFTKRLLSSSVVLRNEAKQ--IKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLD 62
              +R+     VL   A+   +KSSCLAGTPL L+++K G+DPVA+ D EYPEWLW VL+
Sbjct: 4   FVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLE 63

Query: 63  -QTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
             T   A+A+A    + L AR+K++R+ +R +IKQ N+L+QL
Sbjct: 64  PATGGDASARA----DPLAARRKELRRKHRNEIKQSNYLSQL 101

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 95.9 bits (237), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           ML      R +S+S VL N+   K + SSC AGT L+LN+ K+GKD VALED EYP WLW
Sbjct: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
            +L+   T          E+L  R+K IR++NR++IKQ NFL+QL
Sbjct: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 69/105 (65%), Gaps = 2/105 (1%)

Query: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58
           ML    + R +S+S VL N+   K + SSC AGT L+LN+ K+GKD +ALE+ EYP WLW
Sbjct: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60

Query: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           +VLD       A      E+L  R+K IR++NR++IKQ NFL+QL
Sbjct: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 92.4 bits (228), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 57/80 (71%), Gaps = 4/80 (5%)

Query: 24  IKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEESLKARK 83
           IKSSC AGT L LNV K GKDPVALED +YP WLW++L  +N     K P   E++  RK
Sbjct: 35  IKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNN----KNPSPMEAIAQRK 90

Query: 84  KQIRQSNREKIKQRNFLNQL 103
           K +R++NR++IKQ NFL QL
Sbjct: 91  KVLRKNNRDRIKQNNFLKQL 110

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 72/105 (68%), Gaps = 6/105 (5%)

Query: 1   MLRLLFTKRLLSSS-VVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWT 59
           MLRL  ++R  S S  VL++    + SSC  GTPL L V+K  K P+AL+D EYP WLW+
Sbjct: 1   MLRL--SRRFFSHSRSVLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWS 58

Query: 60  VLDQTNTAAAAK-APVSEESLKARKKQIRQSNREKIKQRNFLNQL 103
           VL++ +     + +P+ E  L+ R+KQ+R+ NR+KIKQ+NFL++L
Sbjct: 59  VLNEESANTQKELSPIQE--LELRRKQLRKLNRDKIKQKNFLSEL 101

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score = 27.7 bits (60), Expect = 5.7,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 27/64 (42%)

Query: 27  SCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEESLKARKKQI 86
           S L GTP+  N      D +A  D E+  +  T LDQ  T       ++        +Q+
Sbjct: 358 SLLLGTPIPFNNLGWPVDEIATSDEEWKIYTRTTLDQLQTYNMTSRAITNPQKNVLLQQL 417

Query: 87  RQSN 90
            Q++
Sbjct: 418 WQNS 421

>Suva_9.153 Chr9 complement(253920..256571) [2652 bp, 883 aa] {ON}
           YIL047C (REAL)
          Length = 883

 Score = 27.7 bits (60), Expect = 6.4,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 16  VLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVS 75
           ++  + +QI SS  A T   L+  +  K+P+   +++  EW  T L  TNT    K    
Sbjct: 303 LVAQQMQQITSSQPATTA-ELSSAQRDKEPITWLETQISEWYTTAL--TNTPKDKK---- 355

Query: 76  EESLKARKKQIRQSNREKIKQRN 98
             + K +K  I+ S  E++  RN
Sbjct: 356 HNTHKLKKLTIQYSISEQMVHRN 378

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score = 27.7 bits (60), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 37  NVKKTGKDPVALED-SEYPEWLWTVLDQTNTAAAAK-APVSEESLKARKKQIRQSNREKI 94
           N+ K+ +DP+  +  S Y ++  T  + +N  ++ +  P++EE  K+R K    +N+ K 
Sbjct: 680 NLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITPITEEKFKSRNKNGLSNNKTKD 739

Query: 95  KQRN 98
             R+
Sbjct: 740 NDRH 743

>TBLA0H01620 Chr8 (368544..370715) [2172 bp, 723 aa] {ON} 
          Length = 723

 Score = 27.3 bits (59), Expect = 6.8,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 27/69 (39%), Gaps = 9/69 (13%)

Query: 31  GTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEESLKARKKQIRQSN 90
           G+PL + VK   K  V   D E+P            A   + P+S E       ++  SN
Sbjct: 198 GSPLLIGVKSENKLKVDFVDVEFP---------NENAIQTETPLSNECKTDNNDELNSSN 248

Query: 91  REKIKQRNF 99
              + ++ F
Sbjct: 249 YPTVDKKEF 257

>NDAI0F00540 Chr6 (125324..126148) [825 bp, 274 aa] {ON} Anc_5.665
          Length = 274

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 47  ALEDSEYPEWLWTVLDQTNTAAAAKAPVSE---ESLKARKKQIRQSNREKIKQRNFLNQL 103
           AL D++  E+   + DQ  + AA    + E   ESLK+ +KQ+       IK + F NQL
Sbjct: 82  ALADTDADEYFDFLQDQILSKAAFTTSLIENQIESLKSYEKQLLLQKNIIIKNKRFSNQL 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.125    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,902,857
Number of extensions: 357143
Number of successful extensions: 1258
Number of sequences better than 10.0: 41
Number of HSP's gapped: 1242
Number of HSP's successfully gapped: 41
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)