Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I03432g7.341ON1491497861e-109
Kpol_530.377.341ON88852132e-22
TDEL0C020607.341ON88901922e-19
TPHA0F029107.341ON108991882e-18
KLTH0H01452g7.341ON86821792e-17
SAKL0F10956g7.341ON86811783e-17
Kwal_YGOB_Anc_7.3417.341ON86821774e-17
ZYRO0F11528g7.341ON1211211788e-17
TBLA0E004707.341ON1161011743e-16
Ecym_45207.341ON91871698e-16
ACL158W7.341ON95821584e-14
KLLA0C16709g7.341ON79751522e-13
NCAS0A140807.341ON78821513e-13
NDAI0A019507.341ON122901482e-12
Suva_4.847.341ON81821443e-12
KNAG0C038107.341ON82821358e-11
Skud_4.957.341ON79811288e-10
YDL160C-A (MHF2)7.341ON80601233e-09
Smik_4.767.341ON80671235e-09
KAFR0B009007.341ON78871165e-08
Skud_4.7325.576ON326946690.91
Ecym_70398.545ON29459671.6
TDEL0B05850na 1ON56673636.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I03432g
         (149 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...   307   e-109
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    87   2e-22
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    79   2e-19
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    77   2e-18
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    74   2e-17
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    73   3e-17
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    73   4e-17
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    73   8e-17
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    72   3e-16
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    70   8e-16
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    65   4e-14
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    63   2e-13
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               63   3e-13
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    62   2e-12
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    60   3e-12
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    57   8e-11
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    54   8e-10
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    52   3e-09
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    52   5e-09
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    49   5e-08
Skud_4.732 Chr4 (1289921..1299730) [9810 bp, 3269 aa] {ON} YDR45...    31   0.91 
Ecym_7039 Chr7 complement(83036..83920) [885 bp, 294 aa] {ON} si...    30   1.6  
TDEL0B05850 Chr2 complement(1038414..1040114) [1701 bp, 566 aa] ...    29   6.3  

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score =  307 bits (786), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MEGDPSESQRWLGSIKLVGCSVCFACWCSLLWIFLAGWKFDHWNCNYWNCDHWKCEIWKC 60
           MEGDPSESQRWLGSIKLVGCSVCFACWCSLLWIFLAGWKFDHWNCNYWNCDHWKCEIWKC
Sbjct: 1   MEGDPSESQRWLGSIKLVGCSVCFACWCSLLWIFLAGWKFDHWNCNYWNCDHWKCEIWKC 60

Query: 61  EIWTIPIMDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDA 120
           EIWTIPIMDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDA
Sbjct: 61  EIWTIPIMDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDA 120

Query: 121 SQEGLEQEQDKEITHTDLENIAGLLLLDM 149
           SQEGLEQEQDKEITHTDLENIAGLLLLDM
Sbjct: 121 SQEGLEQEQDKEITHTDLENIAGLLLLDM 149

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
           complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 86.7 bits (213), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 62/85 (72%), Gaps = 9/85 (10%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129
           +P++TIAR+L+ ++F+   TRI  DVV+ LQ+Y+++F REA++RSIE    ++  LE+E 
Sbjct: 7   IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIE----TKAKLEEEN 62

Query: 130 D-----KEITHTDLENIAGLLLLDM 149
                  E+THTDLE IAGLLLLDM
Sbjct: 63  SFTGVRVELTHTDLEEIAGLLLLDM 87

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 88

 Score = 78.6 bits (192), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 16/90 (17%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRS--------IEHHDAS 121
           +P++TIAR  QV AF+++ T I  + V  +Q+Y++VF REAVLRS        +EH  A 
Sbjct: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGA- 63

Query: 122 QEGLEQEQDKEI--THTDLENIAGLLLLDM 149
                Q    EI  TH DLENI GLLLLDM
Sbjct: 64  -----QRNSNEIVLTHEDLENITGLLLLDM 88

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 77.0 bits (188), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (63%), Gaps = 20/99 (20%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQ---EGLE 126
           +P+DTIAR+LQ+ +F ++ TRI ++ V  LQ+Y+++F REAVLRSIE+ +  Q   E L+
Sbjct: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 127 QEQDK----------------EITHTDLENIAGLLLLDM 149
           +   K                E+TH DLE I+GLLLLDM
Sbjct: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
           weakly similar to uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160c-a
          Length = 86

 Score = 73.6 bits (179), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 2/82 (2%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHD-ASQEGLEQE 128
           +P DTIAR+ Q  +FKD  TRI    +  +  Y++VF REA+LRSIE+ +    E  +Q 
Sbjct: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64

Query: 129 QDKEI-THTDLENIAGLLLLDM 149
            D+ + TH DLE ++GLLLLDM
Sbjct: 65  GDQVVLTHKDLERVSGLLLLDM 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
           similar to uniprot|Q3E829 Saccharomyces cerevisiae
           YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 73.2 bits (178), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 52/81 (64%), Gaps = 1/81 (1%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ-E 128
           +P+DTIAR+ Q  +F    TRI  D V    +YI++F REAVLRS+E+ +  +   E  +
Sbjct: 6   LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 129 QDKEITHTDLENIAGLLLLDM 149
               ++H DLE I+GLLLLDM
Sbjct: 66  NGTVLSHEDLEEISGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 86

 Score = 72.8 bits (177), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 55/82 (67%), Gaps = 2/82 (2%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129
           VP+DTIAR+ Q  +F++  TRI    +  +  Y+++F REA+LRSIE+ D  ++  + + 
Sbjct: 5   VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQL 64

Query: 130 DKEI--THTDLENIAGLLLLDM 149
             ++  TH DLE ++GLLLLDM
Sbjct: 65  GSQVVLTHKDLERVSGLLLLDM 86

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 73.2 bits (178), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 31  LWIFLAGWKFDH-WNCNYWNCDHWKCEIWKCE-IWTIPIMDVPQDTIARVLQVAAFKDKK 88
           +  +   W F +  +  +   D     I K + I  + +  VP++TI R+L++ AF+ + 
Sbjct: 1   MEFYFVQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHES 60

Query: 89  TRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDKEITHTDLENIAGLLLLD 148
           T I  + V  LQ+Y++VF REAV RS+ + D+     + + + ++ H DLE I G+LLLD
Sbjct: 61  TTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQLNHEDLEKITGMLLLD 120

Query: 149 M 149
           M
Sbjct: 121 M 121

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 71.6 bits (174), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 60/101 (59%), Gaps = 21/101 (20%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHD---------- 119
           +P++TIAR+LQ ++F D+ TRI  + V  LQ+Y+++F REA LRS+E+ +          
Sbjct: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75

Query: 120 ASQEGLEQEQ-----------DKEITHTDLENIAGLLLLDM 149
            ++ GLE  +           D E++H  LE I GLLLLDM
Sbjct: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
           Ashbya gossypii ACL158W
          Length = 91

 Score = 69.7 bits (169), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 53/87 (60%), Gaps = 11/87 (12%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129
           VP DTIAR+ Q+ +F    TRI  D +   ++YI +F REAVLRS+E+ D     +++E 
Sbjct: 9   VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDK----VKKED 64

Query: 130 DKE-------ITHTDLENIAGLLLLDM 149
            K        + HTDLE I+G+LLLD 
Sbjct: 65  GKGSLIEGPVLHHTDLEEISGILLLDF 91

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL161CX; YDL161CX was
           overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 65.5 bits (158), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (3%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129
           +P DTIAR+    +F    T+I  D V  ++RY+ +F REAVLRS+E+ +  ++    + 
Sbjct: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72

Query: 130 DKE---ITHTDLENIAGLLLLD 148
             E   + HTDLE I+G+L+LD
Sbjct: 73  FAEGPVLQHTDLEEISGVLILD 94

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conserved
           hypothetical protein
          Length = 79

 Score = 63.2 bits (152), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 6/75 (8%)

Query: 74  TIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDKEI 133
           TIAR+LQ   F+D  TRI  + +  L+ YI++F RE VLRS+E+        +   DK +
Sbjct: 9   TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENK------ADMLADKTV 62

Query: 134 THTDLENIAGLLLLD 148
              DLE +AGLLL+D
Sbjct: 63  DFVDLEAVAGLLLMD 77

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 62.8 bits (151), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 55/82 (67%), Gaps = 4/82 (4%)

Query: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127
           M +P++TIA++LQ+ AF++  T++  + +  +QRY+++F REA+ RS+   D  ++ L Q
Sbjct: 1   MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSL---DNKEKELGQ 57

Query: 128 EQDKEITHTDLENIAGLLLLDM 149
             D  I   DLE + GLLLLDM
Sbjct: 58  -TDIVIDEKDLERVVGLLLLDM 78

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 61.6 bits (148), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 58/90 (64%), Gaps = 8/90 (8%)

Query: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQ----- 122
           M +  +TI ++L+  +F++K T I  + +  +QRY+D+F +EAV+RS E+  A+Q     
Sbjct: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFD 92

Query: 123 ---EGLEQEQDKEITHTDLENIAGLLLLDM 149
              +  E+++  E+TH DLE I GLLL+++
Sbjct: 93  DEEDADEEDKTIELTHLDLERIVGLLLMEL 122

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
           YDL160C-A (REAL)
          Length = 81

 Score = 60.1 bits (144), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127
           M +P++ I ++L      DK  +I+  V+  +Q+Y+++F  EA LRS++ H  S    + 
Sbjct: 1   MILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDG 59

Query: 128 EQDKEITHTDLENIAGLLLLDM 149
           +   E++H DLE I GLLL+DM
Sbjct: 60  DGPLELSHLDLERIVGLLLMDM 81

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 82

 Score = 56.6 bits (135), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 53/82 (64%), Gaps = 7/82 (8%)

Query: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127
           + + ++T++R+L   +FK+K T I+   + ++Q+Y++ + +E +LRS+E+ D    G+  
Sbjct: 7   IQISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDL---GV-- 60

Query: 128 EQDKEITHTDLENIAGLLLLDM 149
               E+T  D+E I GLLLLDM
Sbjct: 61  -NPAELTERDIERILGLLLLDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
           YDL160C-A (REAL)
          Length = 79

 Score = 53.9 bits (128), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIE-HHDASQEGLEQE 128
           + +D + ++L    F+ K  +I+  V+  +Q Y+D+F  EA LRS++   DAS  G  ++
Sbjct: 2   LSKDALIKILSQNNFR-KDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDAS--GGHRD 58

Query: 129 QDKEITHTDLENIAGLLLLDM 149
              E++H DLE I GLLL+DM
Sbjct: 59  GPLELSHLDLERIVGLLLMDM 79

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
           MHF2Protein of unknown function; ortholog of human MHF2,
           and component of the heterotetrameric MHF histone-fold
           complex that in humans interacts with both DNA and Mph1p
           ortholog FANCM to stabilize and remodel blocked
           replication forks and repair damaged DNA; mhf2 srs2
           double mutants are MMS hypersensitive
          Length = 80

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 90  RIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDKEITHTDLENIAGLLLLDM 149
           +I  +VV  +Q+Y+D+F  EAVLRS++ H         +   E++H DLE I GLLL+DM
Sbjct: 21  KIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM 80

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
           YDL160C-A (REAL)
          Length = 80

 Score = 52.0 bits (123), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 8/67 (11%)

Query: 87  KKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDK----EITHTDLENIA 142
           K   I  +V+  +Q+Y+D+F  EA LRS++ H    + + +E DK    E++H DLE + 
Sbjct: 18  KDIEISDEVIPMIQKYLDIFIEEAALRSLQSH----KDINKEHDKKDPLELSHQDLERVV 73

Query: 143 GLLLLDM 149
           G+LL+DM
Sbjct: 74  GVLLMDM 80

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 78

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 14/87 (16%)

Query: 68  MDVPQDTIARVLQVAAFKDKKT-RIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLE 126
           M +P++TI+R+L     ++ +   I ++ V+++ +Y DV   E VLRS+E+         
Sbjct: 1   MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLEN--------- 51

Query: 127 QEQDKEITHT----DLENIAGLLLLDM 149
           +E   E T T    DLE I GLLLLDM
Sbjct: 52  KENIAEATPTLDVDDLEKIIGLLLLDM 78

>Skud_4.732 Chr4 (1289921..1299730) [9810 bp, 3269 aa] {ON} YDR457W
            (REAL)
          Length = 3269

 Score = 31.2 bits (69), Expect = 0.91,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 86   DKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDK 131
            DK T+ E  ++D    +I  FA EA++++I +  +S + LE    K
Sbjct: 1742 DKTTKSEVKIIDPHMNFIRKFAVEAIMKAIRNATSSSKLLESNHLK 1787

>Ecym_7039 Chr7 complement(83036..83920) [885 bp, 294 aa] {ON}
           similar to Ashbya gossypii AEL247W
          Length = 294

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 12/59 (20%)

Query: 11  WLGSIKLVGCSVCFACWCSLLWIFLAGWKFDHWNCNYWNCDHWKCEIWKCEIWTIPIMD 69
           W  S+ +V  S+ F        IF+  W F HW  NY+   H     W  +   IPI+D
Sbjct: 248 WSYSLPMVTLSIAF--------IFILPWYFIHWQRNYYR-GHQLLSTWDAK---IPILD 294

>TDEL0B05850 Chr2 complement(1038414..1040114) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAR-----EAVLRSIEHHDASQEG 124
           VP+  + +VL     KDK T+I    +  L R +D F R     EA   ++ H  + +E 
Sbjct: 423 VPEPLLVKVLSF--LKDKPTQISGFHLKDLGRSVDAFLRNLQTEEASSDTVNHISSLKEF 480

Query: 125 LEQEQDKEITHTD 137
           ++  ++ E  + D
Sbjct: 481 VQASKEHEFDNED 493

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.477 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,837,989
Number of extensions: 603338
Number of successful extensions: 2368
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2343
Number of HSP's successfully gapped: 28
Length of query: 149
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 50
Effective length of database: 42,129,465
Effective search space: 2106473250
Effective search space used: 2106473250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)