Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I07161g5.477ON83783740800.0
ZYRO0D11308g5.477ON86877222090.0
Suva_8.1925.477ON87977821820.0
Smik_15.3205.477ON87377421720.0
TDEL0A034105.477ON83777121570.0
Skud_15.3045.477ON88378021580.0
YOR141C (ARP8)5.477ON88176921540.0
NCAS0H022905.477ON86379120490.0
Kpol_543.105.477ON87674720060.0
NDAI0C013705.477ON97484419910.0
KAFR0E025305.477ON84278619590.0
TBLA0A025305.477ON85477019470.0
TPHA0J027905.477ON88276619220.0
SAKL0G03608g5.477ON79475318450.0
KNAG0B040205.477ON93480218380.0
AFR135W5.477ON79178118110.0
Kwal_55.212505.477ON77575017740.0
Ecym_23115.477ON77577417640.0
KLTH0F14960g5.477ON77574917530.0
KLLA0E03213g5.477ON78881116530.0
KNAG0I018602.248ON7531061111e-04
NDAI0A013007.448ON56588990.003
ZYRO0F01122g2.593ON462101970.005
Skud_6.318.23ON360186920.018
TDEL0C004708.23ON375186920.021
CAGL0K12694g8.23ON375186920.021
Suva_6.188.23ON375186920.021
Smik_6.398.23ON375186920.021
YFL039C (ACT1)8.23ON375186920.021
KNAG0L002508.23ON375186910.025
KAFR0D009408.23ON375186910.025
TBLA0H028002.593ON48494920.025
Kpol_1058.158.23ON375186910.026
CAGL0H09042g2.117ON38784900.040
SAKL0B00968g8.23ON375186880.061
ABR222W8.23ON376186880.063
NDAI0G030408.23ON375186880.066
Ecym_15208.23ON376186860.098
NCAS0A147207.448ON485107860.11
TBLA0C004408.23ON375187850.14
TDEL0C031207.448ON43881850.15
TPHA0D002508.23ON375186840.17
NCAS0C037008.23ON375186830.22
SAKL0D05874g1.287ON497158840.23
AFR051W2.117ON40581820.31
ZYRO0F02772g8.23ON37535820.32
Kwal_14.11098.23ON360186820.35
TDEL0B068602.593ON461114820.38
KLTH0G18832g8.23ON375186810.40
Ecym_63852.117ON37781810.44
SAKL0B11220g2.593ON46684810.47
Ecym_23062.593ON407115810.47
Kpol_181.22.593ON46380800.53
Ecym_51464.377ON380228800.61
ADL253C2.248ON751118800.62
KLLA0D05357g8.23ON37535790.77
NDAI0C005802.593ON501108790.80
Ecym_52373.161ON391126790.83
TBLA0E038602.248ON759109790.90
SAKL0E11814g2.117ON37981781.0
YHR129C (ARP1)2.117ON38481781.0
TPHA0N014302.593ON472104781.1
ACR184C7.448ON401119781.1
SAKL0F13772g7.448ON42281781.1
KLTH0G13970g8.251ON30464761.3
NCAS0B060601.287ON49777771.5
Kpol_479.253.161ON391176761.5
ZYRO0A01584g2.248ON748107771.6
TDEL0D015501.287ON480120761.6
KLLA0E22925g2.117ON380102761.7
Skud_8.1902.117ON38481761.7
Ecym_42618.331ON369865772.0
KLTH0G09482g2.248ON745120762.0
KLLA0F03036g5.8ON31157752.1
KNAG0K01130na 1ON393100752.2
Kwal_33.146422.117ON38353752.2
NDAI0G055801.287ON51577752.4
KAFR0K021507.448ON49096752.5
Suva_15.3262.117ON38481752.6
TBLA0F004507.448ON482117752.7
TPHA0A009203.161ON391100743.0
NCAS0B071302.117ON381170743.1
Kwal_33.141773.161ON337100743.1
KNAG0B021107.448ON485137743.3
KLTH0F06490g3.161ON391100743.3
Suva_5.441.464ON120595743.4
Suva_13.2022.593ON467120743.5
ZYRO0B04928g3.161ON391100733.7
Skud_4.2223.161ON391176733.8
SAKL0C07370g3.161ON391100733.8
TBLA0F008703.161ON391173734.1
NCAS0C035503.161ON392100734.1
YDL029W (ARP2)3.161ON391100734.2
TDEL0D046103.161ON391100734.3
Smik_4.2063.161ON391100734.4
Smik_8.2102.117ON38481734.4
CAGL0K01595g3.161ON391100724.6
Suva_4.2203.161ON391100724.7
KLTH0C05324g7.448ON39978724.9
NDAI0G029003.161ON391100725.0
AGR099C8.251ON30567715.6
Kpol_520.117.448ON48887717.5
KLLA0C19360gna 2ON31590707.7
AGR089C8.259ON1370111718.4
KNAG0H036502.117ON38781708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I07161g
         (837 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...  1576   0.0  
ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...   855   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   845   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   841   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...   835   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   835   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   834   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   793   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   777   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   771   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   759   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   754   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   744   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   715   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   712   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   702   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   687   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   684   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   679   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   641   0.0  
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    47   1e-04
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    43   0.003
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    42   0.005
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    40   0.018
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    40   0.021
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    40   0.021
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    40   0.021
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    40   0.021
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    40   0.021
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    40   0.025
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    40   0.025
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    40   0.025
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    40   0.026
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    39   0.040
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    39   0.061
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    39   0.063
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    39   0.066
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    38   0.098
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    38   0.11 
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    37   0.14 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    37   0.15 
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    37   0.17 
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    37   0.22 
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    37   0.23 
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    36   0.31 
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    36   0.32 
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    36   0.35 
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    36   0.38 
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    36   0.40 
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    36   0.44 
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    36   0.47 
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    36   0.47 
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    35   0.53 
Ecym_5146 Chr5 (308809..309951) [1143 bp, 380 aa] {ON} similar t...    35   0.61 
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    35   0.62 
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    35   0.77 
NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {O...    35   0.80 
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    35   0.83 
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    35   0.90 
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    35   1.0  
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    35   1.0  
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    35   1.1  
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    35   1.1  
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    35   1.1  
KLTH0G13970g Chr7 complement(1208540..1209454) [915 bp, 304 aa] ...    34   1.3  
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    34   1.5  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    34   1.5  
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    34   1.6  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    34   1.6  
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    34   1.7  
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    34   1.7  
Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar...    34   2.0  
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    34   2.0  
KLLA0F03036g Chr6 complement(283504..284439) [936 bp, 311 aa] {O...    33   2.1  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    33   2.2  
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    33   2.2  
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    33   2.4  
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    33   2.5  
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    33   2.6  
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    33   2.7  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    33   3.0  
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    33   3.1  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    33   3.1  
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    33   3.3  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    33   3.3  
Suva_5.44 Chr5 complement(76303..79920) [3618 bp, 1205 aa] {ON} ...    33   3.4  
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    33   3.5  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    33   3.7  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    33   3.8  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    33   3.8  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    33   4.1  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    33   4.1  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    33   4.2  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    33   4.3  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    33   4.4  
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    33   4.4  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    32   4.6  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    32   4.7  
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    32   4.9  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    32   5.0  
AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON} Sy...    32   5.6  
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    32   7.5  
KLLA0C19360g Chr3 complement(1731276..1732223) [948 bp, 315 aa] ...    32   7.7  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    32   8.4  
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    32   8.5  

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score = 1576 bits (4080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/837 (92%), Positives = 775/837 (92%)

Query: 1   MSRESSVNXXXXXXXXXXXXXXXXXXXXNARKHGRSXXXXXXXXXXXXXXXXXXXXXXXX 60
           MSRESSVN                    NARKHGRS                        
Sbjct: 1   MSRESSVNSSMVEDEDSASDMDADLDEENARKHGRSDDGEDTGDDNADDNADDNADDNGD 60

Query: 61  XXTSVDGASTRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVV 120
             TSVDGASTRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVV
Sbjct: 61  ADTSVDGASTRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVV 120

Query: 121 GIERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKT 180
           GIERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKT
Sbjct: 121 GIERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKT 180

Query: 181 SELGXXXXXXXXXXXXXXXXLVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDE 240
           SELG                LVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDE
Sbjct: 181 SELGSGAQSASMASSASLDALVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDE 240

Query: 241 EPVSIPNLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQS 300
           EPVSIPNLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQS
Sbjct: 241 EPVSIPNLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQS 300

Query: 301 NAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSG 360
           NAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSG
Sbjct: 301 NAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSG 360

Query: 361 IFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETF 420
           IFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETF
Sbjct: 361 IFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETF 420

Query: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTL 480
           IRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTL
Sbjct: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTL 480

Query: 481 DYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIK 540
           DYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIK
Sbjct: 481 DYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIK 540

Query: 541 RVPGIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIY 600
           RVPGIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIY
Sbjct: 541 RVPGIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIY 600

Query: 601 TNSLNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVP 660
           TNSLNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVP
Sbjct: 601 TNSLNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVP 660

Query: 661 LDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISS 720
           LDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISS
Sbjct: 661 LDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISS 720

Query: 721 FPNFYKSLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHF 780
           FPNFYKSLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHF
Sbjct: 721 FPNFYKSLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHF 780

Query: 781 FTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           FTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY
Sbjct: 781 FTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/772 (52%), Positives = 559/772 (72%), Gaps = 17/772 (2%)

Query: 71  RRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNL 130
           R  + K++KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFARKLK +GIE+VE   L
Sbjct: 109 RDSQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTL 168

Query: 131 PQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXX 190
           P +GLF P+ LINQKNYSSDYL+KDE  FA+R+RK +RN N    + A T ++       
Sbjct: 169 PPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRN-NTQVPSMANTPDVADLKREN 227

Query: 191 XXXXXXXXXXLVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVA 250
                           +    EDID +D   T+VIHPGS+S+K+G A DE P  IP+ VA
Sbjct: 228 GNTTEL---------NEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVA 278

Query: 251 VPRSQVVN--PVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTS 308
           +P+S++ N  P+D+        +   +F E+  +++++F+ERM++YKRK+Q NAHEQV +
Sbjct: 279 IPKSELHNQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVIN 338

Query: 309 FNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNN 368
           FN  SKPE + DKND  +I+WI   D++YYG DA RC  D F++R P  K G FN+ S +
Sbjct: 339 FNKVSKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPD 398

Query: 369 YSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEM 428
           Y S+QDL+GD + L++  L S +F + +S++  YK V+VIPDLF+KSH+ET IR L+ EM
Sbjct: 399 YRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEM 458

Query: 429 DFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVT 488
            F++VA+MQESLATCYGAGIST TCVVNIGA Q RIACVD+GT++QDS +TLDYG +D+T
Sbjct: 459 QFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDIT 518

Query: 489 NLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSE 548
            L A+ L QS+FPY++W++ T +GW  AE+ KK + TFQDA++ VQL+NFIKR+PG  +E
Sbjct: 519 KLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAE 578

Query: 549 KYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWR 608
           K+DFKVFDEVILAPL LFYP I   ++   +P ++  +  L  ++  SRDI+T++L+DWR
Sbjct: 579 KFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEK--LESELPISRDIFTDNLDDWR 636

Query: 609 SITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQS 668
           S++Q +C +N +YC  +D+ +++   LD  + +++LQ+++  E   ++ + PL+KAIVQS
Sbjct: 637 SLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQS 696

Query: 669 ITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSL 728
           ITNA ++ D+SK+S FYSNI++ GGG+N+PA DFIL+DRINIWRP +L  +SFP+ YK L
Sbjct: 697 ITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKL 756

Query: 729 TKQLKDIQTSNKSNTGDKSQEQE---VAERSIALVKVELDKLVASLEIPNSGDHFFTVGV 785
           +KQ+KDI+ S K+  G  +  QE   + E+   ++K EL++    +E  N+ DH   V V
Sbjct: 757 SKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSV 816

Query: 786 LPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           LP PR+LDP++L WKGASVLAQIKL+EELY++  DWD+HG+R+LQYKCIF Y
Sbjct: 817 LPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/778 (52%), Positives = 569/778 (73%), Gaps = 33/778 (4%)

Query: 70  TRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLN 129
           T +  K+Y+KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+ LK +GIE+VE   
Sbjct: 125 TAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATT 184

Query: 130 LPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXX 189
           LP +GLF P+ LINQKNYSSDYL+KD+  FA+R+RK +RN+N    +   T ++      
Sbjct: 185 LPATGLFQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV------ 238

Query: 190 XXXXXXXXXXXLVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNL 248
                      L +++     + D ID NDP  TIVIHPGS+SIKIG   DE P+ +PN 
Sbjct: 239 ------VDMKSLPNSEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNC 292

Query: 249 VAVPRSQVVNPVDETPVNV-LNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVT 307
           VAVP+  +    D+   N+ L  +  ++F  + ++++ NF+ERM+YYKRK+  NAHEQV 
Sbjct: 293 VAVPKKWLNLANDQNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVV 352

Query: 308 SFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESN 367
           SFN +SKPE VS KND   I+WI++  K YYG DA RC+ ++F++R+PF K G FN++S 
Sbjct: 353 SFNESSKPEVVSVKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-KGGCFNIDSP 411

Query: 368 NYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNE 427
            Y S+ +L+ DV +L++ AL S+  N+  +++  YK V+VIPD+FKKSH+ETFIR+LL E
Sbjct: 412 YYKSLAELISDVIKLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTE 471

Query: 428 MDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDV 487
           + F++VA++QESLATCYGAGIST TCVVNIGA + RIACVD+GT++++SAVTLDYGG+D+
Sbjct: 472 LQFQAVAIIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDI 531

Query: 488 TNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPS 547
           T L A+LL QS FP ++W +++ +GW  AE  KK F TFQDADIAVQL+NFI R P  P+
Sbjct: 532 TRLFALLLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPT 591

Query: 548 EKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDW 607
           EKY+FK+FDEV+LAPL LF+P+IFK I+    P+ K   ++L  Q+  SRD++TN LNDW
Sbjct: 592 EKYEFKLFDEVMLAPLALFFPQIFKLIRA---PSGK--NSSLEFQLPESRDLFTNELNDW 646

Query: 608 RSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIE-ENTDKKCFVPLDKAIV 666
            S++Q + +E  +YC+  DDL+I+   LD +T I+ LQ K  +  +T K+   PL+KAI+
Sbjct: 647 NSLSQFESKEGDLYCNLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAII 706

Query: 667 QSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYK 726
           QSITNA++  D++++S FYSNI+IVGG + IPALDFIL+DRINIWRP++L  +SFP FYK
Sbjct: 707 QSITNASVTADVTRMSSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYK 766

Query: 727 SLTKQLKDIQTSNKSNTGDKSQEQ-------EVAERSIALVKVELDKLVASLEIPNSGDH 779
            LTK++KD++ S+  +  +K++E+       ++ E+ +A    ELD+   S+E  N  +H
Sbjct: 767 KLTKEIKDLE-SHFVSAPEKTEEENKQVLQLQINEKVVA----ELDEQHQSIEHQNGNEH 821

Query: 780 FFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
            F + ++P PR+++P+L+ WKGASVLAQIKL+EEL+I+ NDWDVHG+R+LQYKCIF Y
Sbjct: 822 LFPISIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/774 (52%), Positives = 561/774 (72%), Gaps = 25/774 (3%)

Query: 70  TRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLN 129
           T +  K+Y+KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+ LK +GIE+VE   
Sbjct: 119 TAQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATT 178

Query: 130 LPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXX 189
           LP +GLF P+ LINQKNYSSDYL+KD+  FA+R+RK +RN+N    +   T ++      
Sbjct: 179 LPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV------ 232

Query: 190 XXXXXXXXXXXLVDTDTKLQSV-EDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNL 248
                      L  ++    S+ E+ID ND   TIVIHPGS+S+KIG   DE PV +PN 
Sbjct: 233 ------IDLKNLPHSEANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNC 286

Query: 249 VAVPRSQV-VNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVT 307
           VAVP+  + +   +   +  L  E  ++FH + + ++ NF+ERM+YYKRK+  NAHEQV 
Sbjct: 287 VAVPKKWLNLESSENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVI 346

Query: 308 SFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESN 367
           SFN NSKPE +S+KND   I WI++  K YYG DA RC+ ++FI+R+PF K G FN+ S 
Sbjct: 347 SFNENSKPEIISEKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPF-KGGSFNINSP 405

Query: 368 NYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNE 427
            Y S+ +L+ DV++L++ AL S+  N+  +++  YK V+VIPD+FKKSH+ETFIR+LL E
Sbjct: 406 YYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTE 465

Query: 428 MDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDV 487
           + F++VA++QESLATCYGAGIST TCVVNIGA + RIACVD+GT+++ SA+TLDYGG+D+
Sbjct: 466 LQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDI 525

Query: 488 TNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPS 547
           T L  + L QS FP ++W +++ +GW  AE  KK F TFQDAD+AVQL+NFI R P  P+
Sbjct: 526 TRLFGLFLLQSDFPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQPT 585

Query: 548 EKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDW 607
           EKY+FK+FDEV+LAPL LF+P+IFK I+     T+ +  ++L  Q+  SRD++TN LNDW
Sbjct: 586 EKYEFKLFDEVMLAPLALFFPQIFKLIR-----TSSDKNSSLEFQLPESRDLFTNELNDW 640

Query: 608 RSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSK-HIEENTDKKCFVPLDKAIV 666
            S++Q + +E  +YC+  DDLEI++  L  +  I+ LQ K     N  K+ F PL+KAI+
Sbjct: 641 NSLSQFESKEGNLYCNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAII 700

Query: 667 QSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYK 726
           QSI NA+I  D+++++ FYSNI+IVGG + IPALDFIL+DRINIWRP++L  +SFP FYK
Sbjct: 701 QSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYK 760

Query: 727 SLTKQLKDIQTSNKSNTGDKSQEQE--VAERSIA-LVKVELDKLVASLEIPNSGDHFFTV 783
            LTK++KD++ S+  N  DK++E+   V +R I   V  ELD+   ++E  N  +H F +
Sbjct: 761 KLTKEIKDLE-SHFVNAPDKTEEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPI 819

Query: 784 GVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
            ++P PR+++P+L+ WKGASVLAQIKL+EEL+I+ NDWDVHG+R+LQYKCIF Y
Sbjct: 820 SIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/771 (51%), Positives = 556/771 (72%), Gaps = 28/771 (3%)

Query: 72  RGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLP 131
           + +++ +K+P LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+KLK +GIE++E+  LP
Sbjct: 90  KSQERAKKHPRLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLP 149

Query: 132 QSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXX 191
            +GLF PV LINQKNYSSDYL+KDE  FA+RERK +RN N   S+   T ++        
Sbjct: 150 ATGLFQPVLLINQKNYSSDYLKKDEQIFALRERKTLRN-NTQTSSINNTPDV-------- 200

Query: 192 XXXXXXXXXLVDTDTKL-----QSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIP 246
                    + +T+T++      + EDID +D   T+VIHPGS  ++IG A DE P+ +P
Sbjct: 201 -------IDIKNTNTEVPDYIAAADEDIDLSDANTTLVIHPGSRHLRIGFAKDEVPLVVP 253

Query: 247 NLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQV 306
           + VA+P++++ +   E P   L  E  ++F EL + ++++F+ERM+YYKRK+  NAHEQV
Sbjct: 254 SCVAIPKTELNDEFQEAP---LKREQPEEFEELKSTIQHSFRERMRYYKRKVPFNAHEQV 310

Query: 307 TSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLES 366
            S+N NSKP+ + D+ND G I+WI  + K+YYG +A +C  + F +R PF K G FN+ S
Sbjct: 311 VSYNKNSKPQMIEDQNDPGAINWIKKSSKRYYGSEALKCSKETFRIRCPFTKGGSFNVSS 370

Query: 367 NNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLN 426
            +Y+S+QDL+ DV  L++ ALS++  N+ ++++  YK V+VIPDLF KSH+ETFIR LL 
Sbjct: 371 PDYASLQDLINDVISLLEHALSAEGLNLERAQFSQYKVVLVIPDLFHKSHVETFIRFLLT 430

Query: 427 EMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGND 486
           EM F++VA++QESLA CYGAG S+ TCVVNIGA    IAC+D+GT++++S V+LDYGG+D
Sbjct: 431 EMQFQAVAIIQESLAGCYGAGQSSSTCVVNIGATHTSIACIDEGTVLENSLVSLDYGGDD 490

Query: 487 VTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP 546
           +T L A+ L QS+FPY++W++++ +GW  AE+ KKK+ TFQDA++AVQL+NFIKRVP   
Sbjct: 491 LTKLFALFLLQSEFPYQDWDINSSHGWILAEELKKKYTTFQDANVAVQLYNFIKRVPDQQ 550

Query: 547 SEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLND 606
           SE+Y+FKVFDEV LAPL LFYPEI  Y+  +   +     + +  Q+  SRDI+TN++ND
Sbjct: 551 SEQYEFKVFDEVSLAPLALFYPEIISYLHSKS--SQHSGNSNVESQLPASRDIFTNTVND 608

Query: 607 WRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIV 666
           WRS++Q +C +  +Y    ++  I+   LDL T  +D QSK   E   +K + PL+KAI+
Sbjct: 609 WRSLSQSECLDGDLYSGNNNNQLIMSKLLDLQTSFDDFQSKPPMEADSRKNYTPLEKAII 668

Query: 667 QSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYK 726
           QSITNA+  +D++K+S FYSNI++VGGG+ IPALDFIL+DRINIWRP +L ++SFPNFYK
Sbjct: 669 QSITNASTPIDVAKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFYK 728

Query: 727 SLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVL 786
            L KQ KDI+T+ K  TG+  +E + +++   ++  EL     S+E  N  +H   V VL
Sbjct: 729 KLAKQAKDIKTAGK--TGESEEEDQSSKKINEMISAELQAYWDSIEAQNGSEHLLPVNVL 786

Query: 787 PAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           P PR++D + L WKGA VLAQIKL+EELY++  DWD+HG+R+LQYKC+F Y
Sbjct: 787 PPPRDMDAAELAWKGACVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFTY 837

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/780 (52%), Positives = 565/780 (72%), Gaps = 31/780 (3%)

Query: 67  GASTRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVE 126
           G    +  K+Y+KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+ LK +GIE+VE
Sbjct: 126 GEPGVQTSKRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVE 185

Query: 127 NLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXX 186
              LP +GLF P+ LINQKNYSSDYL+KD+  FA+R+RK +RN+N    +   T ++   
Sbjct: 186 ATTLPATGLFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSSTNTPDV--- 242

Query: 187 XXXXXXXXXXXXXXLVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSI 245
                         L  T+     + D ID NDP  TIVIHPGS+SIKIG   DE P+ +
Sbjct: 243 ---------VDLKNLSHTEPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIV 293

Query: 246 PNLVAVPRS--QVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAH 303
           PN VAVP+    + N  +E  ++ L  E  D+F  + ++++ NF+ERM+YYKRK+  NAH
Sbjct: 294 PNCVAVPKKWLNLGNGPNEDNIS-LQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAH 352

Query: 304 EQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFN 363
           EQV SFN NSKPE +S+KND   I+WI++  K YYG DA RC+ ++F++R+PF + G FN
Sbjct: 353 EQVVSFNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPF-QGGSFN 411

Query: 364 LESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRL 423
           + S  Y S+ +L+ DV++L++ AL+S+  N+  +++  YK V+VIPD+FKK+H+ETFIR+
Sbjct: 412 INSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRV 471

Query: 424 LLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYG 483
           LL E+ F++VA++QESLATCYGAGIST TCVVNIGA + RIACVD+GT+++ SAVTL+YG
Sbjct: 472 LLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYG 531

Query: 484 GNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVP 543
           G+D+T L A+LL QS FP ++W + T +GW  AE  KK F TFQDADIAVQL+NFI R P
Sbjct: 532 GDDITRLFALLLLQSDFPLQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSP 591

Query: 544 GIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNS 603
             PSEKY+FK+FDEV+LAPL LF+P+IFK I+     ++    + L  Q+  SRD++TN 
Sbjct: 592 NQPSEKYEFKLFDEVMLAPLALFFPQIFKLIR-----SSSGKNSNLEFQLPESRDLFTNE 646

Query: 604 LNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEEN---TDKKCFVP 660
           LNDW S++Q + +E  +Y +  DDL+I+   L+ +T I+ +Q K   EN   T K+ F P
Sbjct: 647 LNDWNSLSQFESKEGDLYSNLNDDLKILNKILEAHTIIDQIQDK--PENYGDTSKENFAP 704

Query: 661 LDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISS 720
           L+KAI+QSI NA+I  D+++++ FYSNI+IVGG + IPALDFIL+DRINIWRP++L  +S
Sbjct: 705 LEKAIIQSIANASITADVTRMNSFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSAS 764

Query: 721 FPNFYKSLTKQLKDIQTSNKSNTGDKSQEQ--EVAERSIA-LVKVELDKLVASLEIPNSG 777
           FP FYK LTK++KD++ S+  N  DK++E+  +V +  I   V  ELD+   ++E  N  
Sbjct: 765 FPQFYKKLTKEIKDLE-SHFVNAPDKTEEENKQVMQSQIKDKVVAELDEQHQNIENQNGN 823

Query: 778 DHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           +H F V ++P PR+++P+L+ WKGASVLAQIKL+EEL+I+ NDWDVHG+R+LQYKCIF Y
Sbjct: 824 EHLFPVSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/769 (52%), Positives = 562/769 (73%), Gaps = 25/769 (3%)

Query: 75  KKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSG 134
           K+Y+KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFA+ LK +GIE+VE   LP +G
Sbjct: 132 KRYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATG 191

Query: 135 LFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXX 194
           LF P+ LINQKNYSSDYL+KD+  FA+R+RK +RN+N +  +   T ++           
Sbjct: 192 LFQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDV----------- 240

Query: 195 XXXXXXLVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPR 253
                 L  ++     + D ID NDP  TIVIHPGS+SIKIG   D+ PV +PN VAVP+
Sbjct: 241 -IDLKSLPHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPK 299

Query: 254 SQVVNPVDETPVNV-LNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSN 312
             +     E   NV L  E  ++F+ + ++++ NF+ERM+YYKRK+  NAHEQV SFN N
Sbjct: 300 KWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNEN 359

Query: 313 SKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSI 372
           SKPE +S+KND   I+WI++  K YYG DA RC+ ++F++R+PF + G FN++S  Y S+
Sbjct: 360 SKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSL 418

Query: 373 QDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRS 432
            +L+ DV++L++ AL+S+  N+  +++  YK V+VIPD+FKKSH+ETFIR+LL E+ F++
Sbjct: 419 AELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQA 478

Query: 433 VALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLA 492
           VA++QESLATCYGAGIST TCVVNIGA + RIACVD+GT+++ SA+TLDYGG+D+T L A
Sbjct: 479 VAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFA 538

Query: 493 ILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDF 552
           + L QS FP ++W + + +GW  AE  KK F TFQDAD+AVQL+NF+ R P  P+EKY+F
Sbjct: 539 LFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEF 598

Query: 553 KVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQ 612
           K+FDEV+LAPL LF+P+IFK I+     T+    ++L  Q+  SRD++TN LNDW S++Q
Sbjct: 599 KLFDEVMLAPLALFFPQIFKLIR-----TSSHKNSSLEFQLPESRDLFTNELNDWNSLSQ 653

Query: 613 RDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSK-HIEENTDKKCFVPLDKAIVQSITN 671
            + +E  +YCD  DDL+I+   LD +  I+ LQ K     NT K+ F PL+KAIVQSI N
Sbjct: 654 FESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIAN 713

Query: 672 AAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQ 731
           A+I  D+++++ FYSNI+IVGG + IPALDFIL+DRINIWRP++L  +SFP FYK LTK+
Sbjct: 714 ASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKE 773

Query: 732 LKDIQTSNKSNTGDKSQEQ--EVAERSIALVKV-ELDKLVASLEIPNSGDHFFTVGVLPA 788
           +KD++  +  N  DK++++  ++ +  I    V EL++   ++E  N  +H F V ++P 
Sbjct: 774 IKDLE-GHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPP 832

Query: 789 PRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           PR+++P+L+ WKGASVLAQIKL+EEL+I+ +DWDVHG+R+LQYKCIF Y
Sbjct: 833 PRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/791 (49%), Positives = 539/791 (68%), Gaps = 45/791 (5%)

Query: 64  SVDGASTRR--GKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVG 121
           S +G +T+    +KK QK   ++P K P GKKVPLHLLEKRRLGR+KAA+EFA+KLK +G
Sbjct: 101 SANGKTTKEEGPQKKVQK---VEPNKVPLGKKVPLHLLEKRRLGRIKAAKEFAKKLKEIG 157

Query: 122 IERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTS 181
           IE+VE++ +P +G+F P+ LINQKNYSSDYLRKDE  FA+RERK +R++   N + + T 
Sbjct: 158 IEKVESVPVPMTGMFQPLLLINQKNYSSDYLRKDEQIFALRERKTLRSNTTQNISSSNTP 217

Query: 182 ELGXXXXXXXXXXXXXXXXLVDTDTKLQSV-------------EDIDFNDPRLTIVIHPG 228
           E+                      T LQSV             ++I  NDP  TIVIHPG
Sbjct: 218 EV----------------------TDLQSVRETSNFTTANGNNDEILLNDPNTTIVIHPG 255

Query: 229 SDSIKIGLATDEEPVSIPNLVAVPRSQVVNP-VDETPVNVLNIELDDQFHELTNQLKYNF 287
           S  +K+G A DE P  IPN VA+P++   N  + ++    +NIE +++F  L  +++ +F
Sbjct: 256 SSFLKVGFALDEVPELIPNCVALPKTDFNNTNIIKSKQTSVNIEDNEKFESLKAEMEESF 315

Query: 288 KERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIG 347
           +ERM+YYKR++Q N H+QV SFN  SKPE +  +ND   IDWI +  K++YG+DA RC  
Sbjct: 316 EERMRYYKRRIQPNGHDQVVSFNRLSKPESLPVQNDPAHIDWITDGTKRFYGDDALRCTD 375

Query: 348 DEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIV 407
           + FI R PF K G FN  SN+Y S+QDLL DV  L++  LSSDKFNI  S++  YK V+V
Sbjct: 376 ENFIKRYPFKKGGSFNTSSNSYKSLQDLLSDVVGLIEGTLSSDKFNIKSSQFSQYKVVLV 435

Query: 408 IPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACV 467
           IPD F+KSH+E FIRLL+ E+ F++VA++QESL+ CYG+G+   TCVVN+G+++  +ACV
Sbjct: 436 IPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKETTVACV 495

Query: 468 DDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQ 527
           D+G ++ +S +TLDYG NDVT L A  L    FPYKNW+L++  GW+ AE+  K+ VTFQ
Sbjct: 496 DEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELMKQCVTFQ 555

Query: 528 DADIAVQLFNFIKRVP-GIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYE 586
           DADI VQL NFIKR P G   EK DFKVF+EV+LAPL LFYPEIFK ++ ++   ++E  
Sbjct: 556 DADITVQLSNFIKRTPRGNTVEKLDFKVFEEVMLAPLALFYPEIFKLLRSKE---SEEQN 612

Query: 587 TTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQS 646
             L  Q+ PSRDI+T+ +NDWRS++Q DC  +  +CD  D+ E+++ A+D    +E    
Sbjct: 613 AELEYQLPPSRDIFTDKINDWRSLSQNDCINHQTFCDIHDEYELLKKAVDCPNTLETFMD 672

Query: 647 KHIEENTDKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSD 706
              EE      F PLDKAIV+SIT A++ +D+SK++ FYSNI++VGGG+ IP  D +L D
Sbjct: 673 NPPEEKKSTFNFTPLDKAIVESITTASLGLDVSKMATFYSNILVVGGGSKIPGFDLMLMD 732

Query: 707 RINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQEQEVAERSIALVKVELDK 766
           R+NIWRP +L + +F +FY+ LTKQLK++Q+    +  ++ +E E+ E+   L+K EL K
Sbjct: 733 RVNIWRPRLLSLRAFTHFYRELTKQLKELQSLKTGDGEEEIKEDELNEKISELIKTELTK 792

Query: 767 LVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGN 826
            +  +E  +  +HF  V V+P+P  +DP  + WKGASVLAQIKL+EEL+I+  DWDVHGN
Sbjct: 793 YLEVIEQQSGNEHFLPVEVIPSPNEIDPGSIAWKGASVLAQIKLVEELFITNGDWDVHGN 852

Query: 827 RVLQYKCIFAY 837
           R+LQYK I  Y
Sbjct: 853 RILQYKSILTY 863

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/747 (50%), Positives = 546/747 (73%), Gaps = 14/747 (1%)

Query: 92  KKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDY 151
           KKVP HLLEKRRLGRLKAAE FA KLK  GIERV+N +L Q+GLF  + L+NQKN SSDY
Sbjct: 143 KKVPRHLLEKRRLGRLKAAEAFAAKLKKTGIERVDNSHLQQTGLFGQMLLVNQKNCSSDY 202

Query: 152 LRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXXLVDTDTKLQSV 211
           L+KD+  FA+RERK +RN N   S  A T ++                 LVD +   ++ 
Sbjct: 203 LKKDDQVFALRERKTLRN-NTTVSTTANTPDV----VDLKALNNGSSASLVD-EVLNKND 256

Query: 212 EDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIE 271
           +DIDFNDP  TIVIHPGS  +KIG A DE P+ +P+ VA+P++ + +  +   +++  IE
Sbjct: 257 DDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSCVAIPKNSLYSE-NVRELSIDKIE 315

Query: 272 LDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIY 331
             ++   +  QL+ +F+ERM+YYKRK+Q N+HE+V +FN  +KPE V DKND G+I+WI 
Sbjct: 316 DSERLVGMKAQLQQSFRERMRYYKRKIQPNSHERVRTFNEQAKPEIVEDKNDHGRIEWIN 375

Query: 332 NADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDK 391
           N+DK Y+GE+A+RC  + FI+R PF K G  NL+S  YSS+ +LL DV+ L + AL+   
Sbjct: 376 NSDKIYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFEYALTKRD 435

Query: 392 FNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTP 451
            +IT+++ +  K ++VIPDLF+KSH+ET  R+LL EM F++VA+MQESLA CYGAGIST 
Sbjct: 436 ESITQAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTA 495

Query: 452 TCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLY 511
           +C+VNIGA Q  IACVD+GT++++S + LDYGG+D+T L  + L ++ FP+++ +L + +
Sbjct: 496 SCIVNIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPFQDLDLDSTH 555

Query: 512 GWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAPLGLFYPEIF 571
           GW  AE  KK + TF+DA++ VQL+NF+KR+PG  SEKY+FKVFDEVILAPL LFYP+IF
Sbjct: 556 GWTLAEQLKKNYATFEDANMTVQLYNFVKRIPGKVSEKYEFKVFDEVILAPLALFYPDIF 615

Query: 572 KYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEII 631
              QE ++  +K  +  L  Q+  SRD+YT+S+NDWRS++Q  C +  +Y    ++L+II
Sbjct: 616 ---QELKKLDSKN-KFNLEDQLPVSRDLYTDSINDWRSVSQLQCLDGDLYAGNTNELDII 671

Query: 632 QHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIV 691
              L++N+  E+ +     E   ++ +VPL+KAI+QSITNA +++D+SK++QFY+NI++V
Sbjct: 672 TKVLNINSSTEEYEGLETTEVDGRENYVPLEKAIIQSITNACVSMDVSKMNQFYANIMVV 731

Query: 692 GGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQEQE 751
           GG +NIP LDF+L+DRINIWRP  L  ++FP+F+K+++KQ+K+IQ+++K++T    +E+E
Sbjct: 732 GGTSNIPQLDFVLTDRINIWRPKALCNTTFPHFFKNISKQVKEIQSTSKAST--TPEEEE 789

Query: 752 VAERSIA-LVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKL 810
             ++SI  L++ EL K + S+E   +GDH + V VLP PR+++P +L+WKGASVLAQIKL
Sbjct: 790 KIKQSIKELIETELRKYLNSIESQGNGDHSYPVAVLPPPRDMNPEVLNWKGASVLAQIKL 849

Query: 811 IEELYISRNDWDVHGNRVLQYKCIFAY 837
           IEEL+++  DWD+ G+R+LQYKC+F Y
Sbjct: 850 IEELFVTNTDWDMLGSRILQYKCLFTY 876

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/844 (46%), Positives = 557/844 (65%), Gaps = 95/844 (11%)

Query: 71  RRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNL 130
           +  ++ Y+KYP +DP K PPGKKVPLHLLEKRRLGR+KAAEEFA+KLK  GIE+VE++ +
Sbjct: 149 KSKEEAYKKYPKMDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVESVTV 208

Query: 131 PQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXX 190
           P +GLF P+ LINQKNYSS YL+ D+  F +R+ K ++N++ N ++ A    +       
Sbjct: 209 PPTGLFQPLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDNIVES---- 264

Query: 191 XXXXXXXXXXLVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLV 249
                      V T    +S  D ++ NDP  TI+IH GS S+KIG A DE P+ +PN V
Sbjct: 265 -----------VATGINNKSTGDQLNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCV 313

Query: 250 AVPRSQV------VNPVDETPV----NVLN-IELDDQFHELTNQLKYNFKERMKYYKRKM 298
           A+P+ +       +N  D  P     N+ + I   D+F++L  +++ NFKERMKYYKR++
Sbjct: 314 AIPKQEYEGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRI 373

Query: 299 QSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWI-YNADKKYYGEDAQRCIGDEFILRRPFC 357
           Q N+ EQV SFN  SKPE +   ND  +I WI  + +K+YYG +A+RC    F  R+PF 
Sbjct: 374 QPNSCEQVKSFNKISKPEILPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKTRKPFS 433

Query: 358 KSGIFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHL 417
            +G FN+ S +Y S+QDLL DV+ L++ +L+S  F++  S++K +K V++IPD F KSH+
Sbjct: 434 NNGSFNIASTDYISLQDLLSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHV 493

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E FI LLL  + F++VA++QESLATCYGAG S PTCVVN+GA Q  +ACVD+GT++++S 
Sbjct: 494 ELFITLLLTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSM 553

Query: 478 VTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFN 537
           V+L+YGGND+TN+ A  L Q+ FPY NWNL+++ GWK AE+ K+K++TFQD D+ VQLFN
Sbjct: 554 VSLNYGGNDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFN 613

Query: 538 FIKRVPGIPS-EKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPS 596
           FIKR+PG+ + EKYDFKVFD+V+LAPL LF+P+I K ++E+Q     ++   L  Q+  S
Sbjct: 614 FIKRLPGMDTIEKYDFKVFDDVMLAPLTLFFPKILKLMKEQQPQNRNKF---LQSQLPDS 670

Query: 597 RDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKK 656
           RDIYT  +NDWRSITQ +C E+ ++    ++LE+++  L++   +E+ Q+   +   DK 
Sbjct: 671 RDIYTTKINDWRSITQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKNDKL 730

Query: 657 CFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVL 716
            + PLD AI+QSI NA+ N+D+SK+S FYSNI++VGGG+ IPALDFIL+DRINIWRP +L
Sbjct: 731 NYTPLDVAIIQSIMNASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLL 790

Query: 717 GISSFPNFYKSLTKQLKDIQT--------------------------------------- 737
            ++SFPNFYK L+K +KD+Q                                        
Sbjct: 791 SLTSFPNFYKELSKDIKDLQNHYLKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQ 850

Query: 738 ----SNKSNTGDKSQ-------EQEVAERSIALVKVELD------------KLVASLEIP 774
               +N SN  + ++       E    E ++  +K E+D            + + ++E  
Sbjct: 851 VPSGTNISNNLNSTKIDNTPGAETNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKA 910

Query: 775 NSGD-HFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKC 833
            +G+ H+  V V+PAPR++DP+L+ WKGASVLAQ+K+IEELY++  DWDVHG+R+LQYK 
Sbjct: 911 QNGNDHYLPVSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKS 970

Query: 834 IFAY 837
           IF Y
Sbjct: 971 IFPY 974

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/786 (47%), Positives = 538/786 (68%), Gaps = 64/786 (8%)

Query: 87  KAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKN 146
           K   G KVP HLLE+RR+GR+KAAE FA+KLK +GIE++EN+ LPQ+GLF P+ LINQKN
Sbjct: 86  KTMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLNLINQKN 145

Query: 147 YSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXXLVDTDT 206
           YSSDY+RKD+  FA+RERK +R+S   N+ +  T +                  +VD  T
Sbjct: 146 YSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPK-----------------AVVDLKT 188

Query: 207 KLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQ-VVNPVDETPV 265
            +   ++ID NDP  TI+I PGS+++KIG A DE P+ IPNLVA+P+      P  E+  
Sbjct: 189 GVMD-DEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTESK- 246

Query: 266 NVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQG 325
             LN E  ++F +L N+L   FKERM+YYKR++Q N+HEQV SFN N++PE + D ND  
Sbjct: 247 --LNTEQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPA 304

Query: 326 KIDWIYNADKKYYGEDAQRCIGDEFILRRPF--CKSG-IFNLESNNYSSIQDLLGDVSEL 382
           +I WI   DK YYG DA  C    F  R+PF  C++G +FNL  ++YSS+Q+LLGDV +L
Sbjct: 305 RIRWITQNDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKL 364

Query: 383 VDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLAT 442
           ++  L  +K    K++ K YKA++VIPDLF+KSH+E  IRLLL E+ F +VA++QESLAT
Sbjct: 365 IEFGL--NKLLEAKNKDK-YKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLAT 421

Query: 443 CYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
           CYGAGIST TCVVN+GA +  ++C+D+G ++++S + L+YGG+D+T L ++LL+ + FPY
Sbjct: 422 CYGAGISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPY 481

Query: 503 KNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAP 562
           ++WN+ ++ GW  AE  KK+ VT QDAD+ VQL NF+KRV   P+EKY+FK FDEV+LAP
Sbjct: 482 QDWNVESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKTFDEVMLAP 541

Query: 563 LGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYC 622
           L LF P IF Y++  +   +     TL  Q+  S+D++T+ LNDWRS+TQ  C+ N  YC
Sbjct: 542 LALFAPRIFSYLRNEESKNS-----TLQYQLPESKDLFTHELNDWRSMTQEACKNNGSYC 596

Query: 623 DAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVDISKIS 682
           D  D+L+++   L++++ +E  QS+      +K+  +PLDKAI+QSIT+A +++D SK+ 
Sbjct: 597 DISDELQLLTALLEVDSKLEAFQSEATTTLDNKRNMLPLDKAIIQSITDACLSLDPSKMD 656

Query: 683 QFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSN 742
            FYSNI++VGG +NIPA DF+L+DRINIWRP +L +SSFP FYK+L+K++KD++  ++S 
Sbjct: 657 SFYSNILVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMESQST 716

Query: 743 TGDKSQEQEVAERSIA-------------------------------LVKVELDKLVASL 771
              ++Q   V   + +                               L+K +L   ++++
Sbjct: 717 AKLQAQTGSVVPTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKLQDYISNV 776

Query: 772 EIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQY 831
           E  NS +H+F VGV+P PR++  ++L WKGASVLAQIKL+EEL+I+  DWD+HG+R+LQ+
Sbjct: 777 ESQNSNEHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMHGSRILQH 836

Query: 832 KCIFAY 837
           KCIF Y
Sbjct: 837 KCIFTY 842

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/770 (49%), Positives = 523/770 (67%), Gaps = 38/770 (4%)

Query: 78  QKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFS 137
           +K P +D  K    KK  LHLLEKRRLGRLKAAEEFA+KLK  GIE++E L +  +GLF 
Sbjct: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQ 169

Query: 138 PVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXX 197
           P  LINQKNYSSDYL+KD   FA+R RK++R +    ++   T +               
Sbjct: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGRGEANQAAQD- 228

Query: 198 XXXLVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVV 257
                         EDI+  DP  TIVIHPGS  +KIG A D  P+ IP+ VAVP++Q +
Sbjct: 229 --------------EDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFL 274

Query: 258 NPVDETPVNVLNIELD--DQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKP 315
           + V E   N  N   D  ++F E  N+L  +FKERM++YKRK+Q+N HEQV SFN NSKP
Sbjct: 275 DTVSELNDN-FNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKP 333

Query: 316 EEVSDKNDQGKID-WIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQD 374
           E+V++KND   ++ WI +  KKY+G DA RC  + FI+R PF   G FN+E+  Y ++ +
Sbjct: 334 EDVTEKNDIEDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSE 393

Query: 375 LLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVA 434
           LL +V E +   L+SD F +  S++  YK V+VI D+F+KSHLE   RLLLNEM F +VA
Sbjct: 394 LLSEVCEFLVHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVA 453

Query: 435 LMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAIL 494
           ++QESLATCYGAG+ + TCVVN+GA Q RIACVD+G+I++DS V+LDYGG+D+T L +IL
Sbjct: 454 IIQESLATCYGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSIL 513

Query: 495 LQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKV 554
           L QS FPY + N++  + W  AE  KK FVTF DA++ VQL+NFIKRVPG   +KY+F+ 
Sbjct: 514 LLQSGFPYTDLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFET 573

Query: 555 FDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRD 614
           F+EV+LAPL LFYP++ K ++  Q   AK     + KQ+  SRDI+T+ LNDW+SI Q D
Sbjct: 574 FEEVMLAPLSLFYPQVLKLLKSEQ--LAKYKNEQVKKQLPASRDIFTSELNDWKSIAQAD 631

Query: 615 CEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVP------LDKAIVQS 668
           C    +Y +  D++ +++  L+++ ++E+     I +  DK+  +P      L+KAI+QS
Sbjct: 632 CLNKNLYSETSDEISMLKRTLNIHLNLEE-----IRDEIDKEHEIPNSNYTSLEKAIIQS 686

Query: 669 ITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSL 728
           I NA+ ++DISKI+ FYSNI++VGGGA IP+LDFIL DRI IWRP +L ++SFP FYK L
Sbjct: 687 IANASASLDISKINSFYSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKL 746

Query: 729 TKQLKDIQTSNKSNTGDKSQEQEVAERSI-ALVKVELDKLVASLEIPNSGDHFFTVGVLP 787
           TK +K++    K+N    S+E+E  +++I  L+K E +     LE   S D FF V +LP
Sbjct: 747 TKLIKELPNYGKTNK--TSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILP 804

Query: 788 APRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           +PRN+DP+ L WKGASVLAQIKL+EEL+++  DWD+HG+R+LQ+KCIF Y
Sbjct: 805 SPRNMDPAELIWKGASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/766 (48%), Positives = 527/766 (68%), Gaps = 30/766 (3%)

Query: 89  PPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYS 148
           P   K+   +LE+RRLGR +AA  +A KL+  GIE+ EN N+  +GLF P+PL+NQKN S
Sbjct: 130 PVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQKNCS 189

Query: 149 SDYLRKDENAFAVRERKQMRNSNANNSAH------------AKTSELGXXXXXXXXXXXX 196
           SDYL+ +   FA+RERK +RN+    + +            A T E+             
Sbjct: 190 SDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNVNSESNVS 249

Query: 197 XXXXLVDTDTKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQV 256
               L+D      + ++I F+DP  TIVIHPGS  +KIG A D+ P+ IPN VA P++ +
Sbjct: 250 ----LIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSL 305

Query: 257 VNP-VDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKP 315
            +  V+ET   +++ E  D F    NQ++ +F++RM+YYKRK+Q+N+HE+V SFN  SKP
Sbjct: 306 YSENVEET---IVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKP 362

Query: 316 EEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDL 375
           E+V DK +  +++WI N DK YYGE+A RC  D FI+R PF K G FN+ S  Y+S+ ++
Sbjct: 363 EKVEDKTEYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEI 422

Query: 376 LGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVAL 435
           +GD+S L + ALS D+FN+  SEY  YK ++VIPD+F+KSHLET  R+LL EM F++VA+
Sbjct: 423 IGDISNLFEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAI 482

Query: 436 MQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILL 495
           MQESLA  YGAGI   TC+VNIGA Q R+AC+D+GT+ + S +TLDYGG+D+T L   LL
Sbjct: 483 MQESLAASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLL 542

Query: 496 QQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVF 555
            Q++FPY++ ++++ +GW+  E+ KK+FVTF+DA+I VQL+NFIK  PG  +EK +FKVF
Sbjct: 543 LQNEFPYQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFKVF 602

Query: 556 DEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDC 615
           DEVI APLGLFYPEIF+ + E      +     L  Q+ PS D+YT   +DWRS++Q  C
Sbjct: 603 DEVINAPLGLFYPEIFRIMAEENE--KRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQC 660

Query: 616 EENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAIN 675
            +N  Y    +DL++I   L+ N +++D+   + ++N ++K +  LDKAI+QSITNA + 
Sbjct: 661 LDNDTYSGNDNDLDVITKLLNANLNLDDMDLINNDQNENEKNYTSLDKAIIQSITNAVVT 720

Query: 676 VDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDI 735
           +D SK++QFY+NI++VGG ++IP+LDFIL+DRINIWRP +L    FP+F+++L KQ+KD 
Sbjct: 721 MDTSKMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDF 780

Query: 736 QTSNKSNT----GDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRN 791
            T+NKSN     G++ Q++ +AE    L+K EL K   +LE  N+ +H   V VLP P +
Sbjct: 781 NTANKSNNRPEEGEEEQKKGIAE----LIKTELKKYKDNLESQNANEHLLPVSVLPPPAD 836

Query: 792 LDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           +DPS+L+WKGASVL Q+KLIEELY++  DWD+ G+R+LQYKC+F Y
Sbjct: 837 MDPSVLNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/753 (48%), Positives = 514/753 (68%), Gaps = 25/753 (3%)

Query: 89  PPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYS 148
           PPGKKVP+HLLEKRRLGR+KAAEEFA+KLK +GIE+ +N  L Q+GLF P+ LINQKNYS
Sbjct: 63  PPGKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYS 122

Query: 149 SDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXXLVDTDTKL 208
           SDYL+KD+  FA+RERK +RN N+ N      +                   ++  +   
Sbjct: 123 SDYLKKDDQIFAMRERKSLRNPNSGNGNGNTGNN----------AVSNATPEVIPEEEDN 172

Query: 209 QSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVL 268
              +D +  D   TIVIHPGS  +KIG ATD  P S+P+ +A+PR+       +  V   
Sbjct: 173 DDNDDAEGTDDLNTIVIHPGSKFLKIGFATDVLPQSVPSCIAIPRAT------KNSVRSP 226

Query: 269 NIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKID 328
            I    +F  L + ++ +FKERM+YYKRK+  NAH+ V +FNS  +PE + + ND  +++
Sbjct: 227 QIREPSEFDGLKSAIQQDFKERMRYYKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRVE 286

Query: 329 WIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALS 388
           WI N   ++YGE+A RC+   F LR PF + G FN+ES  Y S Q+LLGDV  L++  L 
Sbjct: 287 WIQNGSNQFYGEEATRCLPSHFTLRYPFAR-GSFNVESPYYMSFQELLGDVQSLLEYCLK 345

Query: 389 SDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGI 448
            +K ++TK ++ +YK V+VIPDL+ K+++ETFI LLL +M F++VA++QESLAT YGAGI
Sbjct: 346 QEKIDVTKQQFANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGI 405

Query: 449 STPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLS 508
           S  TCVV+IGA   +IACVD+GT++ +SAVTLDYGG+D+T L +  L QSKFPY +W+LS
Sbjct: 406 SNSTCVVDIGATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDLS 465

Query: 509 TLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPG-IPSEKYDFKVFDEVILAPLGLFY 567
           T +GW  AE  KK+F TFQDA++AVQL+NFIKR PG   ++KY+FKVFDEV+LAP+ +F+
Sbjct: 466 TPHGWMLAESLKKEFTTFQDANVAVQLYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMFF 525

Query: 568 PEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDD 627
           P+I   +     P   + E  +  Q   S+DIYT   N+ RSI+QR+C EN  YCD   D
Sbjct: 526 PKILSLLN----PQKTQQEHYVTNQFPRSKDIYTLRDNNPRSISQRECHENKTYCDMTRD 581

Query: 628 LEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVD--ISKISQFY 685
           L+I+Q  L+L   I++  + ++ +        PL+KAIV+SITNA+I++D  +S++  FY
Sbjct: 582 LDILQKILNLPDEIDEYSNSNLSKKHHHDNITPLEKAIVESITNASISLDNNMSRLGNFY 641

Query: 686 SNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNK-SNTG 744
           SN+++VGGG+  P+LDFIL+DRINIWRP +L +++   FYK +T+Q+KD +  NK S   
Sbjct: 642 SNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFEQENKVSEVT 701

Query: 745 DKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASV 804
           D  Q   + ++ + +VK+EL     S++     ++ F + VLP PR++DP++L WKG SV
Sbjct: 702 DPEQLATLKKKLLKMVKLELQSYWESVDALGGNENVFPINVLPPPRDMDPAVLTWKGGSV 761

Query: 805 LAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           LA+IKL+EELYI+  DWDV G+R+LQYKCIF Y
Sbjct: 762 LARIKLVEELYITAKDWDVLGSRILQYKCIFDY 794

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/802 (46%), Positives = 527/802 (65%), Gaps = 64/802 (7%)

Query: 87  KAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKN 146
           K+  GKKVPLHLLEKRRLGR+KAAEEFA+KLK +GIE+V++  LP +G   P+ +INQKN
Sbjct: 146 KSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQKN 205

Query: 147 YSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXX-XXXXXLVDTD 205
           YSSDY+RKD+  FA+RERK +R++  +N+    T+                     +  +
Sbjct: 206 YSSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEVATSTIPNE 265

Query: 206 TKLQSVEDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPV 265
             L+S +DIDF D   TIVI PGS+SIKIG ATDE P+ IPN VAVP S       ETP+
Sbjct: 266 FTLKS-DDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHS------GETPI 318

Query: 266 -NVLNIELD--DQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKN 322
            N  N+  D  DQF +   +L+ +FKERM++YKR++Q ++++QV +FN  +KPE + D+N
Sbjct: 319 GNAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEIIEDQN 378

Query: 323 DQGKIDWIYNADKK-----YYGEDAQRCIGDEFILRRPF-CKSG--IFNLESNNYSSIQD 374
           D  KI W    D +     Y G++A  C+ + ++ RRPF C  G  +FNL+   Y+S+  
Sbjct: 379 DPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPFGCSEGKYLFNLDEKRYTSLAA 438

Query: 375 LLGDVSELVDSALSSDKF-----NITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMD 429
           LL DVS L++ A+  DK        T+ + K YKAV+VIPDLF+KSH+ET IRLLL+E+ 
Sbjct: 439 LLCDVSRLLEHAI--DKLLKKRDKDTEKDIK-YKAVLVIPDLFEKSHVETMIRLLLSELP 495

Query: 430 FRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTN 489
           F +VA++QESLATCYG+GIST TCVVN+GA   ++ACVD+G ++++S + L+YGG+D++ 
Sbjct: 496 FNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYGGDDISK 555

Query: 490 LLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEK 549
           L A+LL  S FPY+ W++ ++ G   AE  KK+ +TFQDADI  QLFNFIKRVPG+P+EK
Sbjct: 556 LFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVPGLPTEK 615

Query: 550 YDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLK-QIEPSRDIYTNSLNDWR 608
            +FK FDEVILAPL LFYP+IF  ++  +    K      LK Q+  SRD++TN  N+W+
Sbjct: 616 IEFKTFDEVILAPLALFYPKIFSLLKPNK---GKNLTNPKLKYQLPDSRDLFTNKANNWK 672

Query: 609 SITQRDCEENMIYCDAKDDLEIIQHALDLNTHIED-LQSKHIEENTDKKCFVPLDKAIVQ 667
           S+++ DC  N +Y D   +  ++ + L +N+  E   +   +   T +     LDK+++Q
Sbjct: 673 SLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKSVIQ 732

Query: 668 SITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKS 727
           SITNA ++++  K++ FYSNI+IVGG +NIP  D IL DRIN+WRP ++ ++SFPNFY  
Sbjct: 733 SITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNFYNE 792

Query: 728 LTKQLKDIQTSNKSN--------------------------------TGDKSQEQEVAER 755
           L K++KD++TS K++                                T   ++E E+ E+
Sbjct: 793 LVKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEYELNEK 852

Query: 756 SIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELY 815
              L++  L+K ++++E  N  +HF  V V PAP N++PSLL W+GA VLAQIKLIEEL+
Sbjct: 853 IQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIEELF 912

Query: 816 ISRNDWDVHGNRVLQYKCIFAY 837
           ++  DWDVHG+RVLQ+KCIF Y
Sbjct: 913 VTNIDWDVHGSRVLQHKCIFTY 934

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/781 (46%), Positives = 526/781 (67%), Gaps = 60/781 (7%)

Query: 81  PDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVP 140
           P+     A  GKKVP HLLEKRRLGR+KAAEEFARKLK +GIE+ +NL++ Q+GLF P+P
Sbjct: 47  PETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLFRPLP 106

Query: 141 LINQKNYSSDYLRKDENAFAVRERKQMRNSNAN--NSAHAKT--SELGXXXXXXXXXXXX 196
           LINQKNYSSDYLRKD+  F++RERK +R+ N N  NS+   T  +E G            
Sbjct: 107 LINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAG------------ 154

Query: 197 XXXXLVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPR-- 253
                 + D KL   ED ID  +   TIVIHPGS S+KIGL+TD  P+S+P+ VAV R  
Sbjct: 155 ------EDDLKLNGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRA 208

Query: 254 SQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNS 313
           SQ + P           + D+ F E   Q++ +FKERM+YYKRK+  N+HEQV S+NS +
Sbjct: 209 SQRLEPQQR-------YDKDEDFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRA 261

Query: 314 KPEEVSDKNDQGKIDWIYNADKK--YYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSS 371
           +PE++ + ND  +I+WI +A +   YYGE A+RC+ + F++R PF  +G FN+E  +YSS
Sbjct: 262 QPEKIPEHNDLHRIEWIKDAPEGTIYYGEGAERCLPENFVIRYPFS-NGAFNVECPDYSS 320

Query: 372 IQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFR 431
           +Q+LL DV++L+  ALS  K  I++S++ +YK +++IPDLF+K+++E  IRLLL+EM+F+
Sbjct: 321 LQELLNDVTKLITFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQ 380

Query: 432 SVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLL 491
           +VAL+QESLATCYGAG+S  TCV++IGA + +I+CVD+G +IQ+S + L YGG+D+T L 
Sbjct: 381 AVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLF 440

Query: 492 AILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP-SEKY 550
             LL QS FPY +WNL+T  GW  AE  KK  +TFQDAD+AVQLFNF KR P +P +EK+
Sbjct: 441 VELLLQSNFPYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGAEKF 500

Query: 551 DFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSI 610
           +FK+F+EV+++P+  FYP+I  +++      A  Y   + +Q+  SRD YT   ++ +SI
Sbjct: 501 EFKLFNEVMISPMAYFYPQILSFLK-----PATSYNKYMAQQLPESRDPYTYKPDNPKSI 555

Query: 611 TQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSK--------HIEENTDKKC-FVPL 661
            Q       +Y D   DL+II+  + +N  +E L S          I+ NT +   + PL
Sbjct: 556 AQESAFTGKVYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPL 615

Query: 662 DKAIVQSITNAAINV--DISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGIS 719
           DKAI++S+T A++ +  ++SK+  FYSN++++GG + +P LD IL+DRINIWRP +L +S
Sbjct: 616 DKAIIESVTTASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVS 675

Query: 720 SFPNFYKSLTKQLKDIQTSNKSNTGDKSQEQEVAE---RSIALVKVELDKLVASLEIPNS 776
           + P  YK +++ +K ++   K N  +   E+E+A+   + I  +K+EL+    S+   + 
Sbjct: 676 TLPVVYKKVSEMVKQVENEIKKN--NPESEEEIAQSRKKLIKSIKIELENYWESV---DP 730

Query: 777 GDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFA 836
            +H + + VLP PR +DPS+L WKG SV  +IKL EELYI+  DW++ G+R+L+YKCIF 
Sbjct: 731 YEHVYPIAVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFD 790

Query: 837 Y 837
           Y
Sbjct: 791 Y 791

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/750 (46%), Positives = 506/750 (67%), Gaps = 44/750 (5%)

Query: 93  KVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDYL 152
           KVP HLLEKRRLGR KAAE++A+K+K +GIE+ +N  L Q GLF P+ LINQKNYSSDYL
Sbjct: 65  KVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYL 124

Query: 153 RKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXXLVDTDTKLQSVE 212
           ++D+  FA+RERK +RN+ A+ S                         + D D +    E
Sbjct: 125 KRDDQIFAMRERKSLRNATASQST----------------------PDMPDDDDQ----E 158

Query: 213 DIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVP-RSQVVNPVDETPVNVLNIE 271
            +D +    TIVIHPGS S+KIG ATD  P SIP+ VAVP RSQ +    + P +     
Sbjct: 159 SVDGDSELNTIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKRSQSLQGETKQPHDT---- 214

Query: 272 LDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIY 331
             +++ E  + ++ +FKERM+YYKRK+  N+H+ V +FNS   PE + + ND  +IDWI 
Sbjct: 215 --EEYQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEIIPEHNDLHRIDWID 272

Query: 332 NADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDK 391
              + YYG++A RC+   F +R PF K G FN+ES +YSS+Q+LL DV EL+  ALS  K
Sbjct: 273 QPSRPYYGKEATRCLPSHFTVRHPFWK-GRFNIESPDYSSLQELLNDVCELLKFALSQPK 331

Query: 392 FNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTP 451
            ++  S+  +YK VIV+PDL+ K+++ETFIRLLL +++F++VA++QESLA+CYGAGI   
Sbjct: 332 IDVKPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGES 391

Query: 452 TCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLY 511
           TCVV+IGA   +IACVD+G + ++S + LDYGG+D+T L A  L +S FPY++ +L +  
Sbjct: 392 TCVVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQ 451

Query: 512 GWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP-SEKYDFKVFDEVILAPLGLFYPEI 570
           GW   E  K+K+ TFQDAD+ +QL+NFIKR+PG P +EK++FKVFDEV+ AP+GLF+P +
Sbjct: 452 GWSLVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVMTAPMGLFFPHV 511

Query: 571 FKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEI 630
           F  ++E+  PT  EY   +  Q+  S+D++T   N+ +S++Q  C++   YCD   DL+I
Sbjct: 512 FPLLKEQNNPT-NEY---VKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTYCDMGRDLDI 567

Query: 631 IQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVD--ISKISQFYSNI 688
           +Q  L+L + IE+ QS        +  +  L+KAI++SITNA +++D   +K +QFYSNI
Sbjct: 568 LQKLLNLPSEIEEYQSA--ASANVEPAYTALEKAIIESITNACVSLDNNHAKAAQFYSNI 625

Query: 689 IIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQ 748
           ++VGG +  P+LDFIL+DRINIWRP +L +++ P F+  ++KQ+K+ + +NK +   + +
Sbjct: 626 LVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQTNKLSEIKEEE 685

Query: 749 EQEVAERSIA-LVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQ 807
           E    ++ +A  +K+EL      ++     +  F + VLPAPR +DP+LL WKG SV A+
Sbjct: 686 ELLSQKKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPREMDPALLTWKGGSVFAR 745

Query: 808 IKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           +KLIEELY+S NDWDV  +R+LQYKCIF Y
Sbjct: 746 LKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/774 (45%), Positives = 518/774 (66%), Gaps = 44/774 (5%)

Query: 81  PDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVP 140
           P+   + +   KKVP HLLEKRRLGR+KAAEEFARKLK +GIE+ +N+++ Q+GLF    
Sbjct: 29  PETGGVASTQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQTGLFRVHS 88

Query: 141 LINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXX 200
           LINQKNYSSDYLRKD+  F++RERK +R+ N N+  ++    +                 
Sbjct: 89  LINQKNYSSDYLRKDDQIFSMRERKNLRSGNVNSITNSSQPLIALPD------------- 135

Query: 201 LVDTDTKLQSVED-IDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNP 259
           + D + K    ED +D      TIVIHPGS S+KIGL+TD  P+SIP+ VA+ RS+ V  
Sbjct: 136 VQDDEVKTNGDEDGLDDTADTNTIVIHPGSRSLKIGLSTDVFPLSIPSCVAIARSEQVE- 194

Query: 260 VDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVS 319
           V   P      + D++F     Q++ +FKERM+YYKRK+  N+HEQV S+NS  +PE++ 
Sbjct: 195 VPSQP----RYDNDEEFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSKCQPEKIP 250

Query: 320 DKNDQGKIDWIYNAD---KKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLL 376
           + ND  +I+WI  +D   K YYGE A+RC+ + F+LR PF  +G FN++S NY+S+Q+LL
Sbjct: 251 EHNDLHRIEWIKKSDASTKVYYGEYAERCLPEGFLLRYPFA-NGSFNVKSPNYNSLQELL 309

Query: 377 GDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALM 436
            DV  L+  ALS  K NI+KS++  Y  V++IPDLF+KS++E  IRLL++EMDF++VAL+
Sbjct: 310 NDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALI 369

Query: 437 QESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQ 496
           QESLA+CYGAG+S  TCV++IG  + +I+CVD+G +IQ+S + L YGG+D+T L A LL 
Sbjct: 370 QESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLL 429

Query: 497 QSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP-SEKYDFKVF 555
           QS FPY++WNL+T  GW  AE  KK  +TFQDAD+AVQLFNF KR P I  +EKY+FK+F
Sbjct: 430 QSNFPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAEKYEFKLF 489

Query: 556 DEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDC 615
           +EV+++P+  FYP+I   +    +P   E    + +Q+ PSRD YT   +D +S++    
Sbjct: 490 NEVMVSPMAYFYPQILALL----KPPV-EVNKYVQQQLPPSRDPYTCKPDDPQSVSNLGS 544

Query: 616 EENMIYCDAKDDLEIIQHALDLNTHIEDLQ--------SKHIEENTDKKC-FVPLDKAIV 666
                Y +   DL+I++  + +   +E L         S  I ENT++   ++PLDKAI+
Sbjct: 545 LSGKWYTEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEEVSNYMPLDKAII 604

Query: 667 QSITNAAINV--DISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNF 724
           +S+TNAA+ +  ++SK++ FYSN++IVGG + +P LD IL+DRINIWRP +L +S+ P  
Sbjct: 605 ESVTNAAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVI 664

Query: 725 YKSLTKQLKDIQTSNKSNTGDKSQE-QEVAERSIALVKVELDKLVASLEIPNSGDHFFTV 783
           YK ++  +K +++  K N  +  +E Q+  ++ I  +K+EL+    S++     +H + +
Sbjct: 665 YKKISDMVKQVESEIKKNNVESEEEIQQSRKKLIKSIKIELENYWESVD---PYEHVYPI 721

Query: 784 GVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
            VLP PR +DPS+L WKG SV  +IKL EELYI+  DW++ G+R+L+YKCIF Y
Sbjct: 722 TVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKCIFDY 775

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/749 (46%), Positives = 502/749 (67%), Gaps = 42/749 (5%)

Query: 93  KVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDYL 152
           KVP HLLEKRRLGR KAAE++A+K+K +GIE+ +N  L Q GLF P+ LINQKNYSSDYL
Sbjct: 65  KVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKPLSLINQKNYSSDYL 124

Query: 153 RKDENAFAVRERKQMRNSNANNSAHAKTSELGXXXXXXXXXXXXXXXXLVDTDTKLQSVE 212
           ++D+  FA+RERK +RN+NAN +    T ++                   D D      E
Sbjct: 125 KRDDQIFAMRERKSLRNANANQA----TPDMPE-----------------DDDQ-----E 158

Query: 213 DIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIEL 272
            +D      TIVIHPGS ++KIGLAT+  P SIP  VAVP+    +  D TP   ++   
Sbjct: 159 SVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTS--DSTPEPQVD--- 213

Query: 273 DDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYN 332
           ++++      ++ +FKERM+YYKRK+  N+H+   +FN+   PE + + ND  ++DWI +
Sbjct: 214 EEEYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLHRVDWIQD 273

Query: 333 ADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDKF 392
           A K YYG+DA RC+   F +R PF K G FN+ES +Y S+Q+LL DVSEL+  ALS  K 
Sbjct: 274 ASKCYYGKDATRCLPSHFTVRHPFWK-GRFNIESPDYGSLQELLVDVSELLKFALSQPKI 332

Query: 393 NITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPT 452
           ++  S+  +YK VIV+PD F K+++ETFIRLL+ ++ F++VA++QESLA+CYGAGI   T
Sbjct: 333 DVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYGAGIGDST 392

Query: 453 CVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYG 512
           CVV+IGA   +IACVD+G +I +S +TLDYGG+D+T L A  L +S FPY++ +L++  G
Sbjct: 393 CVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEG 452

Query: 513 WKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIP-SEKYDFKVFDEVILAPLGLFYPEIF 571
           W   E  K+K+ TFQDAD+ +QL+NFIKR+P  P +EK++FKVFDEV+ AP+GLF+P I 
Sbjct: 453 WSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMGLFFPHIL 512

Query: 572 KYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDAKDDLEII 631
           + ++++  P  K Y T+   Q+  S+D++T   N+ +S++Q  C++   YCD   DL+I+
Sbjct: 513 RLLKDKNVPVNK-YVTS---QLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHRDLDIL 568

Query: 632 QHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVD--ISKISQFYSNII 689
           Q  L+L + IE+ QS        +  + PL+KAIV+SITNA +++D   SK + FYSNI+
Sbjct: 569 QKLLNLPSEIEEYQSSTCANL--EPAYTPLEKAIVESITNACVSLDNNHSKAANFYSNIL 626

Query: 690 IVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQE 749
           +VGG +   +LDFIL+DRINIWRP +L +++ P F   ++KQ+K+ + + K +     +E
Sbjct: 627 VVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLSEIKDEEE 686

Query: 750 QEVAERSIA-LVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQI 808
               ++ +A  +KVEL      ++     +  F   VLPAPR +DP+LL WKG SV A++
Sbjct: 687 LAAQKKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTWKGGSVFARL 746

Query: 809 KLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           KLIEELY+S +DWD+ G+R+LQYKCIF Y
Sbjct: 747 KLIEELYVSESDWDILGSRILQYKCIFDY 775

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/811 (42%), Positives = 510/811 (62%), Gaps = 76/811 (9%)

Query: 70  TRRGKKKYQKYPDLDPL--------KAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVG 121
           T    K+  K P  +PL        K  P KKVP HLLEKRRLGR+KAAEEFA+KLK++G
Sbjct: 8   TESPSKEPSKEPSKEPLLGSDGKISKDIPSKKVPQHLLEKRRLGRIKAAEEFAKKLKIIG 67

Query: 122 IERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRN-SNANNSAHAKT 180
           IER EN ++ Q     PV +INQKNYSS+YL+ D+  F +RERK +R       S+ A  
Sbjct: 68  IERQENEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSAPA 127

Query: 181 SELGXXXXXXXXXXXXXXXXLVDTDTKLQS--VEDIDFNDPRLTIVIHPGSDSIKIGLAT 238
           + +G                 +D D    S  +ED + +    +I+IHPGS  IKIG   
Sbjct: 128 AGIGTPA--------------LDDDNMADSNAIEDDELD----SIIIHPGSSFIKIGPNY 169

Query: 239 DEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKM 298
           D  P  +PNLVAVP      P  +      +I  ++ F +L + ++++FKERM+YYKR++
Sbjct: 170 DIFPQQVPNLVAVPTHGGTVPSPQE-----DISNNEIFQQLKDDIQFDFKERMRYYKRRI 224

Query: 299 QSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCK 358
             N+ EQ  +FN+ S PE V D ND G+I+WI +  K YYG DA +C+  +F LR PF  
Sbjct: 225 MPNSTEQAAAFNAKSDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKLRSPFL- 283

Query: 359 SGIFNLESNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLE 418
           +G FNL   NY+S Q++L DV +L+  +L+ +K  I ++++ +Y+ V+++PDLF K+ +E
Sbjct: 284 NGSFNLNEPNYNSFQEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVE 343

Query: 419 TFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAV 478
           + I LLL E+DF+S+AL+QESLA+CYGAG+S  TCV++IGA+Q +IACVDDG ++++SA+
Sbjct: 344 SMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSAL 403

Query: 479 TLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNF 538
            L+YGG+D+T L A +L Q+KFPY +WN++   GW  AE  KK+ +TFQDADIA+QL++F
Sbjct: 404 RLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAIQLYSF 463

Query: 539 IKRVP----GIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIE 594
           IKR P       S KY++K+FDEV+ AP+G+F+P+IF+ I+ +Q     EY   +++Q  
Sbjct: 464 IKRDPYARKYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKPKQH-KPNEY---VIRQCP 519

Query: 595 PSRDIYTNSLNDWRSITQRDC--EENMIYCDAKDDLEIIQ-------------------- 632
            S+DIYT   ND +S+TQ  C  E    Y +   D++I+Q                    
Sbjct: 520 RSKDIYTLKPNDTKSLTQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESAG 579

Query: 633 --HALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINV--DISKISQFYSNI 688
                 +N  IED+  +     +     +PL+KAI++SITNA++ +  ++SK++  YSNI
Sbjct: 580 SKEETQINDEIEDINLRQYNNLS-----MPLEKAIIESITNASMLLGDNMSKLNVLYSNI 634

Query: 689 IIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSNTGDKSQ 748
           +IVGG + IPALDFIL+DRINIWRP +L IS+     + + + +K  +T NK +      
Sbjct: 635 LIVGGSSKIPALDFILTDRINIWRPKLLSISALSTLMEKIGEVIKSYETDNKLDLEPTDP 694

Query: 749 EQEVA--ERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLA 806
           +  +A  ++   L+K E++    SL+  +S D    + +LP P ++DPS+L WKG SV +
Sbjct: 695 QAAIAYKKKLSKLIKAEIEAYWDSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFS 754

Query: 807 QIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837
           +IKL+EEL I++ DW++ GNR+LQYKCIF Y
Sbjct: 755 KIKLLEELNITKQDWNMLGNRILQYKCIFEY 785

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTII 473
           +S   ++ +LL    D   V+   +SL + YG        V+N G E+  +  +  G  I
Sbjct: 143 QSQRNSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGI 202

Query: 474 QDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDF 519
                 +++GG+  TN L+ LL   K+PY    LSTL   +  ED+
Sbjct: 203 LSECKRINWGGSQSTNFLSSLL-TLKYPYFPAKLSTLQYTQMYEDY 247

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 4/88 (4%)

Query: 400 KHYKAVIVIPDLFKK---SHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVN 456
           + Y  VI IP + K+     LE +  L+     F    ++ E LA     G S+   V++
Sbjct: 104 EEYPLVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLGKSSG-LVID 162

Query: 457 IGAEQIRIACVDDGTIIQDSAVTLDYGG 484
           +G+   R+  + DGT+I+++ ++  YGG
Sbjct: 163 MGSSGCRVTPIIDGTVIKNAVLSSKYGG 190

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 44/101 (43%)

Query: 397 SEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVN 456
           +E  +    IV    + +  LE+ ++ L   +      L+  +L++ Y  G     CV++
Sbjct: 104 AELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVID 163

Query: 457 IGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQ 497
           IG     I  V D   +     T+ YGGN +   LA +L +
Sbjct: 164 IGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARILPE 204

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 199 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 249

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 250 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 301

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 302 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 353

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 354 IVHHKC 359

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 6/94 (6%)

Query: 408 IPDLFKKSH------LETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQ 461
           IP L   +H      +E+    +  ++    + L+  SL   Y        C+++IG   
Sbjct: 108 IPLLLLNNHKWSQFQMESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNH 167

Query: 462 IRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILL 495
             I  + D T I   + TL+YGG+ +  +L  LL
Sbjct: 168 TDIVPIVDYTTINHLSNTLNYGGSYINTILQKLL 201

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTII 473
           K   E    +L  +    ++   ++ + + YG G +T  C V+ G   I I  V DG I+
Sbjct: 119 KKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTT-GCSVSCGHRGIGITTVIDGMIV 177

Query: 474 QDSAVTLDYGGNDVTNLLAILLQQ 497
             S+   + GG+ VTN +  LL+ 
Sbjct: 178 GGSSQISNTGGSAVTNTMLDLLRH 201

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ +       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 215 EKLCYVALD--FEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPE-------ALFHP 265

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ +       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 266 SVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 317

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 318 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 369

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 370 IVHHKC 375

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 38.5 bits (88), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  A+ +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTASQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 215 EKLCYVALDYD--QEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPE-------ALFHP 265

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VLG+ +       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 266 SVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 317

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 318 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 369

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 370 IVHHKC 375

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 394 ITKSEYKHYKAVIVIPDLFKKSH---LETFIRLLLNEMDFRSVALMQESLATCYGAGIST 450
           + K     Y  VI IP   K      L+ +  L     +   + ++ E LA     G S+
Sbjct: 98  VLKCNSDEYPLVITIPSANKDVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLGKSS 157

Query: 451 PTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQ 497
            + VVN+GA    +  + DGT+I+ + +   YGG+ +   +  +LQ+
Sbjct: 158 -SLVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFLDFQIVNILQE 203

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 33/187 (17%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VL + S       Y S+ K   D++     N   +G  +    +AER    ++ E+  L
Sbjct: 265 SVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER----MQKEITAL 320

Query: 768 V-ASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGN 826
             +S+E+            + AP     S+  W G S+LA +   ++++IS+ ++D  G 
Sbjct: 321 APSSMEVK-----------IIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESGP 367

Query: 827 RVLQYKC 833
            ++ +KC
Sbjct: 368 SIVHHKC 374

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query: 417 LETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDS 476
           +E +  L LN++   ++ ++ E LA     G S+   V+++GA    +  + DGT+++  
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKSS-ALVIDVGARGTTVTPIVDGTVVRSG 171

Query: 477 AVTLDYGGNDVTNLLAILLQQ 497
            +   +GG+ +   +A LL++
Sbjct: 172 VMKSRFGGDFLDYQVAKLLEE 192

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           +VL + S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           ++L + S       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++ +KC
Sbjct: 369 IVHHKC 374

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 59/158 (37%), Gaps = 47/158 (29%)

Query: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTC-VVNIGAEQIRIACVDDGTIIQDSAVT 479
           + +LL  M+F +  L      TC    +  PTC VV+IG +   ++ V DG  +  S+ +
Sbjct: 139 LEVLLENMEFEACFL--SPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLSKSSTS 196

Query: 480 LDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFI 539
               G    +LL  LL +   P K                             V LF   
Sbjct: 197 NFIAG----SLLNALLSKQLDPKK----------------------------TVPLFQIA 224

Query: 540 KRVPGIPSEKYDFKVFDEVILAPLGLFYPEIFKYIQER 577
           +R P    +K+DF+V             P +FK+  ER
Sbjct: 225 QRHPNFIPKKFDFEV------------DPSLFKFGNER 250

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E    LL    +  ++ +  +++ + Y +G +T  CVV+ G        V DG  +  S 
Sbjct: 148 EKMCELLFESFNVPALYVSVQAVLSLYASGRTT-GCVVDCGDGCCHAVPVFDGFSVPSSI 206

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
             +D  G D+T  L +LL+++
Sbjct: 207 RRIDIAGRDITEFLQLLLRKT 227

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 23/35 (65%)

Query: 799 WKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKC 833
           W G S+LA +   ++++IS+ ++D  G  ++ +KC
Sbjct: 340 WIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 199 EKLCYVALD--FEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPE-------ALFHP 249

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           ++LG+ +       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 250 SLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 301

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 302 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 353

Query: 828 VLQYKC 833
           ++  KC
Sbjct: 354 IVHLKC 359

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 50/114 (43%), Gaps = 2/114 (1%)

Query: 379 VSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQE 438
           VS L DS  SS K    ++E      ++V    + +  LE   + +   +   +  L+  
Sbjct: 87  VSILYDS--SSRKPGAFEAELSSIPLLMVAHHSWSQIQLEVITQFVFEALQINNALLLPA 144

Query: 439 SLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLA 492
           SLA+ Y        C+++IG     I  + D T ++  +  + YGG  + + L+
Sbjct: 145 SLASSYAMSSLQNCCIIDIGTTHTDIIPIIDYTPLEALSSKIAYGGQLINDQLS 198

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 31/186 (16%)

Query: 654 DKKCFVPLDKAIVQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRP 713
           +K C+V LD    Q +  AA +  I K  +     +I  G     A +        ++ P
Sbjct: 214 EKLCYVALD--FEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPE-------ALFHP 264

Query: 714 AVLGISSFP---NFYKSLTKQLKDIQTSNKSN---TGDKSQEQEVAERSIALVKVELDKL 767
           ++LG+ +       Y S+ K   D++     N   +G  +    +AER        + K 
Sbjct: 265 SLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER--------MQKE 316

Query: 768 VASLEIPNSGDHFFTVGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNR 827
           + +L  P+S      V ++  P         W G S+LA +   ++++IS+ ++D  G  
Sbjct: 317 ITALA-PSS----MKVKIIAPPER---KYSVWIGGSILASLTTFQQMWISKQEYDESGPS 368

Query: 828 VLQYKC 833
           ++  KC
Sbjct: 369 IVHLKC 374

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E    LL    +  ++ +  +++ + Y +G +T  CVV+ G        V DG  I  S 
Sbjct: 120 ERMCELLFESFNVPALYVSIQAVLSLYASGRTT-GCVVDCGDGCCHAVPVFDGFSIPSSI 178

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
             +D  G D+T  L +LL+++
Sbjct: 179 RRIDIAGRDITEFLQLLLRKT 199

>SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 aa]
           {ON} similar to uniprot|Q05123 Saccharomyces cerevisiae
           YMR033W ARP9 Actin-related protein
          Length = 466

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%)

Query: 412 FKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGT 471
           + +SH+E   + +   ++  S  ++  +LAT Y  G    + V+++G E+  +  + D T
Sbjct: 118 WTRSHIEQITQYVFELLEINSFMILPLALATTYAFGSLQNSLVIDVGLEKTDLVPILDYT 177

Query: 472 IIQDSAVTLDYGGNDVTNLLAILL 495
            I   + TL  G   +   L  LL
Sbjct: 178 PIGFLSTTLRKGSTSINAELEKLL 201

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 45/115 (39%), Gaps = 17/115 (14%)

Query: 412 FKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGT 471
           + +S  E   + +   M   +  +M  SLAT Y  G      V++IG     I  + D T
Sbjct: 56  WSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVIDIGGAHTDIIPIVDYT 115

Query: 472 IIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTA--EDFKKKFV 524
            ++  A +   GG+ +   LA               S L GW  A  ED K+  V
Sbjct: 116 PLEYLAYSAPVGGDAINAKLA---------------SFLPGWSAASIEDLKRSSV 155

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%)

Query: 416 HLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQD 475
           H+E     +   +   S   +  SLA+ Y       +C+++IG     I  V D   +  
Sbjct: 123 HIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQMDH 182

Query: 476 SAVTLDYGGNDVTNLLAILL 495
            A ++ YGG  + + L+ +L
Sbjct: 183 IASSIKYGGQTINDSLSKIL 202

>Ecym_5146 Chr5 (308809..309951) [1143 bp, 380 aa] {ON} similar to
           Ashbya gossypii ABL083W
          Length = 380

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 98/228 (42%), Gaps = 32/228 (14%)

Query: 317 EVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDL- 375
           EV D N  G ID  ++ D   + E  +R  G   I     C S +FN   NN   IQ L 
Sbjct: 123 EVVD-NVIGIID--HHEDNNMHKESIKRANGPRIIEPAGSCSSLVFNYWLNNL-GIQRLK 178

Query: 376 -LGDVSELVDSALSSD----KFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDF 430
            L D+S+L  SAL  D    K+ +TK + + Y   +   D  +    E +   L+ + D 
Sbjct: 179 PLTDISKLFLSALLMDTVNMKYKVTKLDPEAYSNYV---DFLQGMDFEHYYETLVAKKDI 235

Query: 431 RSVALMQESLATCYGA-GISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTN 489
             + + +  LA  Y     S+   VV +G            +I +     L+  GND   
Sbjct: 236 DGLPI-EGILAKDYKQFSFSSHHGVVKVGT----------SSIPRPLQWILEQHGND--- 281

Query: 490 LLAILLQQSKFPY-KNWNLSTL-YGWKTAEDFKKKFVTFQDADIAVQL 535
               +LQ  K+   KN +L  L + W +A+   ++FV   D D +++L
Sbjct: 282 --EFVLQSRKYIIKKNLDLLLLVHHWISADVHYRQFVVVVDNDKSMEL 327

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCYGA-GISTPTCVVNIGAEQIRIACVDDGTI 472
           +S    +  LL    + + V    +SL + YG  G  +   VV+ G E   +  V DG  
Sbjct: 147 QSQRANWYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGLVVSSGNEDTCVVPVVDGRG 206

Query: 473 IQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLS-----TLYGWK--TAEDFKKKF 523
           +   A  +++GG    + L  LL   K+PY    LS     T+Y      AEDF+++ 
Sbjct: 207 VVSEAKRINWGGQQAVDYLTGLL-ALKYPYFPTKLSGSQFETIYREHCYVAEDFEREI 263

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 22/35 (62%)

Query: 799 WKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKC 833
           W G S+LA +   ++++IS+ ++D  G  ++  KC
Sbjct: 340 WIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

>NDAI0C00580 Chr3 complement(110741..112246) [1506 bp, 501 aa] {ON}
           Anc_2.593 YMR033W
          Length = 501

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 8/108 (7%)

Query: 384 DSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATC 443
           D+A S++  NI      HY         + +  LE   + +   +   +  L+  SL+T 
Sbjct: 103 DTAFSTELSNIPFLLITHYT--------WSQPQLEKITQFIFESLKILNAMLLPSSLSTS 154

Query: 444 YGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLL 491
                    C+++IG     I  + D T +   A TL  GG+++   L
Sbjct: 155 VAMISLQNCCIIDIGKSHTDIIPIIDYTPLSFLASTLPMGGDNINKFL 202

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 377 GDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALM 436
            D+ +L D A   D+  I  +    +K ++  P +    + E    ++  + DF  V + 
Sbjct: 82  ADMEQLWDYAFY-DQMKIPST--AGHKVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVA 138

Query: 437 QESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQ 496
            +++   Y  G+S+   VV+ G     I  V +  ++      LD  G DVT  L  LL 
Sbjct: 139 IQAVLALYAQGLSS-GVVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLS 197

Query: 497 QSKFPY 502
           +  + +
Sbjct: 198 RRGYAF 203

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 42/109 (38%), Gaps = 4/109 (3%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCY---GAGISTPTCVVNIGAEQIRIACVDDG 470
           +S    + +LL    D  S     +SL   Y        +   V+N G E   I  +  G
Sbjct: 144 QSQRANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQG 203

Query: 471 TIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDF 519
             I   A  +++GG   T  L+ LL   K+PY    LS        EDF
Sbjct: 204 KGILTEAKRINWGGRHSTEYLSSLL-TLKYPYFPTKLSEFQYQTMYEDF 251

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E    +L    +  +V +  +++ + Y +G +T  CV++ G        V DG  +  S 
Sbjct: 122 EAMCEMLFETFNVPAVYVSIQAVLSLYASGRTT-GCVLDCGDGCCHSVPVFDGFSLPSSI 180

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
             +D  G DVT  L +LL+++
Sbjct: 181 RRIDVAGRDVTEFLQLLLRKT 201

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E   ++L    D  ++ +   ++ + Y +G  T  CVV+ G        + DG  +  S 
Sbjct: 125 EQMAQVLFETFDVSALYVSNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASM 183

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
           + +D GG D+T  L   L++S
Sbjct: 184 MRMDIGGADITEQLQFQLRKS 204

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 2/104 (1%)

Query: 428 MDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDV 487
           +   S  ++  SLA  +       + V++IG     I  + D + +   + T+  GGND+
Sbjct: 143 LKLNSFLMLPTSLAATHAMAALQNSIVIDIGKTHTDILPIVDYSQLTHFSSTIPIGGNDI 202

Query: 488 -TNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDAD 530
            T+L +IL   S    ++  LS +Y    AE  KK +     AD
Sbjct: 203 NTHLKSILPSLSDDQIEDLKLSNIYEVLNAE-AKKNYADLHQAD 245

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 53/119 (44%), Gaps = 7/119 (5%)

Query: 405 VIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRI 464
            I +P     +    F  L+L ++    + L+ E LA     G ST   VV++GA ++ +
Sbjct: 95  CITVPPDLSATVRSQFHELVLCKLRAPVLQLISEPLAVTLSLGRST-ALVVDVGASKVTV 153

Query: 465 ACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKF 523
             + DG++++   +   Y G+ +   L   L          + ++LY W+ +  + + F
Sbjct: 154 TPIVDGSVVKTGILRSRYAGDFLDFQLMKALDDRP------DGTSLYHWQQSRTWMRDF 206

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 405 VIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRI 464
           VI +P          ++ L L ++      ++ E LA     G +T + VV+IGA +I +
Sbjct: 94  VITVPPDLSAGTRSKYLELALEKLKVPVFQMVVEPLAISLSLGRNT-SLVVDIGASKITV 152

Query: 465 ACVDDGTIIQDSAVTLDYGGN 485
             + DG++++ + +   + G+
Sbjct: 153 TPIIDGSVVKPAVLRSKFAGD 173

>KLTH0G13970g Chr7 complement(1208540..1209454) [915 bp, 304 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W
          Length = 304

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 422 RLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLD 481
           R+LL  +   S+  + + L TC   G+     VV+I  E + I  V D  I+Q   V   
Sbjct: 81  RVLLETLKVSSIMFVPDVLTTCIAGGVRNAI-VVDIAWEHLVIVPVFDLRILQKQMVVSS 139

Query: 482 YGGN 485
            GG 
Sbjct: 140 RGGK 143

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTC-VVNIGAEQIRIACVDDGTIIQDSAVT 479
           + +LL  M+F +  L   S+ TC       P C VV+IG +   ++ V DG  +  S++ 
Sbjct: 132 LEILLEGMNFEACYL--SSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMR 189

Query: 480 LDYGGNDVTNLLAILLQ 496
               G  +  L+   LQ
Sbjct: 190 NFIAGKYINTLIEKYLQ 206

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 73/176 (41%), Gaps = 19/176 (10%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKK 522
            I  V +  ++      LD  G DVT  L  LL +     + +  +    ++T    K+K
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR-----RGYAFNRTADFETVRQIKEK 218

Query: 523 --FVTFQDADIAVQLFNFIKRVPGIPSEKYDF------KVFDEVILAPLGLFYPEI 570
             +V++ D D+  +L     R      EKY+       KV  E   AP  LF P +
Sbjct: 219 LCYVSY-DLDLDTRL----ARETTTLVEKYELPDGRIIKVGQERFEAPECLFQPNL 269

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 2/107 (1%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCY-GAGISTPTCVVNIGAEQIRIACVDDGTI 472
           +S    + ++L    D   V    +SL   Y  +G ++   V+  G E   +  V DG  
Sbjct: 143 QSQRANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKG 202

Query: 473 IQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDF 519
           +   +  +++GGN  T  L  L+   K+PY    LS        ED+
Sbjct: 203 VLTESKRINWGGNQATEYLTNLM-SLKYPYFPTKLSPFQYKTMYEDY 248

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTC-VVNIGAEQIRIACVDDGTIIQDSAVT 479
           + +LL  + F +  L   S  TC       P C VV++G +   ++ V DG  +  S + 
Sbjct: 128 LEILLESLQFEACYL--SSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMR 185

Query: 480 LDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYG-WKTAEDFKKKFVTFQDADIAVQLFNF 538
               GN +  L+       K P K  +L  L+   +   +FKKK   +Q   I   L+N+
Sbjct: 186 NFLAGNCINELI-------KKPLKGKDLVPLFEIAQRKPEFKKKTFDYQ---IHPSLYNY 235

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 47/102 (46%), Gaps = 1/102 (0%)

Query: 397 SEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVN 456
           S  + +  ++    L  K + E    LL       +V +  +++ + Y +G +T  CV++
Sbjct: 102 SSLQDHPVLVTEAPLNPKKNREQMCELLFETFSVPAVYVSIQAVLSLYASGRTT-GCVLD 160

Query: 457 IGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQS 498
            G        V DG  +  +   +D  G D++ LL +L+++S
Sbjct: 161 SGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS 202

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E   ++L    +  ++ +   ++ + Y +G  T  CVV+ G        + DG  +  S 
Sbjct: 125 EVMAQVLFETFNLPALYISNPAVLSLYASG-RTTGCVVDCGEGYCSTVPIYDGFALPASI 183

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
           + +D GG D+T  L   L++S
Sbjct: 184 MRMDIGGRDITEQLQFQLRKS 204

>Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar to
            Ashbya gossypii AGR043W
          Length = 3698

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 364  LESNNYSSIQDLLGDVSE--LVDSALSSDKFNITKSEYKHYKAVIVIPDL-FKKSHLETF 420
            L    + SIQD L   SE  L D A+   K  I K EY+   A+IV P L F + H E  
Sbjct: 2275 LSCEEFKSIQDSLESPSEEYLHDKAVKFSKVVIDKKEYEKSLAIIVTPSLEFLQEHAENI 2334

Query: 421  IRLLL 425
             R+L+
Sbjct: 2335 DRILV 2339

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 52/120 (43%), Gaps = 10/120 (8%)

Query: 414 KSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPT-CVVNIGAEQIRIACVDDGTI 472
           +S  E + +LL        V    +SL + Y    +T +  V+N G E   +  V +G  
Sbjct: 143 QSQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKG 202

Query: 473 IQDSAVTLDYGGND----VTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQD 528
           +   A  +++GG      ++NLLA+     K+PY     ST       EDF    V +QD
Sbjct: 203 VLSEAKRINWGGRQSVEYLSNLLAL-----KYPYFPIKPSTHQFQSLYEDFCYVSVDYQD 257

>KLLA0F03036g Chr6 complement(283504..284439) [936 bp, 311 aa] {ON}
           highly similar to uniprot|P15703 Saccharomyces
           cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
           protein of the cell wall involved in cell wall
           maintenance
          Length = 311

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 687 NIIIVGGGAN-IPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNKSN 742
           N+++ GG A  I A DF++++  + W+   +  +S+ +F+  + + L+ IQT+  S 
Sbjct: 167 NVLVDGGSATAIQAADFVMANAFSYWQGQTMDNASY-SFFDDIMQALQTIQTTKGST 222

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E   +++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 107 KILLTEPPMNPLKNREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 165

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 166 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 205

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 446 AGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQS 498
           AG  T  CV++ G    +   V DG  I  +   +D  G DVT  L +LL++S
Sbjct: 150 AGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKS 202

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 421 IRLLLNEMDFRSVALMQESLATCYGAGISTPTC-VVNIGAEQIRIACVDDGTIIQDSAVT 479
           + +LL  MDF +  L   S    + AG   P C VV+IG +   ++ V DG  +  S+  
Sbjct: 128 LEVLLEGMDFEACYLSPVSTCVSFAAG--RPNCLVVDIGHDTTSVSPVIDGMTLSKSSTR 185

Query: 480 LDYGGNDVTNLLAILLQ 496
               G  + +L+   L+
Sbjct: 186 NFIAGRYINHLIETYLK 202

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 393 NITKSEYKHYKAVIVIP---DLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGIS 449
           N  K +   +  VI +P   D      +E +  L  N+ +   + ++ E LA     G S
Sbjct: 90  NELKCKSDEFPLVITVPIMKDAVALRVMERYFDLAFNKFNVPVLQVIIEPLAIALSMGKS 149

Query: 450 TPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGN 485
           +   VV++G+    +  V DGT+ ++S +   Y G+
Sbjct: 150 S-ALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAGD 184

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E   ++L    +  ++ +   ++ + Y +G +T  CV++ G        + DG  +  S 
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASGRTT-GCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
           + +D GG D+T  L   L++S
Sbjct: 184 MRMDIGGRDITKQLQFQLRKS 204

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E + +L   +     + L+   LA  +  G      VV+IGA+  ++  + DGTII+D+ 
Sbjct: 138 EEYYKLAFEKFRIPILYLIPSPLAIAFSLG-KKSALVVDIGAKTCQVTPILDGTIIKDAV 196

Query: 478 VTLDYGGN--DVTNLLAILLQQSKFPYKNWNLSTLYGW----KTAEDFKKKFVTFQD 528
           +   + G+  D   +  + L ++     N  + +L  W     T  DFK++FV   D
Sbjct: 197 MKSKFAGDFLDYQIMKKLNLIETSTDANN-KIDSLKIWLQSNTTILDFKRQFVQVTD 252

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P L    + E    ++  + DF  V +  +++   Y  G+S+   V++ G    
Sbjct: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVIDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 68/170 (40%), Gaps = 21/170 (12%)

Query: 330 IYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSS 389
           I N D  Y G  AQ+  G    LR P  +  +      N+  ++             L S
Sbjct: 52  ISNNDLTYIGNRAQKSRG-LLRLRHPMNRGIV-----ENWDDME------------TLWS 93

Query: 390 DKFN--ITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAG 447
             FN  +  +++  +  +I    L  + + +    +   + DF +V +   S  + Y +G
Sbjct: 94  HTFNDILKINDFDEHPLLITEAPLNPEKNRDKMCEVFFEKFDFAAVYIANPSTLSLYASG 153

Query: 448 ISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQ 497
            +T  CV++ G        + +G  +  S   +D GG DVT  L   +++
Sbjct: 154 RTT-GCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQIRK 202

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 51  KVMLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 109

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 149

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 55/137 (40%), Gaps = 11/137 (8%)

Query: 405 VIVIPDLFKKSHLETFIRLLLNEMDFRS-----VALMQESLATCYGAGISTPTCVVNIGA 459
           V+ +P  F K      + +   +M F       V  + E LA     G S+   V++IG 
Sbjct: 102 VVTMP-AFSKPERARLVMMRYMDMAFYRFNVPVVQFVIEPLAIALSMGKSS-ALVIDIGT 159

Query: 460 EQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTA--- 516
               +  V DG +++   V   YGG  +  L    + +     +  + S+L  W  A   
Sbjct: 160 NGCTVTPVYDGVVVRTGCVRSKYGGAFLDYLAKTKMSEKLGQDQEGSGSSLQVWYEANTW 219

Query: 517 -EDFKKKFVTFQDADIA 532
            +DFK   +   D D+A
Sbjct: 220 IQDFKASMLEVADKDLA 236

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>Suva_5.44 Chr5 complement(76303..79920) [3618 bp, 1205 aa] {ON}
           YEL025C (REAL)
          Length = 1205

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 42/95 (44%), Gaps = 13/95 (13%)

Query: 247 NLVAVPRSQVVNPVDET--PV-NVLNIELDDQFHELTNQLKYNFKER---MKYYKRKMQS 300
           N V V  S VV  +D T  P+ N LN  LD   +   N + Y+   R    K Y     +
Sbjct: 115 NAVTVYDSNVVPKLDTTSSPISNWLNASLDGILYTCNNNMSYDSHSRKSSAKIYSFDFGN 174

Query: 301 N-------AHEQVTSFNSNSKPEEVSDKNDQGKID 328
                   A E++ SF+  S+   V DK D GK+D
Sbjct: 175 KLVETFYAADEEIISFDFISRERLVHDKRDPGKLD 209

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 382 LVDSALSSDKFN----ITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQ 437
           L+  +L SD+ N      ++E  +   +++    + +S LET  + +   ++  ++  + 
Sbjct: 85  LIYVSLLSDRANKGQDAFEAELSNIPLLLITHHSWSQSDLETITQYIFESLEINNLIQLP 144

Query: 438 ESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQ 497
            SLA  Y        C++++G     I  + D   +     +L  GG  + + L  LL Q
Sbjct: 145 ASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLVSSLPVGGQSINDSLKKLLPQ 204

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 73/176 (41%), Gaps = 19/176 (10%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKK 522
            I  V +  ++      LD  G DVT  L  LL +     + +  +    ++T    K+K
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSR-----RGYAFNRTADFETVRQIKEK 218

Query: 523 --FVTFQDADIAVQLFNFIKRVPGIPSEKYDF------KVFDEVILAPLGLFYPEI 570
             +V++ D D+  +L     R   +  E Y+       KV  E   AP  LF P +
Sbjct: 219 LCYVSY-DLDLDTKL----ARETTVLVESYELPDGRTIKVGQERFEAPECLFQPGL 269

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KVLLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAF 203

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 73/173 (42%), Gaps = 13/173 (7%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++    DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KVLLTEPPMNPVKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKK 522
            I  V +  ++      LD  G DVT  L  LL +     + ++ +    ++T    K+K
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR-----RGYSFNRTADFETVRQIKEK 218

Query: 523 --FVTFQ---DADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAPLGLFYPEI 570
             +V++    D  +A +    ++    +P  +   KV  E   AP  LF P++
Sbjct: 219 VCYVSYDLNLDTKLARETTTLVQEYE-LPDGRI-IKVGQERFEAPECLFQPDL 269

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           E   +++    +  ++ +   ++ + Y +G  T  CVV+ G        + DG  +  S 
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPAVLSLYASG-RTTGCVVDCGEGYCSSVPIYDGFALPASI 183

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
           + +D GG D+T  L   +++S
Sbjct: 184 MRMDIGGGDITEQLQFQIRKS 204

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 408 IPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACV 467
           +PD  +  +LE    + L  +      L+ E LA     G +T   VV++GA +  +  +
Sbjct: 98  LPDAVRAQYLE----MALGRLKIPVFQLVVEPLAVALSLGRNT-ALVVDVGAAKSTVTPI 152

Query: 468 DDGTIIQDSAVTLDYGGN 485
            DGT++Q +     + G+
Sbjct: 153 IDGTVVQTAVARSKFAGD 170

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462
           K ++  P +    + E    ++  + DF  V +  +++   Y  G+S+   VV+ G    
Sbjct: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVVDSGDGVT 163

Query: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203

>AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR106W
           (ARP10)
          Length = 305

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 407 VIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIAC 466
           ++ D+ +K  L    ++LLN +   SV  + + L  C  AG+S    VV++G EQ  +  
Sbjct: 68  ILLDIPRKKRL---CQVLLNRLRVNSVVFLPDVLMACVSAGVSNAL-VVDVGWEQTAVVP 123

Query: 467 VDDGTII 473
           V D  I+
Sbjct: 124 VVDMRIL 130

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 405 VIVIPDLFKKSH------LETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIG 458
           +I IP    K+       +E + ++   +     + ++ ESL+   G G  T + V++I 
Sbjct: 103 LITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKT-SLVIDIS 161

Query: 459 AEQIRIACVDDGTIIQDSAVTLDYGGN 485
                +  + DG II++  V   YGG+
Sbjct: 162 GSGSSVTPIVDGVIIKNGIVKSKYGGD 188

>KLLA0C19360g Chr3 complement(1731276..1732223) [948 bp, 315 aa]
           {ON} highly similar to uniprot|P28272 Saccharomyces
           cerevisiae YKL216W URA1 The enzyme catalyzes the
           conversion of dihydroorotic acid to orotic acid
           dihydroorotate dehydrogenase
          Length = 315

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 493 ILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADI-AVQLFNF-IKRVPGIPSEKY 550
           +L +Q +FP +N    ++ G    E+ K      QD++   +   N     VPG P   Y
Sbjct: 86  VLDRQDRFPSENPPFMSVAGMSIDENIKL-LHRIQDSNFRGITELNLSCPNVPGKPQVAY 144

Query: 551 DFKVFDEVILA-------PLGLFYPEIFKY 573
           DF++ D+++ +       PLG+  P  F +
Sbjct: 145 DFELTDQILSSVFEFFTKPLGVKLPPYFDF 174

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR086W
           (SMC4)
          Length = 1370

 Score = 32.0 bits (71), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 455 VNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKF--PYKNWNLSTLYG 512
           V  G ++ R+  +D G +I D + T+  GG+   + L    QQS    P +   +     
Sbjct: 750 VAYGKKRYRVVTLD-GKLI-DISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELN 807

Query: 513 WKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAPL 563
            +  ++FK  F TFQ+ + A+Q  N++ R P I  E    K+  E I A L
Sbjct: 808 ER-EKNFKVAFETFQEMESALQ--NYLDRQPEIEVELSKQKMDIETISAEL 855

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 418 ETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSA 477
           ET   +L    +F ++ +   ++ + Y  G  T  CV+  G        V  G  +  S 
Sbjct: 128 ETMCEILYETFNFDALYVAHPAVLSLYATG-QTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 478 VTLDYGGNDVTNLLAILLQQS 498
             +D GG D+T  L   +++S
Sbjct: 187 RRIDIGGRDITQELQFYIRKS 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,909,663
Number of extensions: 4041272
Number of successful extensions: 15265
Number of sequences better than 10.0: 149
Number of HSP's gapped: 15739
Number of HSP's successfully gapped: 150
Length of query: 837
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 719
Effective length of database: 39,950,811
Effective search space: 28724633109
Effective search space used: 28724633109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)