Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I06050g1.195ON53853828080.0
YJL153C (INO1)1.195ON53353020290.0
Smik_10.811.195ON53352720160.0
Suva_6.2311.195ON54353820170.0
Skud_10.631.195ON53353020100.0
KLLA0D16412g1.195ON52952219970.0
TDEL0C035801.195ON53053819040.0
ZYRO0G18150g1.195ON53053818990.0
SAKL0F00396g1.195ON52752818930.0
KAFR0F018601.195ON54253218090.0
TPHA0A028801.195ON54053817990.0
Kpol_2001.171.195ON47146217870.0
TBLA0C020701.195ON53652417740.0
NCAS0I027501.195ON58352117410.0
KNAG0C025201.195ON59252217400.0
NDAI0B001201.195ON56753717160.0
TBLA0A032005.363ON1071165706.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I06050g
         (538 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...  1086   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   786   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...   781   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...   781   0.0  
Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...   778   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   773   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   738   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   736   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   733   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   701   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   697   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   692   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   687   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   675   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   674   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   665   0.0  
TBLA0A03200 Chr1 complement(758622..761837) [3216 bp, 1071 aa] {...    32   6.0  

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/538 (97%), Positives = 525/538 (97%)

Query: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60
           MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL
Sbjct: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60

Query: 61  NKPERXXXXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120
           NKPER             STMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG
Sbjct: 61  NKPERLGVMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120

Query: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180
           VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD
Sbjct: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180

Query: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240
           HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD
Sbjct: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240

Query: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300
           KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP
Sbjct: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300

Query: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360
           QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG
Sbjct: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360

Query: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420
           YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE
Sbjct: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420

Query: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480
           YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE
Sbjct: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480

Query: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538
           NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK
Sbjct: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/530 (71%), Positives = 445/530 (83%), Gaps = 8/530 (1%)

Query: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXX 67
           S++V  V DK +YK+NELLT Y+Y  N V T +   +F+VTP  ++Y FK+DL KPE+  
Sbjct: 11  SVKV--VTDKCTYKDNELLTKYSYE-NAVVTKTASGRFDVTPTVQDYVFKLDLKKPEKLG 67

Query: 68  XXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127
                      ST++A+VLANKHNV F+T  KEG+ +PNY+GS+TQ ST+KLG+D++G D
Sbjct: 68  IMLIGLGGNNGSTLVASVLANKHNVEFQT--KEGVKQPNYFGSMTQCSTLKLGIDAEGND 125

Query: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187
           VY PFNSL+PMV+PNDFVVSGWDIN A + +AM+R+ VLE DL+ +L   M   KPL S+
Sbjct: 126 VYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVKPLPSI 185

Query: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247
           YYPDFIAANQDERA+NC+N+D + G VTT GKW HL  IR DI+ FK++N LDKVI+LWT
Sbjct: 186 YYPDFIAANQDERANNCINLD-EKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVIVLWT 244

Query: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307
           ANTERYVE+ PGVNDTMENLL++IKNDH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 245 ANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367
           L++LAE   + IAGDD KSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDGYNLS+P+
Sbjct: 305 LVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPK 364

Query: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427
           QFRSKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424

Query: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLS 487
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFC+RV+Y+ VD     E  G FENFYPVL+
Sbjct: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPV--KEDAGKFENFYPVLT 482

Query: 488 FLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           FLSYWLKAPLT+PG+ P+NGLNKQRTALENFLRLLIGLP+ +ELRFEERL
Sbjct: 483 FLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERL 532

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/527 (70%), Positives = 441/527 (83%), Gaps = 6/527 (1%)

Query: 11  VNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXXX 70
           V  V DK +Y ENELLT Y+Y  N V T +   QF+VTP  ++Y FK+DLNKP++     
Sbjct: 12  VKVVTDKCTYTENELLTKYSYE-NAVVTKTAGGQFDVTPTVQDYVFKLDLNKPKKLGIML 70

Query: 71  XXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKDVYV 130
                   ST++A++LAN+H++ F+T  KEGL +PNY+GS+TQ ST+KLG+D++G DVY 
Sbjct: 71  IGLGGNNGSTLVASILANRHDMEFQT--KEGLKKPNYFGSMTQCSTLKLGIDAEGNDVYA 128

Query: 131 PFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYP 190
           PFNSL+PMVNPNDF+VSGWDIN A + +AM+R  VLE DL+ +L   M   KPL S+YYP
Sbjct: 129 PFNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVKPLPSIYYP 188

Query: 191 DFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANT 250
           DFIAANQDERA+NC+N+D + GKVTT GKW HL  IR DI+ FK++N LDKVI+LWTANT
Sbjct: 189 DFIAANQDERANNCINLD-EKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVIVLWTANT 247

Query: 251 ERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIE 310
           ERYVE+  GVNDTM+NLL++IK+DH EIAPST+FAAASILE  PYINGSPQNTFVPGL++
Sbjct: 248 ERYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNTFVPGLVQ 307

Query: 311 LAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFR 370
           LAE   + IAGDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDGYNLS+P+QFR
Sbjct: 308 LAEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNLSAPKQFR 367

Query: 371 SKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGH 430
           SKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGH
Sbjct: 368 SKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGH 427

Query: 431 NRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLS 490
           NRISIHNVCEDSLLATPLIIDL+VMTEFCSRV+Y+   G    E    +E+FYPVL+FLS
Sbjct: 428 NRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKK--GSSVQEDHDKYESFYPVLTFLS 485

Query: 491 YWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           YWLKAPLT+PG+ P+NGLNKQRTALENFLRLLIGLP+++ELRFEERL
Sbjct: 486 YWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERL 532

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/538 (69%), Positives = 441/538 (81%), Gaps = 14/538 (2%)

Query: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXX 67
           S+RV    +K +Y +NELLT Y+Y   VV    D  +++VTP  ++Y FK+DLNKP +  
Sbjct: 11  SVRV--ASNKCTYTDNELLTKYSYENAVVSKTPDG-RYDVTPTVQDYVFKLDLNKPAKLG 67

Query: 68  XXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127
                      ST  AA+LANKHN+ F+T  KEGL +PNY+GS+TQSST+KLG+D++G D
Sbjct: 68  VMLVGLGGNNGSTFTAAILANKHNIEFQT--KEGLKKPNYFGSMTQSSTLKLGIDAQGND 125

Query: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187
           VY PFNSL+PM NPNDFVV+GWDIN A   +AM+RA VLE DL+ +L   M   KPL S+
Sbjct: 126 VYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLKPLPSI 185

Query: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247
           YYPDFIAANQD+RA+NC+N+D + G VTT GKW HL  IR+DI++FK++N LDKVI+LWT
Sbjct: 186 YYPDFIAANQDQRANNCINLD-EKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVIVLWT 244

Query: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307
           ANTERYVE+  GVNDTMENLL++IK+DH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 245 ANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367
           L++LAE   + IAGDDFKSGQTKMKSVLAQFLVDAGI+PVSIASYNHLGNNDG+NLS+P+
Sbjct: 305 LVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLSAPK 364

Query: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427
           QFRSKEISK+SV+DDII SN ILYNDKLGNK+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424

Query: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAK--------GDF 479
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFCSRV+Y+  D                G F
Sbjct: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENENDGKF 484

Query: 480 ENFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           E+FYPVL+FLSYWLKAPLT+PG+ P+NGLNKQRTALENF+RLLIGLP+++ELRFEERL
Sbjct: 485 ESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEERL 542

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/530 (71%), Positives = 441/530 (83%), Gaps = 8/530 (1%)

Query: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXX 67
           S+RV    +K +Y E+ELLT Y+Y   VV    D  +F+VTP  ++Y FKV L+KP++  
Sbjct: 11  SVRV--ATEKCTYTEDELLTKYSYENAVVSKTPDG-RFDVTPTVQDYVFKVGLDKPDKLG 67

Query: 68  XXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127
                      ST++A+VLANKH++ F T  KEGL +PNY+GS+TQSST+KLGVD+ G D
Sbjct: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHT--KEGLKKPNYFGSMTQSSTLKLGVDAAGND 125

Query: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187
           VY PFNSL+PMVNPNDFV+SGWDIN A + +AM+RA VLE DL+ +L   M   KPL SV
Sbjct: 126 VYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSV 185

Query: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247
           YYPDFIAANQDERA+NC+NVD + G VTT GKW HL  IR+DI+ FK++N LDKVI+LWT
Sbjct: 186 YYPDFIAANQDERANNCINVDAK-GSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWT 244

Query: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307
           ANTERYVEI  GVNDTMENLL++IKNDH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 245 ANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304

Query: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367
           L++LAE     IAGDD KSGQTK+KSVLAQFLVDAGI+P+SIASYNHLGNNDGYNLS+P+
Sbjct: 305 LVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPK 364

Query: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427
           QFRSKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424

Query: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLS 487
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFCSRV+Y+ V+     E  G FE+FYPVL+
Sbjct: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVN--PAQEDDGKFESFYPVLT 482

Query: 488 FLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           FLSYWLKAPLT+PG+ P+NGLNKQR+ALENF+RLLIGLP+++ELRFEERL
Sbjct: 483 FLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/522 (71%), Positives = 426/522 (81%), Gaps = 9/522 (1%)

Query: 16  DKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXXXXXXXX 75
           D   + E EL T YTY   +V  ++D   F V P+ ++Y+FKVDL  P +          
Sbjct: 16  DVAEFSETELTTKYTYRNAIVEKSADGV-FNVEPVTQDYEFKVDLKLP-KVGVMLVGLGG 73

Query: 76  XXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKDVYVPFNSL 135
              +T +A++LANKH V F+T  KEGL E NYYGS+TQSST+KLGVD++G DVY PFNSL
Sbjct: 74  NNGTTFLASILANKHKVKFQT--KEGLKEANYYGSVTQSSTLKLGVDAEGNDVYAPFNSL 131

Query: 136 VPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIAA 195
           VPMV+PNDF VSGWDINGA +  AM RA VL VDL+NKL   M  HKPL S+YYPDFIAA
Sbjct: 132 VPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKPLPSIYYPDFIAA 191

Query: 196 NQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERYVE 255
           NQDERADNC N D + G V+   KW H+ HIRNDIR FK+ N LDKV++LWTANTERY +
Sbjct: 192 NQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVLVLWTANTERYAD 251

Query: 256 ILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAEKN 315
           I+ GVNDT ENL+ AI++DH EIAPST+FA ASILE+ PYINGSPQNTFVPG+I+LAEK 
Sbjct: 252 IVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNTFVPGVIDLAEKE 311

Query: 316 DSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEIS 375
            + IAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQF+SKEIS
Sbjct: 312 GAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFKSKEIS 371

Query: 376 KASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRISI 435
           KASVVDDIIESN ILYNDKLGNKIDHCIVIKYM AVGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 372 KASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYSELMLGGHNRISI 431

Query: 436 HNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWLKA 495
           HNVCEDSLLATPLIIDL+VM EFCSR+ Y+ ++     +  G + +FYPVL+ LSYWLKA
Sbjct: 432 HNVCEDSLLATPLIIDLLVMAEFCSRIKYKKIN-----DLSGGYHSFYPVLTMLSYWLKA 486

Query: 496 PLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           PLT+PG++ INGLNKQR ALENFLRLLIGLPA+DELRFEERL
Sbjct: 487 PLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERL 528

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/538 (66%), Positives = 425/538 (78%), Gaps = 8/538 (1%)

Query: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60
           MTV +  S  +N   DK  Y E +L T Y Y  +VV  +      EV P  ++Y+F+VDL
Sbjct: 1   MTVQRYFSPTINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDL 60

Query: 61  NKPERXXXXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120
             P +             +T++A+VLAN+  + F T+D  G  E NYYGS+TQSSTIKLG
Sbjct: 61  KIP-KIGVMLVGLGGNNGTTLVASVLANRDKIRFHTKD--GAKEANYYGSVTQSSTIKLG 117

Query: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180
           +D +G DVYVPFNS++P V+PNDFVV GWDINGA +  AM R+ VLE DL+ +L   M  
Sbjct: 118 IDEQGNDVYVPFNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAK 177

Query: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240
             PL S+YYPDFIAANQDERADNC+N D ++G V+T GKW H+  IR DI+ FK  NDLD
Sbjct: 178 TVPLPSIYYPDFIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLD 237

Query: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300
           KVI+LWTANTERY ++L  VND  +NLL AIKNDH EIAPSTIFA ASILE  PYINGSP
Sbjct: 238 KVIVLWTANTERYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSP 297

Query: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360
           QNTFVPG+I+LAEK+++LIAGDDFKSGQTK+KSVLAQFLVDAGI+PVSIASYNHLGNNDG
Sbjct: 298 QNTFVPGVIDLAEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDG 357

Query: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420
           +NL+S +QF+SKEISK SVVDD+I SN ILYN+K GNKIDHCIVIKYM+AVGDSKVAMDE
Sbjct: 358 FNLTSERQFKSKEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDE 417

Query: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480
           YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVM EFCSRV+Y+ + G D    +  +E
Sbjct: 418 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKL-GSD----QQSYE 472

Query: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538
           +FY +LSFLSYWLKAPLT+ G++ INGLNKQR  +ENFLRLLIGLPA+DELRFEE+LK
Sbjct: 473 SFYSILSFLSYWLKAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKLK 530

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/538 (67%), Positives = 416/538 (77%), Gaps = 8/538 (1%)

Query: 1   MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDL 60
           MT     +  V    DKV Y E EL T YTY  ++V  N+     +V P+ + Y FKVDL
Sbjct: 1   MTAANYFTPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDL 60

Query: 61  NKPERXXXXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLG 120
             P R             +T +A++LAN+  + F   +KEGL E NYYGS+TQ ST+KLG
Sbjct: 61  KLP-RVGVMLVGIGGNNGTTFLASILANRQKMKFH--NKEGLKEANYYGSVTQCSTLKLG 117

Query: 121 VDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKD 180
           V   G D YVPFNSL+P V+PNDF V+GWDI+   +  AMERA VLE DL+ +L P M +
Sbjct: 118 VRPDGNDFYVPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSE 177

Query: 181 HKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLD 240
           +KPL S+YYPDFIAANQD RADNC+N     G  +T  KWEHL  IR DIR FKQQ DLD
Sbjct: 178 YKPLPSIYYPDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLD 237

Query: 241 KVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSP 300
           KVI+LWTANTERY +I+PGVNDT +NLL AIK D  EIAPSTIFA ASILE   YINGSP
Sbjct: 238 KVIVLWTANTERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSP 297

Query: 301 QNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDG 360
           QNTFVPG+IELAE+ DS IAGDDFKSGQTK+KSVLAQFLV+AGI+P SIASYNHLGNNDG
Sbjct: 298 QNTFVPGVIELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDG 357

Query: 361 YNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDE 420
           YNLSS +QF+SKEISK SVVDD++ SNP+LYNDKLGNKIDHCIVIKYM+AVGDSKVAMDE
Sbjct: 358 YNLSSERQFKSKEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDE 417

Query: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480
           YYSELMLGGHNRISIHNVCEDSLLATPLIIDL+VM EFC+RV+Y+ V   DG+   G   
Sbjct: 418 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVG--DGSTEYG--- 472

Query: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538
            FY +LSFLSYWLKAPLT+ GYQ INGLNKQR+ LENF+RLLIGLPA DELRFEERLK
Sbjct: 473 KFYNILSFLSYWLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERLK 530

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/528 (68%), Positives = 420/528 (79%), Gaps = 9/528 (1%)

Query: 10  RVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXX 69
           +V    +   Y+ ++L+TNYTY   +V   SD + +   P+ +NYQFKVDL  P +    
Sbjct: 8   KVKVATENCQYRGSDLITNYTYKNTIVSKCSDGS-YSAQPVVENYQFKVDLKVP-KLGVM 65

Query: 70  XXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKDVY 129
                    ST +A++LANKH + F +  KEG    NYYGS+TQ+STIKLG+D+ G DVY
Sbjct: 66  LVGLGGNNGSTFIASILANKHKIQFNS--KEGTIGANYYGSVTQASTIKLGIDADGNDVY 123

Query: 130 VPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYY 189
           VPFNS++P VNPNDFVV GWDING+ M +AM RA VLE DL+ KL   M+   PL SVYY
Sbjct: 124 VPFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHPLPSVYY 183

Query: 190 PDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTAN 249
           PD+IAANQDERA+NC+N     G V+T  KW+H+  IR DIR FK+ N LDKVI+LWTAN
Sbjct: 184 PDYIAANQDERANNCIN--RVKGTVSTKNKWDHVEKIRKDIRDFKETNGLDKVIVLWTAN 241

Query: 250 TERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLI 309
           TERY +++ GVND  ENLL+AIK+DHTEI+PS IFA ASILE+ PYINGSPQNTFVPG++
Sbjct: 242 TERYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNTFVPGIV 301

Query: 310 ELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQF 369
           ELAEKN S I GDDFKSGQTK+KSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSP+QF
Sbjct: 302 ELAEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPKQF 361

Query: 370 RSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGG 429
           +SKEISK+SVVDDII SN ILYN+KLG KIDHCIVIKYM AV DSKVAMDEYYSELMLGG
Sbjct: 362 KSKEISKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYSELMLGG 421

Query: 430 HNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFL 489
           HNRISIHNVCEDSLLATPLIIDL+VM+EF SRVTY+ ++    A   G +E  Y +LSFL
Sbjct: 422 HNRISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLESDASA---GSYEKLYSILSFL 478

Query: 490 SYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           SYWLKAPLT+ G++ INGLNKQR ALENFLRLLIGLPAIDELRFEERL
Sbjct: 479 SYWLKAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERL 526

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/532 (64%), Positives = 421/532 (79%), Gaps = 11/532 (2%)

Query: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXX 67
           S++ N     +S   NEL++ Y Y  ++V  +    + E+TP +++YQFK++LN P +  
Sbjct: 21  SVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN-PNKVG 79

Query: 68  XXXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127
                      ST +A++LANK+N+ F TR  EG  EPNYYGS+TQSST+KLG+DS+G D
Sbjct: 80  IMLVGLGGNNGSTFLASLLANKNNISFNTR--EGTVEPNYYGSMTQSSTLKLGIDSEGND 137

Query: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187
           V+ PFNS++PMVNPNDFVVSGWDIN   +  AM+RA VLE DL++KL P M+ +KPLKS+
Sbjct: 138 VFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPLKSI 197

Query: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247
           YYPDFIA NQ ERA+NC+N +   G+  T  KW  L  IR DI+ FK  N+L+ +I+LWT
Sbjct: 198 YYPDFIAMNQFERANNCINQN-DDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVLWT 256

Query: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307
           ANTER VEI+PGVNDTM+NL+ +IK++H+EI+PS IFA A+I+E  PYINGSPQNTFVPG
Sbjct: 257 ANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFVPG 316

Query: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367
           LIELAE ND LIAGDDFK+GQTK+KSV+ QFLVDAGI+PVSIASYNHLGNNDG NLSS  
Sbjct: 317 LIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSSHA 376

Query: 368 QFRSKEISKASVVDDIIESNPILYNDK-LGNKIDHCIVIKYMHAVGDSKVAMDEYYSELM 426
           QFRSKEISK+SV+DD I SN IL+N K   +K +HCIVIKYM AVGDSKVAMDEYYS+LM
Sbjct: 377 QFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQLM 436

Query: 427 LGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVL 486
           LGGHNRISIHNVCEDSLLA+P+IIDL+VMTEF SR+TY+ + G+D      +F  FYP+L
Sbjct: 437 LGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKM-GED-----QEFHKFYPIL 490

Query: 487 SFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERLK 538
           SFLSYWLKAPLT+ G++PIN LN+QR ALENFLRLL+GLP  DELRFEERL+
Sbjct: 491 SFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERLR 542

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/538 (64%), Positives = 419/538 (77%), Gaps = 17/538 (3%)

Query: 9   IRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXX 68
           I VNN  DK + + N L + YTY +N+V  N     + V  + K+Y+F VDLN P +   
Sbjct: 10  IIVNN--DKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLP-KLGI 66

Query: 69  XXXXXXXXXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD- 127
                     +T++A+VLANK+N+ F +++ +GL + NYYGS+TQSSTIKLG+D K  D 
Sbjct: 67  MLVGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTNDE 126

Query: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187
           +YVPF  ++P+ NPNDFV++GWDI+     +AM+RA VLE DL+ +L   M+  KPLKS+
Sbjct: 127 IYVPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKSI 186

Query: 188 YYPDFIAANQDERADNCLN--------VDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDL 239
           YYPDFIA NQ+ERA++C N         DP +    T  KW H+  IR+DIR FK++N+L
Sbjct: 187 YYPDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENNL 246

Query: 240 DKVIILWTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGS 299
           DKVI+LWTANTERY  I  GVND  +NLL AIKNDH+E++PSTIFA ASILE  PYINGS
Sbjct: 247 DKVIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYINGS 306

Query: 300 PQNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNND 359
           PQNTFVPG+I+LAE+  S IAGDDFKSGQTKMKSVLAQFLVDAGI+P+SIASYNHLGNND
Sbjct: 307 PQNTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNND 366

Query: 360 GYNLSSPQQFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMD 419
           G+NLSSP QF+SKEISK  V DD+IESN IL+NDK+G  IDHCIVIKY++AVGDSKVAMD
Sbjct: 367 GFNLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAMD 426

Query: 420 EYYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDF 479
           EYYSELMLGGHNRISIHNVCEDSLLATPLIIDL+VMTEFC+RVTY+ +      E   D+
Sbjct: 427 EYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKL-----GEGATDY 481

Query: 480 ENFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           E FYPVL+ LSYWLKAPLT+PG++PINGL KQR ALENFLRLLIGLP +D+LRFEERL
Sbjct: 482 EQFYPVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERL 539

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/462 (71%), Positives = 392/462 (84%), Gaps = 5/462 (1%)

Query: 79  STMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSK-GKDVYVPFNSLVP 137
           +T +A+VLANK+N+ F +++ +GL + NYYGS+TQSSTIKLG++ +  +DVY+PFN ++P
Sbjct: 11  TTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNEDVYIPFNEILP 70

Query: 138 MVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIAANQ 197
            VNPNDFVVSGWDIN +   +AM+RA VLE DL++KL   MKD  PLKS+YYPDFIA NQ
Sbjct: 71  FVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSIYYPDFIAINQ 130

Query: 198 DERADNCLN--VDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERYVE 255
           +ERA+N +N   +  + +  + GKW H+ HIRNDIR FK +N+LDKVI+LWTANTERY  
Sbjct: 131 NERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVLWTANTERYSV 190

Query: 256 ILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAEKN 315
           I  G+NDT +NL+ +IKNDH E++PSTIFA ASILE  PYINGSPQNTFVPG+IELAE+ 
Sbjct: 191 IENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFVPGVIELAERE 250

Query: 316 DSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEIS 375
            S IAGDDFKSGQTKMKSVLAQFLVDAGI+P+SIASYNHLGNNDGYNLSSP QF+SKEIS
Sbjct: 251 HSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSSPMQFKSKEIS 310

Query: 376 KASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRISI 435
           K  V DD+IESN IL+NDK+G  IDHCIVIKYM+AVGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 311 KRGVCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISI 370

Query: 436 HNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWLKA 495
           HNVCEDSLLATPLIIDL+VMTEFC+RVTY+ +DG D    K +FE FYPVL+ LSYWLKA
Sbjct: 371 HNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADA--TKKEFEPFYPVLTLLSYWLKA 428

Query: 496 PLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           PLT+PG++ INGL KQR ALENF+RLLIGLP +DELRFEERL
Sbjct: 429 PLTRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERL 470

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/524 (63%), Positives = 412/524 (78%), Gaps = 5/524 (0%)

Query: 16  DKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXXXXXXXX 75
           DK  Y E+EL+T YTY   +V +N  KT F+V   +++Y+FK DL  P +          
Sbjct: 15  DKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTDLKIP-KVGVMLVGMGG 73

Query: 76  XXXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKG-KDVYVPFNS 134
              +T +A+VLANK  + FRT++ +GL + NYYGS+TQ+ST+KLGVDS+   DVY+PFNS
Sbjct: 74  NNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKLGVDSETLNDVYIPFNS 133

Query: 135 LVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIA 194
           L+PMVNPNDFVVSGWDI       AM  + VLE DL  +L P M   KPLKS+YYPDF+A
Sbjct: 134 LLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEMSQIKPLKSIYYPDFLA 193

Query: 195 ANQDERADNCLNVDPQTGKVT-TTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERY 253
            NQ ERA+NC+N    + +V     K   L+HIRNDI+TFKQ+N LDKVI+LWTA+TERY
Sbjct: 194 MNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQENHLDKVIVLWTASTERY 253

Query: 254 VEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAE 313
            +I+ GVNDT +NLL +IK  H EIAPSTIFA ASILE   YINGSPQNT VPG+++L++
Sbjct: 254 ADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYINGSPQNTLVPGVVDLSK 313

Query: 314 KNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKE 373
           + +++IAGDDFK+GQTK+KSVLAQFL+DAGI+P+S+ASYNHLGNNDGYNLS+P+QFRSKE
Sbjct: 314 RENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGNNDGYNLSAPKQFRSKE 373

Query: 374 ISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRI 433
           ISK+SV+DD+IESN ILYN K G ++DHCIVIKYM AVGD+KVAMDEYYSELMLGGHNRI
Sbjct: 374 ISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVAMDEYYSELMLGGHNRI 433

Query: 434 SIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWL 493
           S+HNVCEDSLLATP++IDL+VM EF SR++Y+ V+ +D  E   ++  F   LSFLSYWL
Sbjct: 434 SVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEEL--EYSTFNSTLSFLSYWL 491

Query: 494 KAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           KAP+ K G+QPINGLNKQR ALENFLRLLIGLP  DELRFEERL
Sbjct: 492 KAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/521 (62%), Positives = 412/521 (79%), Gaps = 13/521 (2%)

Query: 19  SYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXXXXXXXXXXX 78
           S K+N LLT+Y Y T+ V  N      +V+  +++Y+FK+DL  P +             
Sbjct: 73  SAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVP-KVGVMLVGFGGNNG 131

Query: 79  STMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSK-GKDVYVPFNSLVP 137
           ST++A++LANKHN+ F  +D E   +PNY GS+TQS+T+ LG D + G+D + PFN+++P
Sbjct: 132 STLLASILANKHNISFHNKDGE--IKPNYLGSMTQSATVHLGRDEETGRDFFQPFNAVLP 189

Query: 138 MVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIAANQ 197
           MVNPND +V+GWDI+   + ++M+RA VL+ DL+ +L P+MK++ P+KS+YYP+FIAANQ
Sbjct: 190 MVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIYYPEFIAANQ 249

Query: 198 DERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERYVEIL 257
            +RA+NC+N   +  + TT GKW+H+  +R+DI+TFK +N LDKVI+LWTANTE++ +I+
Sbjct: 250 FDRANNCIN--SKGDEFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTANTEKFAQIV 307

Query: 258 PGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAEKNDS 317
           PGVNDT ENLL+AIKNDH EIAPST+FA ASILE  PYINGSPQNTFVPGLI+LAE  + 
Sbjct: 308 PGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGLIKLAEHENV 367

Query: 318 LIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEISKA 377
           LIAGDDFK+GQTK+KSVL QFLVDAGIRPVSIASYNHLGNNDG NLSS  QF+SKEISK+
Sbjct: 368 LIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQFKSKEISKS 427

Query: 378 SVVDDIIESNPILY-NDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRISIH 436
            V++DI+ESN I+Y +D    +IDHCIVIKYM AVGDSKVAMDEYY+ELMLGGHNRIS+H
Sbjct: 428 GVINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELMLGGHNRISLH 487

Query: 437 NVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWLKAP 496
           NVCEDSLLA P+I+DL++M EFCSRVTY+       A   GD++ F+PVL+ LSYWLKAP
Sbjct: 488 NVCEDSLLAAPIILDLVIMCEFCSRVTYKE------ANDNGDYKKFHPVLTLLSYWLKAP 541

Query: 497 LTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           L +  + P+NGL KQR ALENF+RLLIGLPA DELRFEERL
Sbjct: 542 LAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/522 (63%), Positives = 409/522 (78%), Gaps = 6/522 (1%)

Query: 18  VSYKENELLTNYTYHTNVVHTNSDKTQFE-VTPLDKNYQFKVDLNKPERXXXXXXXXXXX 76
           +S + NEL++++ Y   V+ T+        ++P + NY FKVDL+ PE+           
Sbjct: 74  LSRETNELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKVGVLLVGFGGN 133

Query: 77  XXSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKDVYVPFNSLV 136
             ST++A++LAN+  + F   +KEG    N++GS+TQSST+KLGVD KG DV+VPFNS++
Sbjct: 134 NGSTLLASILANRQKMVFN--NKEGPQRANFFGSMTQSSTMKLGVDVKGNDVFVPFNSVL 191

Query: 137 PMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIAAN 196
           PM +P +FVV GWDIN A + +AM+R  VLE DL+ KL   M++  P+KSVYYPDFIA N
Sbjct: 192 PMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVYYPDFIALN 251

Query: 197 QDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERYVEI 256
           Q +RA+NC+N        +T  K + L  IR DIR FK  N LDKVI+LWTANTER V+I
Sbjct: 252 QFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTANTERCVDI 311

Query: 257 LPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAEKND 316
           +P VND+ ++LL+AI+++H EIAPSTIFAAASILE  PYINGSPQNTFVPGLI+LAE++D
Sbjct: 312 IPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLIDLAERHD 371

Query: 317 SLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEISK 376
            LIAGDDFKSGQTK+KSVL QFLVDAGI+PVSIASYNHLGNNDG NLSS +QFRSKEISK
Sbjct: 372 VLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQFRSKEISK 431

Query: 377 ASVVDDIIESNPILYND-KLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRISI 435
           +SV+DD I+SN ILYND K  +K++HCIVIKY+ AVGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 432 SSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELMLGGHNRISI 491

Query: 436 HNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWLKA 495
           HNVCEDSLLA PLIIDL+VMTEF SR+ Y+ +  +DGA     F +FYP+L+FLSYWLKA
Sbjct: 492 HNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKI--EDGAPPSDKFSDFYPILTFLSYWLKA 549

Query: 496 PLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
           PLT+ G+QPIN LN+QR ALENFLRLLIGLP  DELRFEERL
Sbjct: 550 PLTRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERL 591

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/537 (61%), Positives = 410/537 (76%), Gaps = 23/537 (4%)

Query: 17  KVSYKENELLTNYTYHTNVV--HTNSDKTQFEVTPLDKNYQFKVDLNKPERXXXXXXXXX 74
           K S  EN LLTNYTY+  +V    + +     V+ L K+Y FKVDL  P +         
Sbjct: 37  KYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIP-KIGVMLVGMG 95

Query: 75  XXXXSTMMAAVLANKHNVCFRTRD-----KEGLTEPNYYGSLTQSSTIKLGVDSK-GKDV 128
               +T +A++LANK+N+ F  +D     KE      + GS+TQSST+ LG + +  +DV
Sbjct: 96  GNNGTTFLASLLANKNNLTFNNKDGPYNIKE---RGGFLGSMTQSSTLYLGKNQQTNEDV 152

Query: 129 YVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSVY 188
           YVPFNS++PM NPND ++SGWDI+G  M +AM+RA VLE DL+ KL P+M+ + PLKS+Y
Sbjct: 153 YVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKSIY 212

Query: 189 YPDFIAANQDERADNCLNVDPQTGK---VTTTGKWEHLNHIRNDIRTFKQQNDLDKVIIL 245
           YPDFIA NQ +RADNC+N   +       +   KW  L  IR +I+ FK  N LDKVIIL
Sbjct: 213 YPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVIIL 272

Query: 246 WTANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFV 305
           WTA TE++ E++PG+NDT ENLL +IK +H EIAPSTIFA ASILE+CPYINGSPQNTFV
Sbjct: 273 WTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNTFV 332

Query: 306 PGLIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSS 365
           PGLI+LAE+ + LIAGDDFK+GQTK+KSVLAQFL+DAGI+P+SIASYNHLGNNDG NLSS
Sbjct: 333 PGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNLSS 392

Query: 366 PQQFRSKEISKASVVDDIIESNPILY--NDKLGNK---IDHCIVIKYMHAVGDSKVAMDE 420
             QF+SKEI+K++V+DD+I+SN ILY  +DK+  K   +DHCIVIKYM ++GDSKVAMDE
Sbjct: 393 SLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAMDE 452

Query: 421 YYSELMLGGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFE 480
           YY+ELMLGGHNRISIHNVCEDSLLA+P+I+DLI+M EFCSR+TY     Q G    G+++
Sbjct: 453 YYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIESGNQQG---DGNYQ 509

Query: 481 NFYPVLSFLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537
            FYPVLS LSYWLKAPLT+PGY+PINGLNKQR AL+NF+RLLIGLP IDELRFEERL
Sbjct: 510 QFYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERL 566

>TBLA0A03200 Chr1 complement(758622..761837) [3216 bp, 1071 aa] {ON}
           Anc_5.363 YHR077C
          Length = 1071

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 68/165 (41%), Gaps = 38/165 (23%)

Query: 142 NDFVVSGWDINGATMDQAMERASV-----LEVDLRNKLAPMMKDHKPLK----------- 185
           +DF+   +D N   + Q++ RA +       +DL NK   +MKDH+  +           
Sbjct: 223 DDFI---FDSNLKNLLQSLFRAFMDAVFTYTIDLNNKTNKLMKDHQKCQIRTGKERNEYI 279

Query: 186 ---SVYYPDFIA-ANQDERADNCLNVDPQTGKVTTTGKWEHLNH--IRNDIRTFKQQNDL 239
                 YP F    N  +       VDP   + T    +E  N   I N I    Q+   
Sbjct: 280 DEFDELYPIFERFKNASQSLSEFFKVDPPKIEETFIVDYESANKPMITNQILPPDQR--- 336

Query: 240 DKVIILW-TANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTI 283
                +W   +T ++ E+LP + D    +LE++KN+ +   PS I
Sbjct: 337 -----VWENEDTRKFYELLPDLKD----ILESMKNEKSAPDPSQI 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,670,138
Number of extensions: 2711869
Number of successful extensions: 7904
Number of sequences better than 10.0: 29
Number of HSP's gapped: 8041
Number of HSP's successfully gapped: 29
Length of query: 538
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 424
Effective length of database: 40,409,475
Effective search space: 17133617400
Effective search space used: 17133617400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)