Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I03388g7.347ON19119110221e-143
TDEL0C020107.347ON1911918691e-120
NDAI0A019207.347ON1931938641e-119
Smik_4.737.347ON1911918591e-118
Suva_4.817.347ON1911918591e-118
ZYRO0F11638g7.347ON1911918551e-118
Skud_4.927.347ON1911918541e-118
YDL165W (CDC36)7.347ON1911918531e-117
Kpol_530.347.347ON1911918501e-117
KAFR0B008507.347ON1921938451e-116
KNAG0C037607.347ON1911918191e-112
NCAS0A141307.347ON1911918171e-112
TPHA0F029407.347ON1911918031e-110
TBLA0E005107.347ON2871677921e-107
KLTH0H01320g7.347ON1901927561e-103
Kwal_56.246347.347ON1901927511e-102
SAKL0F11308g7.347ON1911927381e-100
KLLA0D12408g7.347ON1841916802e-91
Ecym_47267.347ON1911986631e-88
ACL151C7.347ON2081986441e-85
SAKL0B08052g3.370ON576831054e-05
ZYRO0C16588g3.370ON608811029e-05
KAFR0H008603.370ON578811011e-04
CAGL0D01342g3.370ON548821002e-04
YPR072W (NOT5)3.370ON56081993e-04
Smik_16.3163.370ON56081983e-04
Kwal_23.39623.370ON55383983e-04
Kpol_1006.73.370ON540118966e-04
NDAI0A050803.370ON57581966e-04
KLTH0F11880g3.370ON56383966e-04
Skud_16.3613.370ON56081966e-04
Suva_16.4013.370ON56581967e-04
TPHA0A035003.370ON54882967e-04
KNAG0A072903.370ON50781930.002
TBLA0H014903.370ON55281910.002
Ecym_34563.370ON50885870.007
ADL364C3.370ON50485870.009
TDEL0C051203.370ON56280820.034
KLLA0B09196g3.370ON59072800.066
ZYRO0D16302g7.214ON82981790.10
KLTH0A03652g7.214ON77280790.11
Kpol_1070.257.214ON686103740.38
SAKL0F07964g7.214ON82981740.39
TDEL0H023307.214ON81281730.55
NDAI0A026907.214ON84681720.63
Kwal_47.181147.214ON76380682.1
TBLA0D042707.214ON84766682.6
NDAI0K011508.716ON716147682.6
NCAS0A133507.214ON80081672.9
CAGL0K00363g1.527ON1227154672.9
NCAS0A112103.370ON58241673.0
KLLA0E04335g7.214ON758109673.5
Kpol_1045.78.777ON136669647.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I03388g
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   398   e-143
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   339   e-120
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   337   e-119
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   335   e-118
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   335   e-118
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   333   e-118
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   333   e-118
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   333   e-117
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   332   e-117
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   330   e-116
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   320   e-112
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   319   e-112
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   313   e-110
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   309   e-107
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   295   e-103
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   293   e-102
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   288   e-100
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   266   2e-91
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   259   1e-88
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   252   1e-85
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    45   4e-05
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    44   9e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    44   1e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    43   2e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    43   3e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   3e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    42   3e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    42   6e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    42   6e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    42   6e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    42   6e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    42   7e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    42   7e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    40   0.002
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    40   0.002
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    38   0.007
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    38   0.009
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    36   0.034
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    35   0.066
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    35   0.10 
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.11 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    33   0.38 
SAKL0F07964g Chr6 (608052..610541) [2490 bp, 829 aa] {ON} some s...    33   0.39 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    33   0.55 
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    32   0.63 
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    31   2.1  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    31   2.6  
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    31   2.6  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    30   2.9  
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...    30   2.9  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    30   3.0  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    30   3.5  
Kpol_1045.7 s1045 complement(10278..14378) [4101 bp, 1366 aa] {O...    29   7.7  

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  398 bits (1022), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDFPLFYSAIM
Sbjct: 181 RDFPLFYSAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  339 bits (869), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 158/191 (82%), Positives = 174/191 (91%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPLI+ +E +   +YDHS+T+G DLSSMLHSLGIPRDSK HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEPK++IP+SF NIP VLQS+TTPP F+ VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV++DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           R+F LFY+AIM
Sbjct: 181 REFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  337 bits (864), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/193 (82%), Positives = 176/193 (91%), Gaps = 2/193 (1%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPLI+ D+++  K+YDHSMT+G DL+SMLHSLGIPRDSK HRVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKT--TPPTFDDVQTDQQRVALFQDETLFYLFYK 118
           AETSRSEVEP ++IP+SF +IPDVLQS T  TPP+FD VQ DQQRVALFQDETLFYLFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEPVV+ DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQRDFPLFYSAIM 191
           CQR+F LFY+AIM
Sbjct: 181 CQREFLLFYNAIM 193

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/191 (80%), Positives = 172/191 (90%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGLQ LVPL++ ++++    YDHSMT+G DLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESF NIP VLQS  TPP F+ +Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/191 (80%), Positives = 172/191 (90%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGLQ LVPL++ ++++    YDHSMT+G DLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESF NIP VLQS  TPP F+ +Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  333 bits (855), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (90%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPL++ ++ +    YDHSMT+G DLSSMLHSLGIPRDSK H+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++IPESF NIP+VL S++TPP F+ VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV++DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  333 bits (854), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPL++ ++++    YDHSMT+G DLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESF NIP VLQS  TPP F+ +Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  333 bits (853), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPL++ ++++    YDHSMT+G DLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESF NIP VLQS  TPP F+ +Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  332 bits (850), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 150/191 (78%), Positives = 174/191 (91%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ L+PLI+ D+ +  K Y+H+MTIGTDLSSMLHSLGIPRD++ +R+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+++ PESFKNIP+VLQSK TPP F+ ++ DQQRV LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPM+EP+V+ DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           R+F LFY+AIM
Sbjct: 181 REFVLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  330 bits (845), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 156/193 (80%), Positives = 172/193 (89%), Gaps = 3/193 (1%)

Query: 1   MSKFGLQKLVPLIRAD--EEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQS 58
           M KFGL+ L+PLI+ D   EK+G+ YDHSMT+G DLSSML+SLGIPRD +HHRVLDTFQS
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQ-YDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQS 59

Query: 59  PWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYK 118
           PWAETSRSEVEPK+ IP+SF NI +VLQS  TPP FD +Q DQQRVALFQDETLFYLFYK
Sbjct: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119

Query: 119 HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK 178
           HP TVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ DGLSE+GSYVFFDPQRWEK
Sbjct: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179

Query: 179 CQRDFPLFYSAIM 191
           CQRDF LFY+AIM
Sbjct: 180 CQRDFLLFYNAIM 192

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  320 bits (819), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 164/191 (85%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPL+R  + +    YDHSM +G DLSSMLHSLGIPRDSK   VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP +YIP SF  I +VLQS++TPP FD VQ DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP MEPVV+ DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFLLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  319 bits (817), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 166/191 (86%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ LVPL+R D+++  K YDHSMT+G DLSSM+HSLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP ++IP+SF  I  VLQS  TPP FD  Q DQQRVALFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH  L+AWLTKDP+MEP V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           +DF LFY+AIM
Sbjct: 181 KDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  313 bits (803), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (87%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M KFGL+ L+PLI+ D+ +  K Y+H+MTIG DL+S+ HSLGIP ++K +RVLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
           AETSRSEVEP+Y+ P+SF NIP VLQS  TP  F+ V+TDQQR++LFQDETLFYLFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP++EP+V ADG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFPLFYSAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  309 bits (792), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 138/167 (82%), Positives = 155/167 (92%)

Query: 25  DHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPWAETSRSEVEPKYYIPESFKNIPDV 84
           DHS+TIG DLSSMLHSLG+PRD+K HR+LDTFQSPWAETSRSEV+P+++IP SF NI +V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLK 144
           LQ  TTPPTF++++ DQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQRDFPLFYSAIM 191
            WLTKDPMMEP+VAADG SERGSYVFFDPQRWEKCQR+F LFY+AIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  295 bits (756), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/192 (72%), Positives = 160/192 (83%), Gaps = 3/192 (1%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDS-KHHRVLDTFQSP 59
           M K+GL  L+PLIR +++     YD SMT+G DLS +LHSLGIP +    +RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQSPD--YDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPK+++PESFKNIP+VLQS   PP F+ VQ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHK LK WLTKDPMMEPVVA  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFPLFYSAIM 191
           QRDF LFY+AIM
Sbjct: 179 QRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  293 bits (751), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/192 (72%), Positives = 158/192 (82%), Gaps = 3/192 (1%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRD-SKHHRVLDTFQSP 59
           M K+GL  L+PLIR   E     YD SMT+G DLS +LHSLGI  + S  +RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIR--REDQSPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPK+++PESFKNIP+VLQ+   PP F+ VQ D  +++LFQDETLFYLFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHK LK WLTKDPMMEPVVA  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFPLFYSAIM 191
           QRDF LFY+AIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  288 bits (738), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 4/192 (2%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHH-RVLDTFQSP 59
           + K+GL+ L+PLI+  +E     YD +MT+G DLSSMLHSLGI  + ++  RVLDTF SP
Sbjct: 3   VEKYGLKALLPLIK--QETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKH 119
           W ETSRSEVEPK++ PESF NIP+VLQS + PP+F+ VQ D  ++ALFQDETLFYLFYKH
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKH 119

Query: 120 PGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHK LK WLTKDPMMEPVV+ DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFPLFYSAIM 191
           QRDF LFY+AIM
Sbjct: 180 QRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  266 bits (680), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 150/191 (78%), Gaps = 7/191 (3%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60
           M K+GL+ LVP++R D       YD +MT+G DL+S+L+SL I +D+K H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120
            ETSRSEV+P ++IPESFKNI  +L   T    F  V  DQ R++L QDETLFYLFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGML--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHK LK WLTKDPMMEPVVA D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 RDFPLFYSAIM 191
           RDF L Y+AIM
Sbjct: 174 RDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  259 bits (663), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 132/198 (66%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIP-RDSKH------HRVL 53
           MSK+GL+ L+P+I+ D++     YD SMT+GTDL S+LHSL +  RDS +      H  L
Sbjct: 1   MSKYGLKSLLPVIKHDKQ-----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEPK++IPESFKNI  VL   +T   F  V  D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP+MEP+V+ D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQRDFPLFYSAIM 191
           QRWEKCQRDF L Y+AIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  252 bits (644), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 147/198 (74%), Gaps = 14/198 (7%)

Query: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRD-------SKHHRVL 53
           M K+GL+ L+P+I+ +++     YD  MT+G D+SS+LHSL +          S  H  L
Sbjct: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEPK++IPESF NI  VL   +T   F  V  D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST--DFTSVARDHPRISLLQDETLF 130

Query: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDP 173
           YLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP+MEP+V+ D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQRDFPLFYSAIM 191
           QRWEKCQRDF L YSAIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAWLTKDPMMEP--VVAADGLS 163
           F  +TLF++FY + GT  Q L   EL + RNW+++K    W  K+    P  VV+++   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  S+ +FD Q+ W   +C  DF
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDF 566

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD QR W   +C  DF
Sbjct: 577 ESWRYFDYQRSWLARRCNSDF 597

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 548 ESWRYFDYKKSWLARRCSPDF 568

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 106 LFQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSE 164
           +F  +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E +      SE
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSE 516

Query: 165 RGSYVFFD-PQRW--EKCQRDF 183
             S+ +FD  + W   +C  DF
Sbjct: 517 EESWRYFDFKKSWLSRRCGSDF 538

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 530 ESWRYFDYKKSWLARRCGNDF 550

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 530 ESWRYFDYKKSWLARRCGNDF 550

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 5/83 (6%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLS 163
           ++ F  +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  +E +      S
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQS 520

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  S+ +FD Q+ W   +C  DF
Sbjct: 521 EEISWRYFDYQKSWLARRCGTDF 543

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 57/118 (48%), Gaps = 17/118 (14%)

Query: 76  ESFKNIPDVLQSKTTPPTFDDVQTDQQRVAL------FQDETLFYLFYKHPGTVIQELTY 129
           ES K+  D  +SK  P T  D+ +   R +L      F  +TLF++FY + GT  Q L  
Sbjct: 420 ESIKSEDDKKESK--PSTTHDIYS---RTSLAKTFSKFDLDTLFFIFYHYQGTYEQFLVA 474

Query: 130 LELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQR-W--EKCQRDF 183
            EL K RNW+++K  + W  K+    P        E  ++ +FD Q  W   +C  DF
Sbjct: 475 RELAKHRNWKFNKINRNWYYKEVTKSPPGMQQA--EEETWRYFDYQNSWLARRCNSDF 530

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+    P  A     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDF 565

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLS 163
           ++ F  +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  +E +      S
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQS 530

Query: 164 ERGSYVFFDPQR-W--EKCQRDF 183
           E  S+ +FD Q+ W   +C  +F
Sbjct: 531 EEISWRYFDYQKSWLARRCGAEF 553

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 530 ESWRYFDYKKSWLARRCGNDF 550

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 535 ESWRYFDYKKSWLARRCGNDF 555

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMME-PVVAADGLSE 164
           F  +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+     P +A    +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 165 RGSYVFFDPQR-W--EKCQRDF 183
             ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELR-KRNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD ++ W   +C  DF
Sbjct: 477 ESWRYFDYKKSWLARRCNSDF 497

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++  +E +      SE 
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--VEKLPPGLPQSEE 520

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD Q+ W   +C  +F
Sbjct: 521 ISWRYFDYQKSWLSRRCNSNF 541

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  ++  +E +     
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGME 473

Query: 162 LSERGSYVFFDPQR-W--EKCQRDF 183
             E  S+ +FD Q+ W   +C  DF
Sbjct: 474 QKEEVSWRYFDYQKSWLARRCGPDF 498

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 102 QRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADG 161
           Q +  F  +TLF++FY + GT  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 162 LSERGSYVFFDPQR-W--EKCQRDF 183
             E  S+ +FD Q+ W   +C  DF
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDF 494

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLELRK-RNWRYHKGLKAWLTKDPMMEPVVAADGLSER 165
           F  +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +E +      +E 
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEE 530

Query: 166 GSYVFFDPQ-RW--EKCQRD 182
            S+ +FD Q  W   +C  D
Sbjct: 531 ESWRYFDYQGSWLARRCNND 550

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 104 VALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLS 163
           ++ F  +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  +E +       
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGK 556

Query: 164 ERGSYVFFDPQR 175
           E  ++ +FD Q+
Sbjct: 557 EEVTWRYFDYQK 568

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + QE+  + L +R+W+  K    W  +         A+ L E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLR---QSETKFANELCEVADYKI 768

Query: 171 FDPQRWEKCQR-DFPLFYSAI 190
           F    W    R +F L Y+A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFF 171
           LFY FY     + QE+ Y  L +RNW+  K  + W ++  + +    ++ L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSLPK---FSNELCEVADFKIF 723

Query: 172 DPQRWEKCQR-DFPLFYSAI 190
           +   W    + +F L YS +
Sbjct: 724 NLDDWTVTDKLNFKLDYSIL 743

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 95  DDVQTDQQRVAL--FQDETLFYLFYKH--PGTVIQ-ELTYLELRKRNWRYHKGLKAWLTK 149
           D+   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 150 DPMMEPVVAADGLSERGSYVFFDPQRWEKCQR-DFPLFYSAIM 191
               EP  + +   E G+Y  F    W   ++ +F L ++++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>SAKL0F07964g Chr6 (608052..610541) [2490 bp, 829 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 829

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + +++    L++RNW+  KG   W  +    +    ++ L E   Y  
Sbjct: 707 TLFYSYYYSITPLERKIAMALLKERNWKISKGGNTWFLRQSATK---FSNELCEVADYKI 763

Query: 171 FDPQRWEKCQR-DFPLFYSAI 190
           F    W    + +F L YS +
Sbjct: 764 FKLDDWTVVDKLNFKLDYSVL 784

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + Q +  L L +RNW+  K    W  +    EP  A + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFPLFYSAI 190
           F    W    + +F L Y+A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + +E+  + L +RNW+       W  +     P+   + L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 171 FDPQRWEKCQR-DFPLFYSAI 190
           F    W    + +F L YS++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFF 171
           LFY FY     + +E+ Y  L +R+W+  K   +W ++  + +    ++ L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGVPK---FSNELCEVADFKIF 730

Query: 172 DPQRWEKCQR-DFPLFYSAI 190
           +   W   ++ +F L YS +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR       W ++    +    +D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSRQGEAK---LSDELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {ON}
           Anc_8.716
          Length = 716

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 60/147 (40%), Gaps = 14/147 (9%)

Query: 7   QKLVPLIRADEEKDGKVYDHSMTIGTDLSSM-LHSLGIPRDSKHHRVLDTFQSPWAETSR 65
           Q  VP I +DEE+D    D S  + +  S + L     P   K  +    ++     ++ 
Sbjct: 195 QSTVPSISSDEEEDANETDSSTKLNSSGSLLDLKRFFNPAIPKTRKKSHKYKQEQQHSAS 254

Query: 66  SEVEPKYYIPESFKNI--PDVLQSKTTPPTFDDVQTDQQRVALFQD----ETLFYLFYKH 119
            +  P Y + E  KN+  P    +K  P      +  + R+ ++ D    E  +  F KH
Sbjct: 255 FKESPLYELNEHLKNLLQPTSTTTKQFP------RFTKNRIVIYHDLKYLEEKYGTFTKH 308

Query: 120 PGTVIQELTYLELRKRNWRYHKGLKAW 146
            GT     T ++L  R+   H  LK +
Sbjct: 309 LGTGANG-TVIQLTNRSTLQHYALKTF 334

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR  K    W  +      V   +   E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 171 FDPQRWEKCQR-DFPLFYSAI 190
           F    W    + +F L YS +
Sbjct: 728 FKLDDWTVIDKINFKLDYSNL 748

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score = 30.4 bits (67), Expect = 2.9,   Method: Composition-based stats.
 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 26/154 (16%)

Query: 11   PLIRADEEKDGKVYDHSMTIGTD----------LSSMLHSLGIPRDSK-HHRVLDTFQSP 59
            P+++ D  ++  +Y  + T+G +          L S + SL    DSK    +L   QS 
Sbjct: 1077 PVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKLDDSLLSGGQSQ 1136

Query: 60   WAETSRSEVE-PKYYIPE---------SFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQD 109
                +R  +  PK  I +         S K I D++ S++  P    V   ++ + L   
Sbjct: 1137 RLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRSLAPVTIIVSHQKETIKLC-- 1194

Query: 110  ETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGL 143
            + +F+L     GTV    TY EL + NW + K L
Sbjct: 1195 DKIFFLV---DGTVAMMGTYEELMENNWEFRKLL 1225

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 107 FQDETLFYLFYKHPGTVIQELTYLEL-RKRNWRYHKGLKAW 146
           F  +TLF++FY + GT  Q L   EL + R+W ++K    W
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 14/109 (12%)

Query: 83  DVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKG 142
           D L  +T P  F++++T       F   TLFY +Y     + Q +  L L++R WR  K 
Sbjct: 623 DGLTVETVPKEFENLET-------F---TLFYHYYFSVTPLEQRICALLLKQREWRVLKT 672

Query: 143 LKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQR-DFPLFYSAI 190
              W  +      V  ++   E   Y  F    W    + +F L YS +
Sbjct: 673 GDCWFLRQGA---VKFSNDQCEVADYKIFKMDIWTVVDKLNFKLDYSLL 718

>Kpol_1045.7 s1045 complement(10278..14378) [4101 bp, 1366 aa] {ON}
           complement(10278..14378) [4101 nt, 1367 aa]
          Length = 1366

 Score = 29.3 bits (64), Expect = 7.7,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%)

Query: 20  DGKVYDHSMTIGTDLS---SMLHSLGIPRDSKHHRVLDTFQSPWAETSRSEVEPKYYIPE 76
           DG +  HSM + T  S   S+  +  IPRD +++RV+D         S  E   KY    
Sbjct: 801 DGIISAHSMILATRSSYFDSLFAANWIPRDHENNRVVDFSHFNHISKSHFECILKYLYGY 860

Query: 77  SFKNIPDVL 85
           S+ +I D L
Sbjct: 861 SYDSIFDDL 869

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,528,593
Number of extensions: 982709
Number of successful extensions: 2411
Number of sequences better than 10.0: 60
Number of HSP's gapped: 2437
Number of HSP's successfully gapped: 60
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)