Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I07183g5.476ON77177135410.0
NCAS0H022805.476ON6571324555e-47
NDAI0C013805.476ON7671294578e-47
TDEL0A034005.476ON8101284171e-41
ZYRO0D11286g5.476ON7171324081e-40
Skud_15.3035.476ON7481474011e-39
YOR140W (SFL1)5.476ON7661463992e-39
Smik_15.3195.476ON7621373992e-39
Suva_8.1915.476ON7581453964e-39
KNAG0B040405.476ON8521563904e-38
KLTH0F14982g5.476ON8281283851e-37
Kwal_55.212545.476ON8531273798e-37
AFR136C5.476ON6951283713e-36
Ecym_23125.476ON7561323716e-36
SAKL0G03586g5.476ON8531323602e-34
KLLA0E03191g5.476ON7701283467e-33
Kpol_1062.85.77ON4331462072e-16
TDEL0G010105.77ON3981301972e-15
Kpol_265.24.385ON5491281984e-15
SAKL0H02354g5.77ON3851291929e-15
KLTH0D17182g4.385ON4641311931e-14
TPHA0A052505.77ON6011511932e-14
TBLA0A107004.385ON5871321904e-14
TPHA0C001504.385ON5101311894e-14
NCAS0E038705.77ON3931291866e-14
KAFR0B044105.77ON4651311861e-13
SAKL0B12408g4.385ON4651381851e-13
Kwal_47.167704.385ON4611351841e-13
YGL073W (HSF1)6.209ON8331281834e-13
KNAG0F020206.209ON7711281824e-13
CAGL0F09097g4.385ON6301281815e-13
NCAS0A064504.385ON6091321816e-13
KAFR0B069904.385ON5451281806e-13
Skud_7.2086.209ON8361281817e-13
KLLA0A05368g5.77ON4121281778e-13
ADL388W4.385ON4821281789e-13
NDAI0B009405.77ON5261291781e-12
Smik_7.2096.209ON8371281791e-12
TPHA0H011305.77ON4391521771e-12
KLLA0D03322g6.209ON6771311772e-12
KLTH0H00814g5.77ON3901521742e-12
Ecym_74744.385ON4961281752e-12
AEL216C5.77ON4501281733e-12
Smik_16.585.77ON4531291733e-12
Suva_7.1976.209ON8461281753e-12
TDEL0D003204.385ON5471261743e-12
SAKL0A04576g6.209ON5571301734e-12
TBLA0G02700singletonON4451291724e-12
ZYRO0G08734g6.209ON5721251734e-12
KLLA0A10219g4.385ON4751281725e-12
Smik_8.2964.385ON6251071735e-12
TBLA0A020006.209ON627651727e-12
Suva_15.4124.385ON6171071727e-12
Skud_7.5825.77ON4521291707e-12
KLTH0H04290g6.209ON569671718e-12
YHR206W (SKN7)4.385ON6221071718e-12
TDEL0E051706.209ON546671709e-12
Suva_7.5445.77ON4691291691e-11
Skud_8.2734.385ON6231071701e-11
NDAI0D034304.385ON5971291701e-11
AFL085C6.209ON5691271701e-11
KAFR0C022506.209ON6131301701e-11
YGR249W (MGA1)5.77ON4561291681e-11
ZYRO0G00484g4.385ON6471261692e-11
Kwal_56.240366.209ON567671672e-11
NCAS0D037806.209ON7601301646e-11
Ecym_22086.209ON529671628e-11
KNAG0K004705.77ON4141521618e-11
TPHA0E028806.209ON718641639e-11
CAGL0F08195g5.77ON3251321591e-10
ZYRO0C11506g5.77ON3341291581e-10
KNAG0M001804.385ON6151271592e-10
NDAI0I011106.209ON905651583e-10
Ecym_55735.77ON5721411574e-10
Kpol_1033.466.209ON7171231557e-10
Kpol_1050.795.77ON4331441511e-09
CAGL0H03443g6.209ON7061321512e-09
TBLA0E049804.385ON7911351495e-09
Skud_10.3734.385ON346841216e-06
Suva_12.2414.385ON349701064e-04
YJR147W (HMS2)4.385ON3581051054e-04
Smik_10.4424.385ON34763910.025
KNAG0H025905.190ON198054734.8
Suva_14.2492.199ON124492717.7
NDAI0A004601.46ON57693708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I07183g
         (771 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...  1368   0.0  
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    179   5e-47
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   180   8e-47
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   165   1e-41
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   161   1e-40
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...   159   1e-39
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...   158   2e-39
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...   158   2e-39
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   157   4e-39
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   154   4e-38
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   152   1e-37
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   150   8e-37
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   147   3e-36
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   147   6e-36
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   143   2e-34
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   137   7e-33
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    84   2e-16
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    80   2e-15
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    81   4e-15
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    79   9e-15
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    79   1e-14
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    79   2e-14
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    78   4e-14
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    77   4e-14
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      76   6e-14
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    76   1e-13
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    76   1e-13
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    75   1e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    75   4e-13
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    75   4e-13
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    74   5e-13
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    74   6e-13
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    74   6e-13
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    74   7e-13
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    73   8e-13
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    73   9e-13
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    73   1e-12
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    74   1e-12
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    73   1e-12
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    73   2e-12
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    72   2e-12
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    72   2e-12
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    71   3e-12
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    71   3e-12
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    72   3e-12
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    72   3e-12
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    71   4e-12
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               71   4e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    71   4e-12
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    71   5e-12
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    71   5e-12
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    71   7e-12
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    71   7e-12
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    70   7e-12
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    70   8e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    70   8e-12
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    70   9e-12
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    70   1e-11
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    70   1e-11
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     70   1e-11
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    70   1e-11
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    70   1e-11
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    69   1e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    70   2e-11
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    69   2e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     68   6e-11
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    67   8e-11
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    67   8e-11
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    67   9e-11
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    66   1e-10
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    65   1e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    66   2e-10
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    65   3e-10
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    65   4e-10
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    64   7e-10
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    63   1e-09
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    63   2e-09
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    62   5e-09
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    51   6e-06
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    45   4e-04
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    45   4e-04
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    40   0.025
KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5....    33   4.8  
Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL09...    32   7.7  
NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}...    32   8.5  

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/771 (87%), Positives = 677/771 (87%)

Query: 1   MSEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITS 60
           MSEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITS
Sbjct: 1   MSEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITS 60

Query: 61  FVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFK 120
           FVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFK
Sbjct: 61  FVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFK 120

Query: 121 KGDLENLKLIKRRSSSRTIPXXXXXXXXXXXXXXXXXDGAEIDNVKVIASAVHNATEHLX 180
           KGDLENLKLIKRRSSSRTIP                 DGAEIDNVKVIASAVHNATEHL 
Sbjct: 121 KGDLENLKLIKRRSSSRTIPSLSLASSNTNTSTLETNDGAEIDNVKVIASAVHNATEHLK 180

Query: 181 XXXXXXXXXXXXXXXXXXXXNEPTVDISNTETTSAAITNESEQSSNKRATRVYKSVGTIS 240
                               NEPTVDISNTETTSAAITNESEQSSNKRATRVYKSVGTIS
Sbjct: 181 KKDKVKKEGKKSSKKSTKLKNEPTVDISNTETTSAAITNESEQSSNKRATRVYKSVGTIS 240

Query: 241 NQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDGQSIDXXXXXXXXXXXXXXXTTEIPTD 300
           NQD                            VDGQSID               TTEIPTD
Sbjct: 241 NQDSKNPEKLTKKPKKNSNLKNKGKKSKSNSVDGQSIDNIQPNENQPINIQVNTTEIPTD 300

Query: 301 NTLHHYNETLYEQSIQLNHQIAQMRNTNMDMLAILELMSKLAEMNKEVLNINNSEKIPEL 360
           NTLHHYNETLYEQSIQLNHQIAQMRNTNMDMLAILELMSKLAEMNKEVLNINNSEKIPEL
Sbjct: 301 NTLHHYNETLYEQSIQLNHQIAQMRNTNMDMLAILELMSKLAEMNKEVLNINNSEKIPEL 360

Query: 361 MANHYRFFDAQLTSLKNNILDRINNTNIHKFGMDSNDLRSASQTNIHLSHPIAQNMVYSS 420
           MANHYRFFDAQLTSLKNNILDRINNTNIHKFGMDSNDLRSASQTNIHLSHPIAQNMVYSS
Sbjct: 361 MANHYRFFDAQLTSLKNNILDRINNTNIHKFGMDSNDLRSASQTNIHLSHPIAQNMVYSS 420

Query: 421 ADQAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNYSKNQVVQHPQAANDYFSSVHVQTANP 480
           ADQAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNYSKNQVVQHPQAANDYFSSVHVQTANP
Sbjct: 421 ADQAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNYSKNQVVQHPQAANDYFSSVHVQTANP 480

Query: 481 FEKFQTEKNGIINVTARRHMSVLVDPLTPASMMSVPTTTQSSLSGPSLYNQQHAIIFPHD 540
           FEKFQTEKNGIINVTARRHMSVLVDPLTPASMMSVPTTTQSSLSGPSLYNQQHAIIFPHD
Sbjct: 481 FEKFQTEKNGIINVTARRHMSVLVDPLTPASMMSVPTTTQSSLSGPSLYNQQHAIIFPHD 540

Query: 541 LNQAFNSRSEPTITPITGHHSNFTRASDSNLMNTKQTIVNSMKNRASYPSRRTESPLKYS 600
           LNQAFNSRSEPTITPITGHHSNFTRASDSNLMNTKQTIVNSMKNRASYPSRRTESPLKYS
Sbjct: 541 LNQAFNSRSEPTITPITGHHSNFTRASDSNLMNTKQTIVNSMKNRASYPSRRTESPLKYS 600

Query: 601 SGMPIEEEQRWEYKITKDNGRNTDIPQLPSNQCQIDSPVPVRSPYNKFVSPHSFYAGGRN 660
           SGMPIEEEQRWEYKITKDNGRNTDIPQLPSNQCQIDSPVPVRSPYNKFVSPHSFYAGGRN
Sbjct: 601 SGMPIEEEQRWEYKITKDNGRNTDIPQLPSNQCQIDSPVPVRSPYNKFVSPHSFYAGGRN 660

Query: 661 ISPPMNGNVDMLAQRPSTEVVSLTSSDNKIDNAVVIKRSSTANPILRGXXXXXXXXXXXX 720
           ISPPMNGNVDMLAQRPSTEVVSLTSSDNKIDNAVVIKRSSTANPILRG            
Sbjct: 661 ISPPMNGNVDMLAQRPSTEVVSLTSSDNKIDNAVVIKRSSTANPILRGSSSEKENKESSN 720

Query: 721 XLIGSTVTEKTSRTKRNSSGVYSLLNGTIKEEKANETFIDTDSHVDKKIKL 771
            LIGSTVTEKTSRTKRNSSGVYSLLNGTIKEEKANETFIDTDSHVDKKIKL
Sbjct: 721 KLIGSTVTEKTSRTKRNSSGVYSLLNGTIKEEKANETFIDTDSHVDKKIKL 771

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  179 bits (455), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 107/132 (81%), Gaps = 1/132 (0%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           NT+FI+KLY++LE+KDL+DLIWW+++G+SF I+P+E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK+SNDH + +       S+ +++ G    +  +E IK+WEFKHS G+FKKGD+E L
Sbjct: 107 YGFHKVSNDHQY-INYPNNNNSNDNDSKGKEREDLTNETIKIWEFKHSAGIFKKGDVEGL 165

Query: 128 KLIKRRSSSRTI 139
           KLIKRRSSSR I
Sbjct: 166 KLIKRRSSSRNI 177

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  180 bits (457), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 82/129 (63%), Positives = 106/129 (82%), Gaps = 3/129 (2%)

Query: 6   GGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQL 65
             NT+FI+KLY++LE+KDL+DLIWW+ +G+SFLIRP+E FS+ LA YFKHTNITSFVRQL
Sbjct: 75  SSNTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQL 134

Query: 66  NIYGFHKISNDH-FHNLKREKKQKSSTDN--NTGVSNNNSGDENIKVWEFKHSGGLFKKG 122
           NIYGFHK+SNDH + N K E    ++  N  NT V+NN + +E +K+WEFKHS G+F+KG
Sbjct: 135 NIYGFHKVSNDHQYINNKTEDDTTTNVTNHANTDVNNNITDNEQVKIWEFKHSAGIFRKG 194

Query: 123 DLENLKLIK 131
           D+E+LKLIK
Sbjct: 195 DVESLKLIK 203

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  165 bits (417), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 101/128 (78%), Gaps = 8/128 (6%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           NTVFI+KLY++LE+ DL DLIWW+ +G SFLIRP+E FS+ LA YFKHTNI SFVRQLN+
Sbjct: 49  NTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFVRQLNM 108

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK+SNDH   ++++++Q+  +        + +G + +K+WEF+HS G+FK+GD+E L
Sbjct: 109 YGFHKVSNDHNKGIQQQQQQQQPS--------SEAGQDGVKIWEFRHSMGIFKRGDIEGL 160

Query: 128 KLIKRRSS 135
           K IKRRSS
Sbjct: 161 KFIKRRSS 168

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  161 bits (408), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 99/132 (75%), Gaps = 4/132 (3%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           +TVFI+KLY++LE+ DL DLIWW+ +G SFLIRP E FS+ LA YFKHTNI SFVRQLN+
Sbjct: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNM 135

Query: 68  YGFHKISNDHF----HNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGD 123
           YGFHK+SNDH     H+     +  +S  ++   ++N    E+IK+W+F+HS GLFK+GD
Sbjct: 136 YGFHKVSNDHGKSSEHDSASNSRTNNSNSSDNNNNSNADVQEDIKIWKFRHSTGLFKRGD 195

Query: 124 LENLKLIKRRSS 135
           +E LK IKRRSS
Sbjct: 196 IEGLKYIKRRSS 207

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 90/216 (41%), Gaps = 37/216 (17%)

Query: 306 YNETLYE-QSIQLNH--QIAQMRNTNMDMLAILELMSKLAEMNKEVLNINNSEKIPELMA 362
           YN   YE  S+Q  H   +  ++  NMDM+ +LEL+  L  +        +SE  P+   
Sbjct: 370 YNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQ------TSSEPSPQ--- 420

Query: 363 NHYRFFDAQLTSLKNNILDRINNTNIHKFGMDSNDLRSASQTNIHLSHPIAQNMVYSSAD 422
             +   + +L   K  ++ R++  +          ++  SQ +   + P++   V +S  
Sbjct: 421 -EFSGLEQELLRFKALLMSRVHRNS-------DAQVQQPSQRSFGENRPLSSISVPTSHS 472

Query: 423 QAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNYSKNQVVQHPQAA--------NDYFSSVH 474
             +P  V +      R S       PA     + +  V  P  A         D+FS   
Sbjct: 473 N-VPSLVQHVFAVPARPSSAVNVVQPASTTGSASSAPVPAPTPAPPPPPPQATDHFSGPR 531

Query: 475 VQTANPFEKFQTEKNGIINVTARRHMSVLVDPLTPA 510
           +   NPFE   +  NG     ++R+MS+L+DPL PA
Sbjct: 532 MMMMNPFE---STGNG-----SKRNMSILMDPLAPA 559

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 20/147 (13%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           N +FI+KLY +LE+  L DLIWW+++G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 44  NAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 103

Query: 68  YGFHKISNDHFHNLKREKKQK-----SSTDNNTGVSNNNSGDEN---------------I 107
           YGFHK+S+DH  N             +ST+++ G S N+SG+EN                
Sbjct: 104 YGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNSSGEENNGATVQEKEKEKSNPT 163

Query: 108 KVWEFKHSGGLFKKGDLENLKLIKRRS 134
           K+WEFKHS G+FKKGD+E LK IKRR+
Sbjct: 164 KIWEFKHSSGIFKKGDIEGLKHIKRRA 190

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (67%), Gaps = 20/146 (13%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           N +FI+KLY +LE++ L DLIWW  +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 62  NAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121

Query: 68  YGFHKISNDHFHNLKREKKQKSST------DNNTGVSNNNSGDEN-------------IK 108
           YGFHK+S+DH  N        ++       D+N+G + N+SGDEN              K
Sbjct: 122 YGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSG-NKNSSGDENTGGGVQEKEKSNPTK 180

Query: 109 VWEFKHSGGLFKKGDLENLKLIKRRS 134
           +WEFKHS G+FKKGD+E LK IKRR+
Sbjct: 181 IWEFKHSSGIFKKGDIEGLKHIKRRA 206

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/137 (54%), Positives = 96/137 (70%), Gaps = 14/137 (10%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           N +FI+KLY +LE+  L DLIWW+ +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 62  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 121

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDEN-------------IKVWEFKH 114
           YGFHK+S+DH  N      + ++ D+++G + N SGDEN              K+WEFKH
Sbjct: 122 YGFHKVSHDHSSNDTNGGDEANTNDDSSG-NKNTSGDENNGVSVQEKERSNPTKIWEFKH 180

Query: 115 SGGLFKKGDLENLKLIK 131
           S G+FKKGD+E LK IK
Sbjct: 181 SSGIFKKGDIEGLKHIK 197

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  157 bits (396), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 98/145 (67%), Gaps = 18/145 (12%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           N +FI+KLY +LE+  L DLIWW+ +G SF+I+P E FS+ LA YFKHTNITSFVRQLNI
Sbjct: 58  NAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLNI 117

Query: 68  YGFHKISNDHFHNLKREKKQKSSTD-----NNTGVSNNNSGDEN-------------IKV 109
           YGFHK+S+DH  N        ++ D     ++ G + N+SGDE               K+
Sbjct: 118 YGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGDETTGAGAQEKEKSNPTKI 177

Query: 110 WEFKHSGGLFKKGDLENLKLIKRRS 134
           WEFKHS G+FKKGD+E+LK IKRR+
Sbjct: 178 WEFKHSSGIFKKGDIESLKHIKRRA 202

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  154 bits (390), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 100/156 (64%), Gaps = 24/156 (15%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           NTVFI+KLY +LE+  L DLIWWA NG SF IRP+E+FS+ LA YFKHTNITSFVRQLNI
Sbjct: 62  NTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLNI 121

Query: 68  YGFHKISN----DHFHNLKREKKQKS------STDNNT-----GV---------SNNNSG 103
           YGFHK++N      F  +  + +  S        D NT     GV         S   + 
Sbjct: 122 YGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPGAT 181

Query: 104 DENIKVWEFKHSGGLFKKGDLENLKLIKRRSSSRTI 139
              +K+WEFKHS  LF++GD+E LK IKRRSS+++I
Sbjct: 182 SSPVKIWEFKHSANLFRRGDIEGLKFIKRRSSAKSI 217

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  152 bits (385), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (69%), Gaps = 7/128 (5%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           NT FI+KLY +LE+ ++D+LIWW+    SFLIRP+E F + LA YFKHTN+ SFVRQLN+
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK+++   H   +    K  TD+    S N +      +WEFKHS   F++GD+E+L
Sbjct: 131 YGFHKVNDHKTHAASKNGAAK--TDDPASKSENTTS-----IWEFKHSSSAFRRGDMESL 183

Query: 128 KLIKRRSS 135
           KLIKRRSS
Sbjct: 184 KLIKRRSS 191

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 103/275 (37%), Gaps = 73/275 (26%)

Query: 316 QLNHQIAQMRNTNMDMLAILELMSKLAEMNKEVLNINN---SEKI------------PEL 360
           Q    +  +RN+NMDM+ +L+L+  L  +  ++   ++   SE I            P  
Sbjct: 391 QYEAAVEDLRNSNMDMVRLLDLVHNLVTLTPQLAAASSGRPSEGIKRSTTPVSGHPNPSE 450

Query: 361 MANHYRFFDAQ----------LTSLKNNILDRINNTN--------IHKFG----MDSNDL 398
           M    R   +Q          +  LKN+ L R+  +         +H F       S+ +
Sbjct: 451 MGTSPRDTPSQQQCMDQIMSEIARLKNSTLYRLQRSTMLQQTVRPVHSFSEYPMTSSSAI 510

Query: 399 RSASQTNIH----LSHPIAQNMVYSSADQAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNY 454
            +AS+  +     LS P    +       A P  +P  +       P  G +   G    
Sbjct: 511 PAASRPPLSNQTSLSSPALSQLT-----NAQPAPLPQ-MSHAMYYPPAYGPSVYPGT--- 561

Query: 455 SKNQVVQHPQAANDYFS--------SVHVQTANPFEKFQTEKNGIINVTARRHMSVLVDP 506
                   P   +DYF         S+     NPFEK  +      + +  R+MSVL+DP
Sbjct: 562 --------PGPQSDYFGTTAKANSGSMPYLMMNPFEKKTS-----TSSSGNRNMSVLMDP 608

Query: 507 LTPASMM-SVPTTTQSSLSGP-SLYNQQHAIIFPH 539
           L PA ++ ++P  + S+   P     QQH     H
Sbjct: 609 LAPAPIVQALPGVSTSASPNPNQQIAQQHGYFAGH 643

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  150 bits (379), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (68%), Gaps = 1/127 (0%)

Query: 9   TVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNIY 68
           T FI+KLY +LE++++ +LIWW+ +  SFLIRP+E FS+ LA YFKHTN+ SFVRQLN+Y
Sbjct: 58  TAFIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMY 117

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           GFHK+ NDH  +  +        +           D +  VWEFKHS   F++GD+E+LK
Sbjct: 118 GFHKV-NDHKAHGAKSGAANKGEEAGLKTRGGQPTDNSTSVWEFKHSSAAFRRGDMESLK 176

Query: 129 LIKRRSS 135
           LIKRRSS
Sbjct: 177 LIKRRSS 183

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 99/243 (40%), Gaps = 58/243 (23%)

Query: 314 SIQLNHQIA--QMRNTNMDMLAILELMSKLAEMNKEVLNINNSEK--------------- 356
           S Q  ++IA   +RN+NMDM+ +L+L+  L  ++ ++   NN ++               
Sbjct: 396 SYQTQYEIAVEDLRNSNMDMIKLLDLVHSLVTVSPQLSGANNRKQDEVKRSTTPVSGMPA 455

Query: 357 ------IPELMANHYRFFD---AQLTSLKNNILDRINNTNIHKFGM-DSNDL-------- 398
                  P+  +   ++ D    ++  LKN+ L R+  + + + GM  S+ L        
Sbjct: 456 SNDFSESPKDGSLQQQYLDNIMGEIARLKNSTLYRVQRSALLQQGMRPSSSLEHPTAAAT 515

Query: 399 --------RSASQTNIHLSHPIAQNMVYSSADQAIPKSV-PYYLKQGQRTSPDNGTTTPA 449
                   R+A  T   +S P    M  +    ++P+   P Y +     +P    T   
Sbjct: 516 TYPMAFPGRAALSTQTSMSSPALSQMA-TGHHASLPQMTHPMYYQPA--YTPSAYPTIAG 572

Query: 450 GAQNYSKNQVVQHPQAANDYFSSVHVQTANPFEKFQTEKNGIINVTARRHMSVLVDPLTP 509
              +Y     ++ P A      S      NPFEK      G  + +  R+MSVL+DPL P
Sbjct: 573 PVSDYYGTAAIKAPGA------SAPCLKMNPFEK-----KGSTSSSRNRNMSVLMDPLAP 621

Query: 510 ASM 512
           A M
Sbjct: 622 APM 624

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  147 bits (371), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 70/128 (54%), Positives = 90/128 (70%), Gaps = 15/128 (11%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           NT FI+KLY +LE+ ++ DLIWW+A+  SFLI+P+E FS+ LA +FKHTN+ SFVRQLN+
Sbjct: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK+S DH    K    + +S D           DE I +WEF+HS G F+KGD E+L
Sbjct: 84  YGFHKVS-DH----KPSSAKGTSQDE----------DEAINLWEFRHSMGCFRKGDKESL 128

Query: 128 KLIKRRSS 135
           K IKRRSS
Sbjct: 129 KSIKRRSS 136

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  147 bits (371), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 96/132 (72%), Gaps = 8/132 (6%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           +T FI+KLY +LE++++ DLIWW+ +  SFLI+P+E FS+ LA +FKHTN+ SFVRQLN+
Sbjct: 70  STAFIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 129

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK+S DH     +  ++ S TD   G  N +  +++I +WEF+HS G F+KGD E+L
Sbjct: 130 YGFHKVS-DH-----KSNEKSSETDGAHG--NGDIEEDSINLWEFRHSLGCFRKGDKESL 181

Query: 128 KLIKRRSSSRTI 139
           K IKRRSS   I
Sbjct: 182 KSIKRRSSKNQI 193

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 479 NPFEKFQTEKNGIINVTARRHMSVLVDPLTP----ASMMSVPTTTQSSLSGPSLYNQQHA 534
           NPF K ++ ++    +  +RHMSV +DPL P    ++  S PT     LSGP +     +
Sbjct: 477 NPFAKRKSTES----LPKKRHMSVFMDPLAPVPQQSASTSAPTNINEPLSGPHILGGTSS 532

Query: 535 IIFPHDLNQAFNSRSE 550
              P +L+   +SR +
Sbjct: 533 PFVPTNLSSRISSRQD 548

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 95/132 (71%), Gaps = 11/132 (8%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           +T FI+KLY +LE++++ DLIWW+   +SFLI+P+E FS+ LA +FKHTN+ SFVRQLN+
Sbjct: 42  HTAFIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 101

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGFHK++++       ++  K STD+ +      + +++I +WEFKHS   F+KGD+E L
Sbjct: 102 YGFHKVNDN-----TGKQTDKYSTDSAS------TNEDSINLWEFKHSSSAFRKGDMEGL 150

Query: 128 KLIKRRSSSRTI 139
           K IKRRSS   I
Sbjct: 151 KTIKRRSSRNPI 162

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  137 bits (346), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 90/128 (70%), Gaps = 15/128 (11%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67
           N  FI+KLY +LE+ DL +LIWW+ + +SFLIRP+E FS+ L+ +FKHTN+ SFVRQLN+
Sbjct: 85  NPHFIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQLNM 144

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127
           YGF K+S DH          KS+   NT    ++S + +I +WEFKHS G F+KGD E+L
Sbjct: 145 YGFQKVS-DH----------KSTWAANT----DDSDEPSINLWEFKHSSGYFRKGDTESL 189

Query: 128 KLIKRRSS 135
           K IKR SS
Sbjct: 190 KSIKRGSS 197

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 24/146 (16%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP-SESFS-QNLAHYFKHTNITSFVRQLNI 67
           F+++LY +L   DL D I+W+ +  S F I+P S  FS Q L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTD-----------------NNTGVSNNNSGDENIKVW 110
           YGFHK+S  H  N +   K  ++TD                 ++         D ++ +W
Sbjct: 66  YGFHKLS--HL-NKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLTIW 122

Query: 111 EFKHSGGLFKK-GDLENLKLIKRRSS 135
            F H  G F K  D+ NL+ I+R+S+
Sbjct: 123 YFTHPSGYFHKNADILNLEKIQRKST 148

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 74/130 (56%), Gaps = 18/130 (13%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRPSES-FSQN-LAHYFKHTNITSFVRQLNI 67
           FI++LY +L+   L + I W  + +S F+++P +  FS+  L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKK-GDLEN 126
           YGFHKI+N       +E   +  +D          GD     W F H  G F+K  DL +
Sbjct: 66  YGFHKITN------PQEGLGEGRSDEQ--------GDRATTRWFFAHPLGYFRKDADLAS 111

Query: 127 LKLIKRRSSS 136
           LK I+R+S+ 
Sbjct: 112 LKKIQRKSTG 121

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 23/128 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIYG 69
           F+ K+Y +LE  D  D++ W  NG+SF++  + SF SQ L ++FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQLNKYD 146

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR ++++ +            G+ +   WEF H   LFK+    NL  
Sbjct: 147 FHKV--------KRTQEERKAC---------QYGELS---WEFNHP--LFKRNQEANLDN 184

Query: 130 IKRRSSSR 137
           IKR+++++
Sbjct: 185 IKRKAATQ 192

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 17/129 (13%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP--SESFSQNLAHYFKHTNITSFVRQLNI 67
           FI++L+ +L+ +DLD  I+W++  ++ F ++P   E  SQ L  YFKH N++SFVRQL++
Sbjct: 6   FIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLE-N 126
           YGFHKI++             S+   +   +N  + +++  +W F H  G F +      
Sbjct: 66  YGFHKIAS-------------SNAPQSQIAANTTANNKDSVIWNFTHPSGNFHRDSTTVE 112

Query: 127 LKLIKRRSS 135
           L  I+R+SS
Sbjct: 113 LSKIQRKSS 121

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 72/131 (54%), Gaps = 23/131 (17%)

Query: 6   GGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQ 64
            G+  F+ KL+ +LE  + +D+I W  +G+SF++  +  F+   L  +FKH+N +SFVRQ
Sbjct: 25  AGSNDFVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQ 84

Query: 65  LNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDL 124
           LN Y FHKI        KR  ++K          N+  G+ +   WEFKH    FK  D 
Sbjct: 85  LNKYDFHKI--------KRTNEEK---------QNSQYGEHS---WEFKHP--FFKIHDE 122

Query: 125 ENLKLIKRRSS 135
           + L  IKR+S+
Sbjct: 123 DQLDNIKRKSA 133

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 77/151 (50%), Gaps = 28/151 (18%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGES-FLIRP-SESFSQN-LAHYFKHTNITSFVRQLN 66
           VFI++LY +L+  DL + I W  + +  F I+P   +FSQ  L  YFKH N TSFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 67  IYGFHKIS----------------------NDHFHNLKREKKQKSSTDNNTGVSNN-NSG 103
           +YGFHK+S                      N         +K  S +D + G S N  +G
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 104 DENIKVWEFKHSGGLFKKG-DLENLKLIKRR 133
            E+I+ W F H  GLF KG D+  L  I+R+
Sbjct: 123 KEDIE-WYFTHPSGLFHKGSDVVTLNKIQRK 152

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 74/132 (56%), Gaps = 24/132 (18%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIYG 69
           F+  +Y +LE +D  D+I W+  G+SFL+  +  F SQ L ++FKH+N  SFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR +++K              G+++   WEF H   LFK+   + L  
Sbjct: 127 FHKV--------KRTQEEKKKW---------KYGEQS---WEFCHP--LFKRNHDDGLNN 164

Query: 130 IKRRSSS-RTIP 140
           IKR++SS + IP
Sbjct: 165 IKRKTSSQKKIP 176

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 72/131 (54%), Gaps = 23/131 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIYG 69
           F+ K+Y +LE  +  +++ W   G+SF++  +  F SQ L ++FKH+N  SFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR ++++              G+ +   WEFKH   LFK+G  ENL  
Sbjct: 111 FHKV--------KRTQEERKVW---------QYGELS---WEFKHP--LFKRGQEENLDN 148

Query: 130 IKRRSSSRTIP 140
           IKR+  ++  P
Sbjct: 149 IKRKIGTQKKP 159

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 23/129 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAA-NGESFLIRPSE-SFSQN-LAHYFKHTNITSFVRQLNI 67
           FI++L+ +L+   LDD I W++ +   F+++P + +FS   L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKG-DLEN 126
           YGFHKI+  H +N     K ++                   +W FKH  G F +   L++
Sbjct: 66  YGFHKIATVHNNNNVVNDKVQT-------------------IWHFKHPSGNFTRDVHLDS 106

Query: 127 LKLIKRRSS 135
           LK I+R+S+
Sbjct: 107 LKKIQRKST 115

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/131 (38%), Positives = 78/131 (59%), Gaps = 6/131 (4%)

Query: 11  FINKLYDLLENKDLDDLIWWA-ANGESFLIRPSE-SFS-QNLAHYFKHTNITSFVRQLNI 67
           FI++L+ +L+  DL +LI W+      FL++P + +FS Q L  YFKH NI+SFVRQL++
Sbjct: 6   FIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLHM 65

Query: 68  YGFHKI-SNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKV-WEFKH-SGGLFKKGDL 124
           YGFHK+ S++H  N        ++T NN  ++  N   +   V W F H SG  ++  D 
Sbjct: 66  YGFHKLPSHNHMTNSTANTTTTATTINNNDMNFENRDKDKASVEWHFTHPSGHFYRDADA 125

Query: 125 ENLKLIKRRSS 135
             L  I+R+S+
Sbjct: 126 STLNKIQRKSA 136

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 77/138 (55%), Gaps = 24/138 (17%)

Query: 1   MSEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNIT 59
           +S+K GG+  F+ KL+++LE  +  D++ W   G+SF++  +  F+   L  +FKH+N  
Sbjct: 17  LSQK-GGSNDFVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFA 75

Query: 60  SFVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLF 119
           SFVRQLN Y FHK+        KR  ++K          N+  G+ +   WEF H    F
Sbjct: 76  SFVRQLNKYDFHKV--------KRTSEEK---------QNSQYGEHS---WEFNHP--YF 113

Query: 120 KKGDLENLKLIKRRSSSR 137
           +  D ++L  IKR+++++
Sbjct: 114 RIHDEDSLDKIKRKTATQ 131

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 73/135 (54%), Gaps = 23/135 (17%)

Query: 2   SEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITS 60
           S +  G+  F+ KL+ +LE  +  D+I W A+G+SF++  +  F+   L  +FKH+N +S
Sbjct: 20  SAQKAGSNDFVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSS 79

Query: 61  FVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFK 120
           FVRQLN Y FHKI        KR  ++K          N+  G+ +   WEF H    FK
Sbjct: 80  FVRQLNKYDFHKI--------KRTSEEK---------QNSEYGEHS---WEFNHPH--FK 117

Query: 121 KGDLENLKLIKRRSS 135
             + + L  IKR+S+
Sbjct: 118 IHNEDQLDNIKRKSA 132

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 23/128 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L +     LI WA +G+SF++   E F  Q L  YFKH+N  SFVRQLN+Y
Sbjct: 174 AFVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 233

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+      ++K    Q SS D                 W+F++   +  + DL   K
Sbjct: 234 GWHKV-----QDVKSGSIQSSSDDK----------------WQFENENFIRGREDLLE-K 271

Query: 129 LIKRRSSS 136
           +I+++ SS
Sbjct: 272 IIRQKGSS 279

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (53%), Gaps = 24/128 (18%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L ++   DLI WA +G+SF++   E F  + L  YFKH+N  SFVRQLN+Y
Sbjct: 168 AFVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMY 227

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+                  D  +G   N++ D     W+F++    F+KG  + L 
Sbjct: 228 GWHKVQ-----------------DVKSGSIQNSTDDR----WQFENEH--FQKGREDLLH 264

Query: 129 LIKRRSSS 136
            I R+ S+
Sbjct: 265 KIVRQKST 272

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 75/128 (58%), Gaps = 23/128 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFS-QNLAHYFKHTNITSFVRQLNIYG 69
           F+ KL+++LE+    +++ W+  G+SF++  +  F+ Q L ++FKH+N  SFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHKI   +      E++QKS             G+++   WEF++    FK  D ++L L
Sbjct: 137 FHKIKRTN------EERQKSIY-----------GEQS---WEFENPN--FKINDEKSLDL 174

Query: 130 IKRRSSSR 137
           IKR++ ++
Sbjct: 175 IKRKTPAQ 182

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 30/132 (22%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KLY +LE     D++ W  NG++F++  +  F+++ L ++FKH+N  SFVRQLN Y 
Sbjct: 56  FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFVRQLNKYD 115

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHKI             +K  TD               + WEFKH    F++   E L  
Sbjct: 116 FHKI-------------KKKVTDVE-------------RSWEFKHPS--FRRHFDEGLDN 147

Query: 130 IKRR-SSSRTIP 140
           IKR+ ++S+ +P
Sbjct: 148 IKRKPTTSKRLP 159

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 23/128 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KLY++LEN +  D++ W A G+SF++  +  F+   L ++FKH+N  SFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHKI        K + K+K      +              WEF+H    F+  D   L  
Sbjct: 121 FHKIKT------KPDDKEKLIYGELS--------------WEFQHP--CFRIHDASQLDN 158

Query: 130 IKRRSSSR 137
           IKR+ +S+
Sbjct: 159 IKRKLTSQ 166

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 23/128 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L +     LI WA +G+SF++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 175 AFVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+      ++K    Q SS D                 W+F++   +  + DL   K
Sbjct: 235 GWHKV-----QDVKSGSIQSSSDDK----------------WQFENENFIRGREDLLE-K 272

Query: 129 LIKRRSSS 136
           +I+++ SS
Sbjct: 273 IIRQKGSS 280

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 72/128 (56%), Gaps = 8/128 (6%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP-SESFSQN-LAHYFKHTNITSFVRQLNI 67
           FI++L+ +L   +L + I W+ + ES F+I+P + +FS   L  +FKH N++SFVRQL++
Sbjct: 6   FIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLE-N 126
           YGFHK+     H+         + +N    S NN+  ++   W+F H    F K   E  
Sbjct: 66  YGFHKLP----HSASSTLAASGADNNGATASTNNATSKSEIEWKFTHHSHDFCKSASEAQ 121

Query: 127 LKLIKRRS 134
           LK I R+S
Sbjct: 122 LKRIHRKS 129

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (54%), Gaps = 23/128 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LE+ +  D+I W   G SF++  +  F+ N L  +FKH+N +SFVRQLN Y 
Sbjct: 38  FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 97

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR  +++ S+     V   +S       WEF+H    F++ D   L  
Sbjct: 98  FHKV--------KRTPEERQSS-----VYGEHS-------WEFQHPR--FRRNDEAALDR 135

Query: 130 IKRRSSSR 137
           IKR++ ++
Sbjct: 136 IKRKTVTQ 143

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 72/129 (55%), Gaps = 17/129 (13%)

Query: 11  FINKLYDLLENKDLDDLI-WWAANGESFLIRPSE-SFSQN-LAHYFKHTNITSFVRQLNI 67
           F+N+L+ +L+ K L   I W++     FL++P + +FS+  L  YFKH NI+SFVRQL++
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDL-EN 126
           YGFHKIS++                N+   SN N  +    +W F H  G F +    E 
Sbjct: 66  YGFHKISSNDL-------------PNSILNSNPNPNNRINTIWYFAHPSGFFTQTSTNEI 112

Query: 127 LKLIKRRSS 135
           LK I+R+S+
Sbjct: 113 LKKIQRKST 121

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 23/128 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L +     LI WA +G+SF++   E F  Q L  YFKH+N  SFVRQLN+Y
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 234

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+      ++K    Q SS D                 W+F++   +  + DL   +
Sbjct: 235 GWHKV-----QDVKSGSIQSSSDDK----------------WQFENENFIRGREDLLE-R 272

Query: 129 LIKRRSSS 136
           +I+++ SS
Sbjct: 273 IIRQKGSS 280

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 78/152 (51%), Gaps = 30/152 (19%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRPSES-FSQN-LAHYFKHTNITSFVRQLNI 67
           F+++L+ +L  ++L++ I+W  + ++ F I+P  S FS   L  YFKH N++SFVRQL++
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKS--STDNNTGVSNNN--------------------SGDE 105
           YGFHK+SN +     R K Q S    DN+   S+                        D 
Sbjct: 66  YGFHKLSNSN----NRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDR 121

Query: 106 NIKVWEFKHSGGLF-KKGDLENLKLIKRRSSS 136
              +W F H  G+F K  +  +L  I R+S+S
Sbjct: 122 AKTIWYFTHPSGVFHKNAETSDLDKIHRKSNS 153

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 24/131 (18%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ +K  +  I W+ +GES ++   E F Q  L  YFKH+N  SFVRQLN+Y
Sbjct: 196 AFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMY 255

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+ +                 + + +SNN+S       WEF++    FK+G    L+
Sbjct: 256 GWHKVQD---------------VKSGSMLSNNDS------RWEFENEN--FKRGKEYLLE 292

Query: 129 LIKRRSSSRTI 139
            I R+ S+  I
Sbjct: 293 NIVRQKSNTNI 303

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 72/152 (47%), Gaps = 25/152 (16%)

Query: 8   NTVFINKLYDLLENKDLDDLIWWAANGE---SFLIRPSES-FSQN-LAHYFKHTNITSFV 62
           N  FI++L+ +L+  +L+  I W  + +    F +RP ++ FS N L  YFKH N++SFV
Sbjct: 3   NKTFIHQLHAILQQPELERWIRWEPDEQLRGVFSLRPHDAAFSTNVLKRYFKHGNVSSFV 62

Query: 63  RQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSG------------------- 103
           RQL++YGFHK++              +S   + G S    G                   
Sbjct: 63  RQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGTSSADGSAGAAATTAGTKS 122

Query: 104 DENIKVWEFKHSGGLF-KKGDLENLKLIKRRS 134
            ++  VW+F H  G F +   +  L  I+R+S
Sbjct: 123 GKSAVVWQFSHPSGAFCRDSTMSELGRIQRKS 154

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 69/128 (53%), Gaps = 23/128 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LE+ +  ++I W  +G SF++  +  F+ N L  +FKH+N +SFVRQLN Y 
Sbjct: 43  FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 102

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR  +++ ++D                 WEF+H    F++ D   L  
Sbjct: 103 FHKV--------KRTPEERQNSDYGK------------HSWEFQHPK--FRRSDEAALDR 140

Query: 130 IKRRSSSR 137
           IKR++ ++
Sbjct: 141 IKRKTVTQ 148

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 66/128 (51%), Gaps = 10/128 (7%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP--SESFSQNLAHYFKHTNITSFVRQLNI 67
           FI++L+ +L ++ L+  I W+A  +  F ++P   E     L   FKH N++SFVRQL++
Sbjct: 6   FIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVRQLHL 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLE-N 126
           YGFHK+                + DN        S  E++ VW F H  G F KG  + +
Sbjct: 66  YGFHKLQTG-----PGAASSGPAGDNEPPTHIIKSNKESM-VWYFTHPSGYFYKGACQPD 119

Query: 127 LKLIKRRS 134
           L  I+R+S
Sbjct: 120 LARIQRKS 127

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 20/129 (15%)

Query: 11  FINKLYDLLENKDLDDLIWWA-ANGESFLIRPSE-SFSQN-LAHYFKHTNITSFVRQLNI 67
           F+++L+ +L   +++  I+W+  +   F ++P + +FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKH-SGGLFKKGDLEN 126
           YGFHK+S+              S D    VS NN   + +  W+F H SG  FK+ +   
Sbjct: 66  YGFHKLSHP-------------SPDQ---VSTNNGNVKELVEWKFTHPSGFFFKEANAGV 109

Query: 127 LKLIKRRSS 135
           L  I+R+S+
Sbjct: 110 LNKIQRKST 118

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 23/128 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L +     LI WA +G+SF++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+      ++K    Q SS             DE    W+F++   +  + DL   K
Sbjct: 235 GWHKV-----QDVKSGSIQSSS-------------DEK---WQFENENFIRDREDLLE-K 272

Query: 129 LIKRRSSS 136
           +I+++ SS
Sbjct: 273 IIRQKGSS 280

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 23/126 (18%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFS-QNLAHYFKHTNITSFVRQLNIYG 69
           F+ KLY +LE  +  D++ W   GESF++  +  F+ Q L ++FKH+N  SFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+          E++Q S     +              WEFKH    F   + E L  
Sbjct: 94  FHKVKK------TPEERQTSQYGELS--------------WEFKHP--FFTIHNEEALDN 131

Query: 130 IKRRSS 135
           IKR+++
Sbjct: 132 IKRKTT 137

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 23/130 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ +     LI W+ +G+SF++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 165 AFVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMY 224

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+                  D  +G   NNS +     W+F++   +  K +L + K
Sbjct: 225 GWHKVQ-----------------DVRSGSIQNNSDER----WQFQNEHFVRDKEELLD-K 262

Query: 129 LIKRRSSSRT 138
           +++++SS  T
Sbjct: 263 IVRQKSSGST 272

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (56%), Gaps = 25/129 (19%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+NKL+++L+     D+I W  +G+SFL+   E F  + L +YFKH+N  SFVRQLN+YG
Sbjct: 121 FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMYG 180

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSN-NNSGDENIKVWEFKHSGGLFKKGD-LENL 127
           +HK+                  D  +G  N  N+ DE    W+F++   +  + D LEN 
Sbjct: 181 WHKVQ-----------------DIRSGSMNMANTNDEK---WQFENQNFIRGREDLLEN- 219

Query: 128 KLIKRRSSS 136
            +I+++SSS
Sbjct: 220 -IIRQKSSS 227

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 24/125 (19%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIY 68
           +F+NK++ +L ++   +LI WA +G+SF++   E F  Q L  YFKH+N  SFVRQLN+Y
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+                  D  +G   N+S D+    W+F++    F +G  + L+
Sbjct: 172 GWHKVQ-----------------DVKSGSIQNSSDDK----WQFENE--FFIRGREDLLQ 208

Query: 129 LIKRR 133
            I R+
Sbjct: 209 HIVRQ 213

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 25/128 (19%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LE+++   +I W+ +G++F++  +  F+ + L  +FKH+N  SFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        KR+K + S      G+ N          WEF H    F++ D   L  
Sbjct: 103 FHKV--------KRKKNEVSE-----GIQN---------AWEFNHQ--YFRRHDEAGLDN 138

Query: 130 IKRRSSSR 137
           I+R+ SS+
Sbjct: 139 IRRKPSSQ 146

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 25/107 (23%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LEN +  D++ W  NG+SF++  +  F+ + L ++FKH+N  SFVRQLN Y 
Sbjct: 88  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 147

Query: 70  FHKISNDHFHNLKR--EKKQKSSTDNNTGVSNNNSGDENIKVWEFKH 114
           FHK+        KR  E++QK              G+++   WEF+H
Sbjct: 148 FHKV--------KRSPEERQKCKY-----------GEQS---WEFQH 172

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 47/65 (72%), Gaps = 1/65 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+++L +    D+I W+ +G+SFL+   E F  + L +YFKH+N  SFVRQLN+Y
Sbjct: 162 AFVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMY 221

Query: 69  GFHKI 73
           G+HK+
Sbjct: 222 GWHKV 226

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 25/107 (23%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LEN +  D++ W  NG+SF++  +  F+ + L ++FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 70  FHKISNDHFHNLKR--EKKQKSSTDNNTGVSNNNSGDENIKVWEFKH 114
           FHK+        KR  E++QK              G+++   WEF+H
Sbjct: 147 FHKV--------KRSPEERQKCKY-----------GEQS---WEFQH 171

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 75/129 (58%), Gaps = 20/129 (15%)

Query: 11  FINKLYDLLENKDLDDLIWWAA-NGESFLIRPSE-SFS-QNLAHYFKHTNITSFVRQLNI 67
           F+++L+ +L   +++  I+W++ +   F ++P + +FS Q L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKH-SGGLFKKGDLEN 126
           YGFHK+S+          +Q S+++ N          + +  W+F H SG  FK+ +   
Sbjct: 66  YGFHKLSHP-------SPEQASASNGNA---------KELVEWKFTHPSGFFFKEANAGI 109

Query: 127 LKLIKRRSS 135
           L  I+R+S+
Sbjct: 110 LNKIQRKST 118

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ +     LI W+A+G+SF+I   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 160 AFVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMY 219

Query: 69  GFHKISN 75
           G+HK+ +
Sbjct: 220 GWHKVQD 226

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 25/107 (23%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LEN +  D++ W  NG+SF++  +  F+ + L ++FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 70  FHKISNDHFHNLKR--EKKQKSSTDNNTGVSNNNSGDENIKVWEFKH 114
           FHK+        KR  E++Q+              G+++   WEF+H
Sbjct: 147 FHKV--------KRSPEERQRCK-----------YGEQS---WEFQH 171

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESF-SQNLAHYFKHTNITSFVRQLNIY 68
            F+NK++ +L ++   +LI W+ +G+SF++   E F  Q L  YFKH+N+ SFVRQLN+Y
Sbjct: 119 AFVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMY 178

Query: 69  GFHKISN 75
           G+HK+ +
Sbjct: 179 GWHKVQD 185

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 74/129 (57%), Gaps = 20/129 (15%)

Query: 11  FINKLYDLLENKDLDDLIWWA-ANGESFLIRPSE-SFSQN-LAHYFKHTNITSFVRQLNI 67
           F+++L+ +L   +++  I+W+  +   F ++P + +FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKH-SGGLFKKGDLEN 126
           YGFHK+S+          +Q S+ + NT         + +  W+F H SG  FK+ +   
Sbjct: 66  YGFHKLSHP-------SPEQTSANNGNT---------KELVEWKFTHPSGFFFKEANAGV 109

Query: 127 LKLIKRRSS 135
           L  I+R+S+
Sbjct: 110 LNKIQRKST 118

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 25/107 (23%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LEN +  D++ W  NG+SF++  +  F+ + L ++FKH+N  SFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 70  FHKISNDHFHNLKR--EKKQKSSTDNNTGVSNNNSGDENIKVWEFKH 114
           FHK+        KR  E++Q+              G+++   WEF+H
Sbjct: 147 FHKV--------KRSPEERQRCKY-----------GEQS---WEFQH 171

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 6   GGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFS-QNLAHYFKHTNITSFVRQ 64
             N  F+ KLY +LE     +L+ W   G SF++  +  F+ Q L  +FKH+N +SFVRQ
Sbjct: 78  AANNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHFKHSNFSSFVRQ 137

Query: 65  LNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDL 124
           LN Y FHK+        +++  + S                    WEF H    FK+ D 
Sbjct: 138 LNKYDFHKVKRKSDEPGRKKYGELS--------------------WEFTHPS--FKRHDE 175

Query: 125 ENLKLIKRR 133
             L+ IKR+
Sbjct: 176 AGLENIKRK 184

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 66/127 (51%), Gaps = 23/127 (18%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+NKL+ ++ +     LI W+ +G+SF++   E F    L  YFKH+N  SFVRQLN+YG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           +HK+                  D  +G   +NS D     WEF +   L  + DL    +
Sbjct: 220 WHKVQ-----------------DVKSGSIQSNSDDR----WEFANENFLRGREDLLA-NI 257

Query: 130 IKRRSSS 136
           I+++SS+
Sbjct: 258 IRQKSSA 264

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 27/130 (20%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ +L +    DLI W+ +G+SF++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 151 AFVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMY 210

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL- 127
           G+HK+                  D  +G S  NS DE    W+F++    + + D E+L 
Sbjct: 211 GWHKVQ-----------------DVKSG-SIQNSSDEK---WQFENE---YFQRDREDLL 246

Query: 128 -KLIKRRSSS 136
            K+++++S+S
Sbjct: 247 EKIVRQKSNS 256

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 73/129 (56%), Gaps = 20/129 (15%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRPSE-SFSQN-LAHYFKHTNITSFVRQLNI 67
           F+++L+ +L   +++  I+W+    + F ++P + +FS + L  YFKH N+ SFVRQL++
Sbjct: 6   FVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKH-SGGLFKKGDLEN 126
           YGFHK+S+              S D ++    NN   + +  W+F H SG  FK+ +   
Sbjct: 66  YGFHKLSHP-------------SPDQSSA---NNGNVKELVEWKFTHPSGFFFKEANAGI 109

Query: 127 LKLIKRRSS 135
           L  I+R+S+
Sbjct: 110 LNKIQRKST 118

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 23/126 (18%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFS-QNLAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LE  +  D++ W   GESF++  +  F+ Q L ++FKH+N  SFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        K+  +++          N+  G+ +   WEF+H    F   + E L  
Sbjct: 104 FHKV--------KKSPEER---------QNSQYGELS---WEFRHP--YFTIHNEEALDN 141

Query: 130 IKRRSS 135
           IKR+++
Sbjct: 142 IKRKTT 147

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ +     LI W+++G+SF+I   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 159 AFVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMY 218

Query: 69  GFHKISN 75
           G+HK+ +
Sbjct: 219 GWHKVQD 225

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 67/130 (51%), Gaps = 23/130 (17%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ ++    LI W+ +G+SF++    SF    L  YFKH+N  SFVRQLN+Y
Sbjct: 196 AFVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMY 255

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HKI      ++K    Q SS D                 W+F +   L  + DL  + 
Sbjct: 256 GWHKI-----QDVKSGSIQSSSDDR----------------WQFGNRFFLRGRDDLL-VN 293

Query: 129 LIKRRSSSRT 138
           +I+++  S T
Sbjct: 294 IIRQKGGSST 303

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NKL+ ++ +     LI W  +G+SF++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 213 AFVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMY 272

Query: 69  GFHKISN 75
           G+HK+ +
Sbjct: 273 GWHKVQD 279

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 26/152 (17%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGE-SFLIRPSESFSQNLA--HYFKHTNITSFVRQLNI 67
           F++KL+ +L+   + +LI W+   + +F ++P ++   NL    YFKH N++SFVRQL++
Sbjct: 6   FVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNN---------TGVSNNNSGDENIK---------- 108
           YGFHKI      N         S +N          TG +N NS  E++           
Sbjct: 66  YGFHKIPVLDVKNTISPLPSSDSINNTSTNSTGPEFTGNNNENSSLESMAQETDQRRTDK 125

Query: 109 ---VWEFKH-SGGLFKKGDLENLKLIKRRSSS 136
              +W F H SG  +K      L    R++S+
Sbjct: 126 ASTIWYFSHPSGNFYKDAKYGTLSKTHRKNSA 157

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
           F+NK+++++ +   + LI WA +G+SF +   E   +  L  YFKH+N  SFVRQLN+YG
Sbjct: 171 FVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMYG 230

Query: 70  FHKI 73
           +HKI
Sbjct: 231 WHKI 234

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 22/132 (16%)

Query: 11  FINKLYDLLENKDLDDLIWWAAN--GESFLIRPSE-SFSQN-LAHYFKHTNITSFVRQLN 66
           F+++L+ +L +  L  +I W  +  G  FL++P    F  N L  YFKH N++SFVRQL+
Sbjct: 6   FVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFVRQLH 65

Query: 67  IYGFHKISND----HFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKH-SGGLFKK 121
           +YGFHK+ N+    H +N+          + N  VS     + +  +W+F H SG   ++
Sbjct: 66  MYGFHKVGNNSVNSHINNI----------EGNKIVSKK---EPHFIIWKFSHPSGNFHRE 112

Query: 122 GDLENLKLIKRR 133
              E L  I R+
Sbjct: 113 SSYETLCKITRK 124

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRPSESFSQNLA--HYFKHTNITSFVRQLNI 67
           FI++L+ +L +  L + I W+ + +  F++RP + +   L    YFKH N++SFVRQL++
Sbjct: 6   FIHQLHAILNDATLAEWIRWSDDQDGVFVLRPYDKWFSTLVLKRYFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKK-GDLEN 126
           YGFHK+SN    +        S        +     D++  VW F H  G+F +      
Sbjct: 66  YGFHKLSNFGSESSASGGSSISQLHGPPPPAK----DKSATVWFFTHPLGIFTRNASAAT 121

Query: 127 LKLIKRRSS 135
           L  I R+S+
Sbjct: 122 LNRIPRKST 130

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 23/127 (18%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFS-QNLAHYFKHTNITSFVRQLNIYG 69
           F+ KL+ +LE+    +++ W   G+SF++  +  F+ Q L ++FKH+N  SFVRQLN Y 
Sbjct: 78  FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 137

Query: 70  FHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLKL 129
           FHK+        K + KQK      +              WEFKH    F+  + + L  
Sbjct: 138 FHKVKR------KMDDKQKPKFGELS--------------WEFKHPA--FQIHNEKALDN 175

Query: 130 IKRRSSS 136
           IKR+ ++
Sbjct: 176 IKRKMAA 182

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NK++ ++ +     LI W+ +G SF+++  E+F    L  YFKH+N  SFVRQLN+Y
Sbjct: 265 AFVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMY 324

Query: 69  GFHKI 73
           G+HK+
Sbjct: 325 GWHKV 329

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 70/141 (49%), Gaps = 17/141 (12%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP--SESFSQNLAHYFKHTNITSFVRQLNI 67
           FI++L+ +L +K L+  I W+A  +  F ++P   E   + L   FKH N++SFVRQL++
Sbjct: 6   FIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVRQLHM 65

Query: 68  YGFHKISN--DHFHNLKREKK-----QKSSTDNNTGVSNNNSGDENIK------VWEFKH 114
           YGFHK+    +  H              ++T  +T   +N      IK      VW F H
Sbjct: 66  YGFHKLQTGPNGMHTTVNAGAGAGLPASAATAGSTTSMDNEPPTHIIKSNKESMVWYFTH 125

Query: 115 SGGLFKKGDLE-NLKLIKRRS 134
             G F K   + +L  I+R+S
Sbjct: 126 PSGYFYKDACQPDLARIQRKS 146

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 63/123 (51%), Gaps = 24/123 (19%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NK+++++ + +  +LI W+++G S +I   E   +  L  YFKH+N  SFVRQLN+Y
Sbjct: 185 TFVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMY 244

Query: 69  GFHKISND-------------HFHN----------LKREKKQKSSTDNNTGVSNNNSGDE 105
           G+HK+ +               F N          L+   +QKS T    G++N   G  
Sbjct: 245 GWHKVQDIRSGSIQNSVEDKWQFENENFIKGREDLLENIVRQKSQTSQGQGLANGPHGTR 304

Query: 106 NIK 108
           NI+
Sbjct: 305 NIQ 307

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 73/144 (50%), Gaps = 16/144 (11%)

Query: 11  FINKLYDLLENKDLDDLIWWAANGES-FLIRP--SESFSQNLAHYFKHTNITSFVRQLNI 67
           F+++L+ +L   D  + I W  + +S F+I P   E   + L  YFKH N +SFVRQL++
Sbjct: 4   FVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLHM 63

Query: 68  YGFHK--ISNDHFHNLKREKKQKSSTDNNTGVS--NNNSGDENIK--------VWEFKHS 115
           YGF K  I N+   N      + +  +NN  +   NN++   +I          W F H 
Sbjct: 64  YGFQKLPIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSRPKRGSTTWHFTHP 123

Query: 116 GGLF-KKGDLENLKLIKRRSSSRT 138
            G F +  D+  L  I+R+SS+ T
Sbjct: 124 SGFFHRNSDVVTLNRIQRKSSTVT 147

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 65/132 (49%), Gaps = 22/132 (16%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
            F+NK++ ++ +     LI W+ +G S ++   E F    L  YFKH+N  SFVRQLN+Y
Sbjct: 229 AFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMY 288

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENLK 128
           G+HK+      ++K    Q SS D                 W+F++   +  + DL N  
Sbjct: 289 GWHKV-----QDVKSGSIQSSSDDR----------------WQFENEFFVRGREDLLNRI 327

Query: 129 LIKRRSSSRTIP 140
           + ++ +S+   P
Sbjct: 328 VRQKGTSANATP 339

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 26/135 (19%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
           +F+  L+++LE++   ++I W   G+ F++  +  F+ + L  +F H+N  SFVRQLN +
Sbjct: 34  LFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKF 93

Query: 69  GFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGD---LE 125
           GFHKI       L     ++S                    WEF H    FKK D   +E
Sbjct: 94  GFHKIKKTQEERLMCIYGEQS--------------------WEFIHPN--FKKNDRILME 131

Query: 126 NLKLIKRRSSSRTIP 140
            +     R+SS+ +P
Sbjct: 132 KISKKISRTSSKQVP 146

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
          (REAL)
          Length = 346

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%), Gaps = 4/84 (4%)

Query: 10 VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
          VF++KL+ LL++     +I W+++G  F+I   E F++  L  +F  ++ T+FV+QL+ Y
Sbjct: 6  VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 69 GFHKISNDH---FHNLKREKKQKS 89
           F K    H   F N+  +++ K+
Sbjct: 66 SFQKTKRPHCEEFFNVHFQRENKA 89

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
          (REAL)
          Length = 349

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 10 VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHT--NITSFVRQLNI 67
          VF++KL+ LL++    ++I W  +G  F+I  ++ F++ +   F  +  +  SFVRQL+ 
Sbjct: 6  VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 68 YGFHKISNDH 77
          Y F K+   H
Sbjct: 66 YEFQKMERLH 75

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 14/105 (13%)

Query: 10  VFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIY 68
           VF++KLY LL+     ++I W+ +G   +I   + F++  L  +F      +FV+QL+ Y
Sbjct: 12  VFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFVKQLSKY 71

Query: 69  GFHK--------ISNDHFH-----NLKREKKQKSSTDNNTGVSNN 100
            F K         SN HF      +L   K  +S+   N    NN
Sbjct: 72  NFQKAGRPDCVEFSNIHFQKDNINSLSLVKAHQSAATPNVAAVNN 116

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
          (REAL)
          Length = 347

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 11 FINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQN-LAHYFKHTNITSFVRQLNIYG 69
          F++ L+++L+      +I W+A+G  F+I   + F++  L  +F   +  +F +QL+ Y 
Sbjct: 7  FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 70 FHK 72
          F K
Sbjct: 67 FQK 69

>KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5.190
            YGR184C
          Length = 1980

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 658  GRNISPPMNGNVDMLAQRPSTEVVSLTSS---DNKIDNAVVIKRSSTANPILRG 708
            G N S  ++G++DM+    S EV   T S   D+K ++  VI      +PI RG
Sbjct: 1172 GINDSVEVDGDIDMITGEKSIEVNEFTCSLCQDDKSEDVFVIPAYHDYSPIFRG 1225

>Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL091W
           (REAL)
          Length = 1244

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 13/92 (14%)

Query: 354 SEKIPELMANHYRFFDAQLTSLKNNILDRINNT-----------NIHKFGMDSNDLRSAS 402
           S   P+L  N  R+ +    S+ + IL  +N+            N+H     SND + A 
Sbjct: 802 SSATPQLHPNINRYQENNNRSINDEILKMVNSVAASKPVSPTAFNVHDLLRSSNDTQMAE 861

Query: 403 QTNIHLSHPIAQNMVYSSADQAIPKSVPYYLK 434
             N  LS P + N ++ SA   IP +V +  K
Sbjct: 862 MKNTQLSQPASTNDLFGSA--TIPNTVDFSAK 891

>NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}
           Anc_1.46 YCL029C
          Length = 576

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 15/93 (16%)

Query: 302 TLHHYNETLYEQSIQL---NHQIAQMRNTNM-----------DMLAIL-ELMSKLAEMNK 346
           T+  Y + L++  +QL   N+Q+ Q R   +            +LA++ +L  ++ E  K
Sbjct: 291 TIDQYEKNLHDMELQLQNVNNQLNQEREQQLKQKQFFETEHEQLLAVIDQLHEEIKENEK 350

Query: 347 EVLNINNSEKIPELMANHYRFFDAQLTSLKNNI 379
           + +NINN++ I     N+  F D +  S+KN +
Sbjct: 351 QFININNNKSIDTHNNNNNVFSDEEFKSIKNEL 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,972,638
Number of extensions: 3556729
Number of successful extensions: 16926
Number of sequences better than 10.0: 221
Number of HSP's gapped: 17440
Number of HSP's successfully gapped: 236
Length of query: 771
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 654
Effective length of database: 40,065,477
Effective search space: 26202821958
Effective search space used: 26202821958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)