Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I02706g8.851ON89894511e-59
ZYRO0C14894g8.851ON84833191e-39
TPHA0I003308.851ON88843164e-39
NDAI0E002508.851ON93903141e-38
NCAS0B002608.851ON88873095e-38
YMR286W (MRPL33)8.851ON86833062e-37
TDEL0B002008.851ON86843052e-37
Kpol_237.28.851ON86833052e-37
Suva_13.4768.851ON83833009e-37
Skud_13.4598.851ON83832973e-36
SAKL0D01144g8.851ON84832955e-36
Kwal_27.102098.851ON84832931e-35
Smik_13.5028.851ON84842912e-35
AFR450C8.851ON84832834e-34
KLLA0C06270g8.851ON84832817e-34
Ecym_46248.851ON84832749e-33
KAFR0A028708.851ON85832722e-32
KNAG0G034808.851ON84832643e-31
KLTH0C03630g8.851ON84832592e-30
TBLA0B029108.851ON85812497e-29
NDAI0C039005.274ON48951660.66
TDEL0F036908.242ON108249622.0
Suva_1.147.17ON104542604.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I02706g
         (89 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   178   1e-59
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   127   1e-39
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   126   4e-39
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   125   1e-38
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   123   5e-38
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   122   2e-37
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   122   2e-37
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   122   2e-37
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   120   9e-37
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   119   3e-36
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   118   5e-36
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   117   1e-35
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   116   2e-35
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   113   4e-34
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   112   7e-34
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   110   9e-33
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...   109   2e-32
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   106   3e-31
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   104   2e-30
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...   100   7e-29
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    30   0.66 
TDEL0F03690 Chr6 (675163..678411) [3249 bp, 1082 aa] {ON} Anc_8....    28   2.0  
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    28   4.4  

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  178 bits (451), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQEDGLLE 89
          SRLTKQQQRELRKTNPGFTVEKQEDGLLE
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQEDGLLE 89

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  127 bits (319), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 58/83 (69%), Positives = 72/83 (86%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YKVTL RSLIG P   RN+VK++GLGKRGS VYR+V+P  AGSLAK+KEL++V+VT+
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LTK+QQRELRK+NPGFTVEK+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 76/84 (90%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RSLIGTP   +N+VKAIGLGKRGSVVYR+ +P+MAG+LA +KE++ V+VT+
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQE 84
          ++L+K+QQRELRK+NPGFTV+K+E
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKRE 84

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  125 bits (314), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (85%), Gaps = 1/90 (1%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RSLIG P+ TR IVK IGLGKRGS+VYR+V+P+MAGSLAK+KELI V++T+
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQE-DGLLE 89
            L K +QRELRK+NPGFT+EK+  +G+++
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKRNLNGIID 90

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  123 bits (309), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 74/87 (85%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M YYK+TL RS+IG P+ATR+IVK +GLGKRGSV+YR+V+P++AGS+ K+KE+I V+VTK
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQEDGL 87
            L K +QR+LRK+NPGF VEK+ D L
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKRSDLL 87

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  122 bits (306), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 72/83 (86%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YKVTL RSLIG P  T++IVK++GLGKRGS+VY+KV+P++AGSLAK+KEL+ V+VT+
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LT  QQRELRK+NPGF VEK+
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  122 bits (305), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 52/84 (61%), Positives = 77/84 (91%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          MA+YK+TL RS+IGTP  T++IVK++GLGK GS+VY++V+P+ AG+LAK+KEL+ V+VT+
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQE 84
          ++L+K++QRELRK+NPGF VEK++
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKRQ 84

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  122 bits (305), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 73/83 (87%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          MA+YK+TL RSLIG P+ATRNIVK IGLGKRGS+VYR+V+PS+AGSLAK+KEL+SV+++ 
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LT+++    RK+NPGFTVEK+
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKR 83

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  120 bits (300), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 73/83 (87%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RSLIG P  T+++VK++GLGKRGS+VY++V+P++AGSLAK+KEL++V+VT+
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LT  QQRELRK+NPGF VEK+
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  119 bits (297), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 71/83 (85%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RSLIG P  T++IVK++GLGKRGS+ Y++V+P++AGSLAK+KELI ++VT+
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LT  QQRELRK+NPGF VEK+
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  118 bits (295), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 73/83 (87%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RS IG P+AT++IVK++GLGKRGS VYR+V+PS+AGS+ KIKEL+ ++VT+
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            L+K++QRELRK+NPGF VEK+
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKR 83

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  117 bits (293), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 71/83 (85%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RS IG P+A +++V ++GLGK GSVVYR+VSPS+AGS+AKIKE++ VDV +
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            L+K+QQRELRK+NPGF VEK+
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKR 83

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  116 bits (291), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          MA+YK+ L RSLIG P  T++IVK++GLGKRGS+VY++V+P++AGSLAK+KEL++V VTK
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQE 84
            LT  QQR LR +NPGF VEK+ 
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKRS 84

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  113 bits (283), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 68/83 (81%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RS IG P+  + +V ++GLGKRG+ VYRKVSP  AGS+AKIKEL+ V+VT+
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LTK++QR LRK+NPGFTVEK+
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKR 83

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  112 bits (281), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 71/83 (85%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +Y++TL RS+IGTP+ TR +VK++GLGKRGSV Y+  +PS+AG++A+IKEL+SV++  
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            L+K +QRELRK+NPGFTVEK+
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKR 83

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  110 bits (274), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 69/83 (83%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+ L RS IG P  TR +VK++GLGKRGSVVY  VSP++AG++AK+KEL++V+VT 
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            L+K++QR+LR +NPG+TVEK+
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKR 83

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (80%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M YY+ TLVRSLIG P+ TR IVK +G  KRGS +YRKV+P++ GSL K+KELIS+ +T+
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            +TK +QRE+RK+NPG+ VEK+
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKR 83

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  106 bits (264), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 66/83 (79%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YKVTL RSLIG P ATR IVK +GLGKRGS VY++ +P++AGSL K+KELI+V+V+ 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
           +++K + R  RK+NPG+ VE Q
Sbjct: 61 QKVSKGEMRLARKSNPGYVVEAQ 83

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 74/83 (89%)

Query: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60
          M +YK+TL RS IG P+AT+++V ++GLGK GSVVYR+V+PS+AGS+AK+KE++ V+VT+
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 SRLTKQQQRELRKTNPGFTVEKQ 83
            LTK+QQRELRK+NPGFTVEK+
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKR 83

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  100 bits (249), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 66/81 (81%)

Query: 3  YYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTKSR 62
          +YK+TL RSLIG P+ +R+IVK++GLGKRGS+ Y+K+SPS AG++ ++KEL+ V++T   
Sbjct: 2  FYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKA 61

Query: 63 LTKQQQRELRKTNPGFTVEKQ 83
          LTK +  + R++NPGF +EK+
Sbjct: 62 LTKAEVHDSRRSNPGFIIEKR 82

>NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa]
          {ON} Anc_5.274
          Length = 489

 Score = 30.0 bits (66), Expect = 0.66,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 22 IVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTKSRLTKQQQRELR 72
          IVKAIG G  G +   K + ++  ++  IK++ S     SR  K+  REL+
Sbjct: 25 IVKAIGKGSFGLICSAKYTEAVDSTMVAIKQIDSA-FQNSRTAKRALRELK 74

>TDEL0F03690 Chr6 (675163..678411) [3249 bp, 1082 aa] {ON} Anc_8.242
           YER176W
          Length = 1082

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 17  EATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTKSRLTK 65
           EA  N    +G     ++VY ++ P M  ++AK++   S DV+K++ +K
Sbjct: 693 EAQYNNEHPLGKICLHNIVYDQMPPDMKENIAKLRSGRSKDVSKNQFSK 741

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 27.7 bits (60), Expect = 4.4,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 38  KVSPSMAGSLAKIKELI----SVDVTKSRLTKQQQRELRKTN 75
           +  PS+A +L K+KE++      D  KSR+ +   R L+ TN
Sbjct: 247 RAQPSVANNLLKLKEMLIRQCQTDDEKSRVNEFTDRILQNTN 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,130,407
Number of extensions: 255786
Number of successful extensions: 700
Number of sequences better than 10.0: 27
Number of HSP's gapped: 700
Number of HSP's successfully gapped: 27
Length of query: 89
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 29
Effective length of database: 46,601,439
Effective search space: 1351441731
Effective search space used: 1351441731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)