Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I03366g7.348ON2121899121e-126
TPHA0F029507.348ON2161816992e-93
Kpol_530.337.348ON1951866937e-93
NCAS0A141407.348ON2241866897e-92
KAFR0B008607.348ON2281806742e-89
TDEL0C020007.348ON2131886722e-89
Kwal_56.246357.348ON2261836681e-88
SAKL0F11330g7.348ON2081846652e-88
Smik_4.727.348ON1971876591e-87
KLLA0D12386g7.348ON2111866592e-87
Ecym_47257.348ON2341846594e-87
KLTH0H01298g7.348ON2141836565e-87
NDAI0A019107.348ON2141876557e-87
Suva_4.807.348ON2061876547e-87
ZYRO0F11660g7.348ON1981836503e-86
YDL166C (FAP7)7.348ON1971846484e-86
ACL150W7.348ON2191846462e-85
Skud_4.917.348ON1941846391e-84
TBLA0E005207.348ON2091886365e-84
KNAG0C037707.348ON2231846123e-80
Smik_15.623.103ON32329740.37
YOL094C (RFC4)3.103ON32329711.0
Suva_15.713.103ON32329711.1
Skud_15.593.103ON32329701.3
TDEL0D052103.103ON32229701.4
KLTH0C09900g3.103ON32229691.7
KAFR0C013803.103ON32129691.9
KNAG0F009302.26ON58938692.0
Kwal_56.226333.103ON32229692.0
Kpol_1053.343.103ON32129682.3
Kwal_56.236388.295ON492220692.5
Skud_2.2453.378ON8645642.6
Skud_16.3683.378ON8645642.6
TBLA0C004808.101ON36024672.8
TBLA0E035203.103ON32429672.8
TPHA0A007103.103ON32529673.0
SAKL0C09812g3.103ON31929673.1
TBLA0B084503.69ON33341673.2
NDAI0A060603.69ON33832673.3
ZYRO0B06248g3.103ON32129673.4
TDEL0E007803.69ON33641673.5
YNL290W (RFC3)3.69ON34032663.8
Skud_14.473.69ON34032664.1
NCAS0A098903.69ON33632664.2
AFR169W8.155ON267139674.3
Smik_14.413.69ON34032664.3
Suva_14.493.69ON34032664.4
KLLA0E13201g3.69ON32932664.5
SAKL0C12144g3.69ON32932655.1
AGR074C8.295ON489923665.6
Kpol_1066.383.69ON33632647.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I03366g
         (212 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   355   e-126
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   273   2e-93
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   271   7e-93
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   270   7e-92
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   264   2e-89
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   263   2e-89
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   261   1e-88
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   260   2e-88
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   258   1e-87
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   258   2e-87
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   258   4e-87
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   257   5e-87
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   256   7e-87
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   256   7e-87
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   254   3e-86
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   254   4e-86
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   253   2e-85
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   250   1e-84
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   249   5e-84
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   240   3e-80
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    33   0.37 
YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}  ...    32   1.0  
Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON...    32   1.1  
Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON...    32   1.3  
TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.10...    32   1.4  
KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa] {O...    31   1.7  
KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.10...    31   1.9  
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    31   2.0  
Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C...    31   2.0  
Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp...    31   2.3  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    31   2.5  
Skud_2.245 Chr2 (446256..446432,446536..446619) [261 bp, 86 aa] ...    29   2.6  
Skud_16.368 Chr16 (665741..665917,666021..666104) [261 bp, 86 aa...    29   2.6  
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    30   2.8  
TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.10...    30   2.8  
TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON...    30   3.0  
SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa] {O...    30   3.1  
TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa] ...    30   3.2  
NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa] ...    30   3.3  
ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly ...    30   3.4  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    30   3.5  
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    30   3.8  
Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W (...    30   4.1  
NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa] ...    30   4.2  
AFR169W Chr6 (744136..752151) [8016 bp, 2671 aa] {ON} Syntenic h...    30   4.3  
Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W (...    30   4.3  
Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W (...    30   4.4  
KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highl...    30   4.5  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    30   5.1  
AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}...    30   5.6  
Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa] {O...    29   7.7  

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  355 bits (912), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 174/189 (92%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               GKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 SELKDGKKY 189
           SELKDGKKY
Sbjct: 181 SELKDGKKY 189

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  273 bits (699), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/181 (70%), Positives = 150/181 (82%)

Query: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVX 62
           SRR+ PN+++TGTPGCGKSTTCELLQRRL  Y YYNIS+FA+EH CYDG+DEGRKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  XXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122
                         GK I+DWHVNDVFPERLIDLVVVLR +N  LYDRLK+RGYHDSKI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182
           EN+DAEIMGVVLQDAQESY  EIVVELQS+TTE M+ NVD+I  WV+ W+++HK+GV++E
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 183 L 183
           L
Sbjct: 182 L 182

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  271 bits (693), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 150/186 (80%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M SRR  PN+++TGTPGCGKST+CELLQRRL  YKYYNIS+FA+EH CY+GYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G SI+DWHVNDVFPERLIDLVVVLR +N  LYDRL AR YHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           I+ENLDAEIMGVVLQDAQESY  EIVVELQS+TTE ME NVDRI  WV+ W+++HK GV+
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 SELKDG 186
           +EL++G
Sbjct: 181 NELEEG 186

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  270 bits (689), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%)

Query: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVX 62
           SRR+ PN+++TGTPGCGKSTTCELLQRRL  YKYYNIS+FA+EH CYDGYD+GRKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 63  XXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122
                         GKSIIDWHVNDVFPERLIDLV VLR +N  LYDRL  R YHD+KIE
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182
           EN+DAEIMGVVLQDA ESY  EIVVELQS+TTE M+ NVDRI  W   W+E+H+DGV++E
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183

Query: 183 LKDGKK 188
           L+D ++
Sbjct: 184 LEDKQR 189

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  264 bits (674), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 146/180 (81%)

Query: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVX 62
           SRR+ PN++VTGTPGCGKSTTCELL RRL  Y Y+NISEFAE+HKCYDGYDE RKSHIV 
Sbjct: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVD 67

Query: 63  XXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122
                         GKSIIDWHVNDVFPERLIDLVVVLR +N  L+DRL  RGYH+SKI+
Sbjct: 68  DDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127

Query: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182
           ENLDAEIMGVVLQDA +SYE EIVVELQSN+TE+M+ NV+RI  W + W+ +HK+GV++E
Sbjct: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  263 bits (672), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 149/188 (79%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M  RRF PN+++TGTPGCGKSTTCELLQRRL  YKYYNIS+FA+EH C+DGYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +I+DWHVNDVFPERLIDLVVVLR +N  LYDRLK+R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           I+ENLDAEIMGVVLQDA +SYE EIVVELQS++TE ME NVDRI +W   W+++HKDG +
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 SELKDGKK 188
           +EL +  K
Sbjct: 181 NELLERTK 188

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  261 bits (668), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 122/183 (66%), Positives = 147/183 (80%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M S R  PNI+VTGTPGCGK++TCELLQRRL+G KYYNIS+FA+E+KCYDGYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +I+DWHVNDVFPERLIDLVVVLR++N  L+DRL  RGYH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           I+EN+DAEIMGVV+ DA++SY  EIVVELQS+TTE M+ NVDRI TW D W E+H +GV+
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 SEL 183
           +EL
Sbjct: 181 NEL 183

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  260 bits (665), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 143/184 (77%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M ++R  PNI+VTGTPGCGKSTTCELL RRL  Y YYNIS+FA EHKCYDGYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               GKSI+DWHVNDVFPERLIDLVVVLR +N  LYDRL  RGYHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVV+QDA ESY  EIVVELQS+T E M+ NVDRI  W + W+ +H +GV+
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 SELK 184
           +EL+
Sbjct: 181 NELE 184

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  258 bits (659), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 125/187 (66%), Positives = 146/187 (78%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M SRR+ PNIIVTGTPGCGKS+ CELL+ +L  YKYYNIS+FA++H C++GYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G SI+DWHVND+FPERLIDLVVVLR +N  LY RL ARGYHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVV QDA ESYEP IVVELQS+T EDME+NV RI TW   W+E+H +GV+
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 SELKDGK 187
           +E +  +
Sbjct: 181 NEYQGSR 187

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  258 bits (659), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 145/186 (77%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M   RF PNIIV+GTPGCGKSTTCELL RRL  Y YYNIS+FA+EH CYDGYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G  IIDWHVNDVFPERL+DLVVVLR +NG LYDRL  RGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEEN+DAEIMGVVLQDA +SY  EIVVELQS+TTE+M+ NVDRI  W + W+++HK GV+
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 SELKDG 186
           +EL DG
Sbjct: 181 NELDDG 186

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  258 bits (659), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 125/184 (67%), Positives = 141/184 (76%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M S R  PNIIVTGTPGCGK+TTCELLQRRLD  +YYNIS+FA+EH CY+GYDEGRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +IIDWHVNDVFPERLIDLVVVLR +N  LYDRL  RGYHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEEN+DAEIMGVVLQDA +SY  +IVVELQSNT   ME NV RI  W  +WV +H  GV+
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 SELK 184
           +EL+
Sbjct: 195 NELQ 198

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  257 bits (656), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 147/183 (80%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M S RF PNI+VTGTPGCGK++TCELLQRRL    YYNIS+FA++H+CYDGYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +I+DWHVND+FPERLIDLVVVLR++N  LYDRLK+RGYH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           I+EN+DAEIMGVV+QDAQ+SYE EIVVELQS+T + M+ NVDRI +W   W+E++  GV+
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 SEL 183
           +EL
Sbjct: 181 NEL 183

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  256 bits (655), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (78%)

Query: 2   GSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIV 61
            SRR+ PN+++TGTPG GKSTTCELLQRRL  Y YYNIS+FA+E+ CY+GYD+GRKSHIV
Sbjct: 5   NSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIV 64

Query: 62  XXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKI 121
                          GKSI+DWHVND+FPERLIDLVVVLR +N  LYDRL  RGYHDSKI
Sbjct: 65  DEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKI 124

Query: 122 EENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSS 181
           +ENLDAEIMGVVLQDA ESY+ EIVVELQS+ TE ME NV+RI  W   W+++HK+GV++
Sbjct: 125 QENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTN 184

Query: 182 ELKDGKK 188
           EL+   K
Sbjct: 185 ELQGKNK 191

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  256 bits (654), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 125/187 (66%), Positives = 147/187 (78%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M SRR+ PNIIVTGTPGCGKS+TCELL+  L GYKYYNIS+FA+++ C++GYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G SIIDWHVNDVFPERLIDLVVVLR +N KLY RL ARGYHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVV QDA +SYEP IVVELQS+T +D+ +NV RI  W   W+E+H +GV+
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 SELKDGK 187
           +E + G+
Sbjct: 181 NEYQGGR 187

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  254 bits (650), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 146/183 (79%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M SRR+HPN+++TGTPG GKSTT ELLQRRL  ++YYNIS+FA+E+ C+DGYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +IIDWHVNDVFPERLIDLVVVLR EN  L+ RLK RGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           I+EN+DAEIMGVV+QDA +SYE EIVVEL S++TE MENNVDRI +WV+ W ++H  GV+
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 SEL 183
           +EL
Sbjct: 181 NEL 183

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  254 bits (648), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 123/184 (66%), Positives = 143/184 (77%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M +RR+ PNIIVTGTPGCGKS+TCE L+ +L  YKYYNIS+FA+++ C++GYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G SI+DWHVNDVFPERLIDLVVVLR +N  LY RL ARGYHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVV QDA ESYEP IVVELQS+T EDM +NV RI  W   W+E+H DGV+
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 SELK 184
           +E +
Sbjct: 181 NEYQ 184

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  253 bits (646), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 139/184 (75%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M   R  PNI+V+GTPGCGKSTTCELLQR L  Y+Y+NIS+FA EH CYDGYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +I+DWHVND+FPERLIDLVVVLR +N  L+DRL+ RGYH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEEN+DAEIMGVVLQDA +SY  EIVVELQS+ TE M+ NVDRI  W  NWV EH DGVS
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 SELK 184
           + L+
Sbjct: 181 NALQ 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  250 bits (639), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 123/184 (66%), Positives = 140/184 (76%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M  RRF PNIIVTGTPGCGKS+TCELL+  L GYKYYNIS+FA+++ C++ YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G SIIDWHVNDVFPERLIDLVVVLR +N  LY RL ARGYHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           IEENLDAEIMGVV QDA +SYEP IVVELQ +T EDM +NV RI  W   W+E+H DGV+
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 SELK 184
           +E +
Sbjct: 181 NEYQ 184

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  249 bits (636), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 149/188 (79%)

Query: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60
           M SRR+ PN++++GTPG GKS+TCELL+R L+ YKY NIS+FA+E  CYDG+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120
           V               G +I+DWHVNDVFPERLIDLVV+LR++N  LYDRL+ R YHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180
           ++ENLDAEIMGVVLQDA +SY  EIV+ELQSN TE+M +NVDRI +WV+ W ++H DGV+
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 SELKDGKK 188
           +EL + KK
Sbjct: 181 NELGEIKK 188

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  240 bits (612), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 119/184 (64%), Positives = 138/184 (75%), Gaps = 1/184 (0%)

Query: 1   MG-SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSH 59
           MG SRR +PNI+VTGTPG GKSTTCELL R L  Y YYNIS+FA ++KCYDGYDE RKSH
Sbjct: 1   MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSH 60

Query: 60  IVXXXXXXXXXXXXXXXGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDS 119
           IV               G +IIDWHVNDVFPERLIDLV VLR ++  L+DRL  R YH S
Sbjct: 61  IVDEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSS 120

Query: 120 KIEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGV 179
           KI+EN+DAEIMGVVLQDA +SYE +IVVELQS+ TE M  NVDR+ TW   W E+H +GV
Sbjct: 121 KIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGV 180

Query: 180 SSEL 183
           ++EL
Sbjct: 181 TNEL 184

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G+ Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY 71

>YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}
          RFC4Subunit of heteropentameric Replication factor C
          (RF-C), which is a DNA binding protein and ATPase that
          acts as a clamp loader of the proliferating cell
          nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 323

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGRSY 71

>Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGSSY 71

>Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGNSY 71

>TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.103
          YOL094C
          Length = 322

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 45 PHMIISGLPGIGKTTSVHCLAHELLGKSY 73

>KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 322

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHLIISGLPGIGKTTSVSCLAHELLGNAY 72

>KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.103
          YOL094C
          Length = 321

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHMIISGLPGIGKTTSVHCLAHELLGSHY 72

>KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.26
           YNL218W
          Length = 589

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 8   PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEE 45
           P++I+ G PG GK++   LL + +DG KY  I   A +
Sbjct: 180 PSMILWGPPGVGKTSLARLLTKSVDG-KYLMIETSATK 216

>Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C
          (RFC4) - Subunit 4 of Replication Factor C; homologous
          to human RFC 40 kDa subunit [contig 184] FULL
          Length = 322

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHLIISGLPGIGKTTSISCLAHELLGNAY 72

>Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp,
          321 aa] {ON} complement(54419..55063,55065..55385) [966
          nt, 322 aa]
          Length = 321

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHMIISGMPGIGKTTSIHCLAHELLGDSY 72

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 10   IIVTGTPGCGKSTTCELLQR 29
            I++ G  GCGK+T C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>Skud_2.245 Chr2 (446256..446432,446536..446619) [261 bp, 86 aa]
          {ON} YBR118W (REAL)
          Length = 86

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 1  MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEE 45
          MG  + H N++V G    GKSTT   L  +  G     I +F +E
Sbjct: 1  MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE 45

>Skud_16.368 Chr16 (665741..665917,666021..666104) [261 bp, 86 aa]
          {ON} YPR080W (REAL)
          Length = 86

 Score = 29.3 bits (64), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 1  MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEE 45
          MG  + H N++V G    GKSTT   L  +  G     I +F +E
Sbjct: 1  MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE 45

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 9  NIIVTGTPGCGKSTTCELLQRRLD 32
          NII+ G PG GKST  E L   L+
Sbjct: 26 NIIIVGPPGSGKSTIAEKLSANLN 49

>TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.103
          YOL094C
          Length = 324

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 46 PHMIISGMPGIGKTTSIHCLAHELLGDSY 74

>TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON}
          Anc_3.103 YOL094C
          Length = 325

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHMIISGLPGIGKTTSIHCLAHELLGDSY 72

>SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 319

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 43 PHMIISGLPGIGKTTSIHCLAHELLGDSY 71

>TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa]
          {ON} Anc_3.69 YNL290W
          Length = 333

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 5/41 (12%)

Query: 4  RRF-----HPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          RRF      P+++  G PG GK++T   L R + G  Y N+
Sbjct: 36 RRFVSEGKLPHLLFYGPPGTGKTSTIVALAREIYGNNYSNM 76

>NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa]
          {ON} Anc_3.69
          Length = 338

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 48 PHLLFYGPPGTGKTSTIVALAREIFGKNYSNM 79

>ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly
          similar to uniprot|P40339 Saccharomyces cerevisiae
          YOL094C RFC4 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 321

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKY 36
          P++I++G PG GK+T+   L   L G  Y
Sbjct: 44 PHLIISGLPGIGKTTSIHCLAHELLGDSY 72

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
          YNL290W
          Length = 336

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 5/41 (12%)

Query: 4  RRF-----HPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          RRF      P+++  G PG GK++T   L R + G  Y N+
Sbjct: 36 RRFIEEGQLPHLLFYGPPGTGKTSTVVALAREIYGKNYSNM 76

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit
          of heteropentameric Replication factor C (RF-C), which
          is a DNA binding protein and ATPase that acts as a
          clamp loader of the proliferating cell nuclear antigen
          (PCNA) processivity factor for DNA polymerases delta
          and epsilon
          Length = 340

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa]
          {ON} Anc_3.69
          Length = 336

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>AFR169W Chr6 (744136..752151) [8016 bp, 2671 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL195W (GCN1)
          Length = 2671

 Score = 30.4 bits (67), Expect = 4.3,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 135 QDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVE 173
           QDA + +  E+   ++SN   D ++ V RI TWV  + E
Sbjct: 367 QDALQQFVAELFKSMKSNMHVDYKSTVARILTWVPTFSE 405

>Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highly
          similar to uniprot|P38629 YNL290W Saccharomyces
          cerevisiae RFC3 Subunit of heteropentameric Replication
          factor C (RF-C)
          Length = 329

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGSNYRNM 73

>SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290W RFC3 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 329

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L R + G  Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGKNYKNM 73

>AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR106C
            (MDN1)
          Length = 4899

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 16/23 (69%)

Query: 10   IIVTGTPGCGKSTTCELLQRRLD 32
            +++ G  GCGK+T C+L+ R  D
Sbjct: 1364 VLLVGETGCGKTTICDLIARYKD 1386

>Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa]
          {ON} complement(64176..65186) [1011 nt, 337 aa]
          Length = 336

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 8  PNIIVTGTPGCGKSTTCELLQRRLDGYKYYNI 39
          P+++  G PG GK++T   L + + G  Y+N+
Sbjct: 46 PHLLFYGPPGTGKTSTIIALAKEIYGKNYHNM 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,487,834
Number of extensions: 834352
Number of successful extensions: 3418
Number of sequences better than 10.0: 90
Number of HSP's gapped: 3418
Number of HSP's successfully gapped: 90
Length of query: 212
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 107
Effective length of database: 41,441,469
Effective search space: 4434237183
Effective search space used: 4434237183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)