Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I02684g8.850ON49349323730.0
TBLA0B029008.850ON52043917580.0
Suva_13.4758.850ON51544117460.0
NCAS0C003108.850ON55644317330.0
ZYRO0C14872g8.850ON49643617230.0
NDAI0K003708.850ON56842517060.0
Skud_13.4588.850ON51444116940.0
TDEL0B001908.850ON49243916840.0
YMR285C (NGL2)8.850ON51544116800.0
Kpol_237.18.850ON50343916730.0
Smik_13.5018.850ON51544016670.0
SAKL0D01166g8.850ON50543716650.0
KAFR0L019608.850ON51144216340.0
TPHA0I003208.850ON52944116290.0
KNAG0K006508.850ON48244715670.0
KLTH0C03608g8.850ON49544015600.0
Kwal_27.102048.850ON49443514910.0
KLLA0C06248g8.850ON51644414820.0
Ecym_46198.850ON48742313820.0
ABL118W8.850ON50442313640.0
NDAI0E002608.850ON49845611951e-160
NCAS0B002708.850ON47644511321e-151
TBLA0D033008.850ON48044911101e-147
CAGL0B02387g8.850ON4714499551e-124
YML118W (NGL3)8.850ON5054569351e-121
Suva_13.258.850ON5024519351e-121
Skud_13.238.850ON4984549201e-118
Smik_13.168.850ON5024539151e-118
KAFR0A028608.850ON4784359081e-117
KNAG0G034708.850ON4664398571e-109
SAKL0B10032g7.78ON7312562028e-16
KLTH0D02310g7.78ON7392321992e-15
KLLA0F15884g7.78ON7902241973e-15
KNAG0D048407.78ON7792411955e-15
Suva_1.457.78ON8312551946e-15
Ecym_73547.78ON7852241921e-14
ACR288W7.78ON7362261912e-14
CAGL0H06149g7.78ON8732301902e-14
Skud_1.407.78ON8692551884e-14
KAFR0K006707.78ON7952231866e-14
Kwal_26.71127.78ON7422411867e-14
ZYRO0D05302g7.78ON8572231867e-14
YAL021C (CCR4)7.78ON8372241803e-13
Smik_1.457.78ON8392231779e-13
NDAI0H025207.78ON8982541751e-12
TPHA0H026807.78ON8722701732e-12
TBLA0A046607.78ON8962561724e-12
Kpol_1040.147.78ON7842291714e-12
TDEL0H037307.78ON7972321714e-12
NCAS0F016407.78ON8552591545e-10
ACR277C7.90ON3782601435e-09
Kwal_26.71707.90ON3722441356e-08
Ecym_26367.90ON3672141348e-08
KLTH0D02574g7.90ON3682471275e-07
KLLA0F07733g7.90ON3712371266e-07
CAGL0F01001g7.90ON3592351268e-07
SAKL0B09768g7.90ON3682441232e-06
Kpol_1044.67.90ON3722411161e-05
TBLA0E022607.90ON3882381161e-05
ZYRO0D05588g7.90ON3562401115e-05
TDEL0H036007.90ON3662391081e-04
KNAG0L005507.90ON3812411043e-04
TPHA0L005307.90ON3912411044e-04
KAFR0D012507.90ON3562341035e-04
NDAI0A085307.90ON365238950.004
YOL042W (NGL1)7.90ON363133930.007
Smik_15.1257.90ON363240920.011
Suva_15.1277.90ON363259900.018
NCAS0I005007.90ON389245880.029
Skud_15.1157.90ON363133870.036
Suva_14.761.85ON1066156780.68
Skud_14.721.85ON1066151770.83
YNL267W (PIK1)1.85ON1066155761.2
YPL249C (GYP5)6.281ON89494698.6
Smik_6.4536.281ON93390689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I02684g
         (493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   918   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   681   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   677   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      672   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   668   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   661   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   657   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   653   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   651   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   649   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   646   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   645   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   634   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   632   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   608   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   605   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   578   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   575   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   536   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   530   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   464   e-160
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      440   e-151
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   432   e-147
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   372   e-124
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   364   e-121
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   364   e-121
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   358   e-118
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   357   e-118
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   354   e-117
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   334   e-109
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    82   8e-16
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    81   2e-15
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    80   3e-15
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    80   5e-15
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    79   6e-15
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    79   1e-14
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    78   2e-14
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    78   2e-14
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    77   4e-14
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    76   6e-14
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    76   7e-14
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    76   7e-14
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    74   3e-13
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    73   9e-13
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      72   1e-12
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    71   2e-12
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    71   4e-12
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    70   4e-12
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    70   4e-12
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      64   5e-10
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    60   5e-09
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    57   6e-08
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    56   8e-08
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    54   5e-07
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    53   6e-07
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    53   8e-07
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    52   2e-06
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    49   1e-05
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    49   1e-05
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    47   5e-05
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    46   1e-04
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    45   3e-04
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    45   4e-04
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    44   5e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    41   0.004
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    40   0.007
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    40   0.011
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    39   0.018
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    39   0.029
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    38   0.036
Suva_14.76 Chr14 (135508..138708) [3201 bp, 1066 aa] {ON} YNL267...    35   0.68 
Skud_14.72 Chr14 (129617..132817) [3201 bp, 1066 aa] {ON} YNL267...    34   0.83 
YNL267W Chr14 (140878..144078) [3201 bp, 1066 aa] {ON}  PIK1Phos...    34   1.2  
YPL249C Chr16 complement(76669..79353) [2685 bp, 894 aa] {ON}  G...    31   8.6  
Smik_6.453 Chr6 (744924..747725) [2802 bp, 933 aa] {ON} YPL249C ...    31   9.7  

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/493 (89%), Positives = 443/493 (89%)

Query: 1   MTQEEVVHVAENPAAVNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRQEMLE 60
           MTQEEVVHVAENPAAVNA                                   KRQEMLE
Sbjct: 1   MTQEEVVHVAENPAAVNAVKEVKKSKGKKKGKGKPSPEEIARIRAEREAMREAKRQEMLE 60

Query: 61  RGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWY 120
           RGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWY
Sbjct: 61  RGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWY 120

Query: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWK 180
           RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWK
Sbjct: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWK 180

Query: 181 HEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVG 240
           HEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVG
Sbjct: 181 HEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVG 240

Query: 241 TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFD 300
           TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFD
Sbjct: 241 TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFD 300

Query: 301 SPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQPQTPVP 360
           SPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR               KFGKDQPQTPVP
Sbjct: 301 SPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQPQTPVP 360

Query: 361 EKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHT 420
           EKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHT
Sbjct: 361 EKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHT 420

Query: 421 WRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYP 480
           WRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYP
Sbjct: 421 WRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYP 480

Query: 481 SDHLCLLSEVELR 493
           SDHLCLLSEVELR
Sbjct: 481 SDHLCLLSEVELR 493

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/439 (71%), Positives = 367/439 (83%), Gaps = 2/439 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR  +L +G+DPDCP ELQFI+R +L++HE EPV+G K  +M+YNCLAQALIRRKLFP+ 
Sbjct: 82  KRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEG 141

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKW+RRS+VLLNEFKHY+PD++CLQEID++QYQSFWKEEF KLGY  QF++KPSKNH
Sbjct: 142 GDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNH 201

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV ++WK E FEM+DRML+D+D E SGDIEPRTTTNN AL+L+LKF++KV     K + +
Sbjct: 202 GVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNI-N 260

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           K+GIL+GTTHLFWHPFGTYERTRQCY++LNKMKEF+ RVN+LQNN D D SHWYPFFCGD
Sbjct: 261 KTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGD 320

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFDSPYLSMT KPIKY  R+KTVIECSTSFKFSKKR               KFGKD
Sbjct: 321 FNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR-DGEEGDDEEGGNIEKFGKD 379

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QPQ PVP+ + ANDEQ  LV++M+ELHNSLDMRA+SLYS  Y KVHPENSG+DNER EPE
Sbjct: 380 QPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPE 439

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473
           ISNWAH WRGLLDY+F I++W+F    EID+LEDFE  N+IKIRG LRMPP  E+ +HGQ
Sbjct: 440 ISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQ 499

Query: 474 PHVGEYPSDHLCLLSEVEL 492
           P  GEYPSDHLC+L EVEL
Sbjct: 500 PFEGEYPSDHLCMLCEVEL 518

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/441 (69%), Positives = 362/441 (82%), Gaps = 1/441 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR  ML +G+DPDCPPEL FI+R  L LHEEEPV G + K+M+YNCLAQALIRRKLFPDS
Sbjct: 74  KRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDS 133

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKWYRRSRVLLNEF+HY+ DV+CLQEID+IQ+QSFWKEEF KLGY  Q+HR  +KNH
Sbjct: 134 GDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNH 193

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV IIW+ + F+  D+MLIDFD E SG+I  RTTTNN  L+LALKF++KV     K    
Sbjct: 194 GVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSK 253

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           KSGIL+GT+HLFWHPFGTYERTRQCY+VL KM+EFMHRVNVLQN NDGD+SHW+PFFCGD
Sbjct: 254 KSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGD 313

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMTCKP+ Y+ RAKTVIECSTSFKFSK R               KFGKD
Sbjct: 314 FNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEEGADEEEGGNIEKFGKD 373

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP++PVP+ F AN+EQ +LV +M +LHNSLDMRAVSLYSVAY  VHPEN+GLDN+RGEPE
Sbjct: 374 QPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPE 433

Query: 414 ISNWAHTWRGLLDYMFMIRNWEF-DDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHG 472
           ISNWA+TWRGLLDY+F I+ W+   +  E+D+L+DFE  N IK RG LRMPPGSEM+ HG
Sbjct: 434 ISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHG 493

Query: 473 QPHVGEYPSDHLCLLSEVELR 493
           QPHVGEY SDHL ++ ++EL+
Sbjct: 494 QPHVGEYASDHLSMVCDIELQ 514

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/443 (70%), Positives = 361/443 (81%), Gaps = 7/443 (1%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           K++  L +G+DP+  P+LQFI+R +L LHEEEPV G KI IM+YNCLAQALIRRKLFPDS
Sbjct: 116 KKEAALAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDS 175

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKW++RS+VL NEFKHY+PDV+CLQEID++QYQSFWK EF+K+GY SQFHRK SKNH
Sbjct: 176 GDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNH 235

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV IIW+ E F ++D+MLIDFD E SG+I PRTTTNNA L L+LKFT+K      K  + 
Sbjct: 236 GVAIIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKAL---SKFSNG 292

Query: 234 KS--GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFC 291
            S  GI+VGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHR+NVLQNNNDGD SHWYPFFC
Sbjct: 293 TSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFC 352

Query: 292 GDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFG 351
           GDFNSQPFD+PYLSMT KPI Y  RAKTVIECSTS+KFSKKR               KFG
Sbjct: 353 GDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFG 412

Query: 352 KDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGE 411
           KDQPQTPVP+ F+AN+EQ KLV  ME LHNSLDMRA+SLY V Y KVHPEN+GLDN+ GE
Sbjct: 413 KDQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGE 472

Query: 412 PEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMST- 470
           PEISNWAHTW GLLDY+  I++W FDD   +DTLE FE  N+IK+RG LRMPP +EMS  
Sbjct: 473 PEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKH 532

Query: 471 -HGQPHVGEYPSDHLCLLSEVEL 492
            HGQPH GEYPSDHL ++ E+EL
Sbjct: 533 GHGQPHTGEYPSDHLSMICELEL 555

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/436 (72%), Positives = 359/436 (82%), Gaps = 4/436 (0%)

Query: 58  MLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEAL 117
           M+ +G+DPD PPELQFI+R +L LH+ E VEG K K+M+YNCLAQALIRRKLFP SG+AL
Sbjct: 62  MMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDAL 121

Query: 118 KWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCI 177
           KWYRRS+VLLNEFK+Y+ DV+CLQEIDYIQYQSFWK+E  KLGY SQFHR+ SKNHGV I
Sbjct: 122 KWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAI 181

Query: 178 IWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGI 237
           +WK E F M+D+MLIDFD E SGDI PRTTTNNA LIL+LKF+ KV    ++    K+GI
Sbjct: 182 VWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKV---AQEHNLKKTGI 238

Query: 238 LVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
           +VGTTHLFWHPFGT+ERTRQCYVVLNK+KEF HRVNVLQN NDGD SHWYPFFCGDFNSQ
Sbjct: 239 IVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQ 298

Query: 298 PFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXX-XKFGKDQPQ 356
           PFDSPYLSMT KPI+Y  RAKTVIECSTS+ FSK R                KFG DQP 
Sbjct: 299 PFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPD 358

Query: 357 TPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISN 416
            PVP+ + A D + +LV QM+ LHNSLDMRAVSLYSVAY KVHPEN+GLDNERGEPEISN
Sbjct: 359 HPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISN 418

Query: 417 WAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHV 476
           WAHTWRGLLDY+F IR+W+F D  EID+LE FE  N++KIRGLLR+PPG EM+ HGQPH 
Sbjct: 419 WAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHT 478

Query: 477 GEYPSDHLCLLSEVEL 492
           GEYPSDHLC+L E+EL
Sbjct: 479 GEYPSDHLCMLCELEL 494

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/425 (70%), Positives = 348/425 (81%)

Query: 68  PPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLL 127
           PPELQFI+R +L LHEEEPV+G K  +M+YNCLAQALIRRKLFPDSG+ALKWYRRS+VLL
Sbjct: 143 PPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLL 202

Query: 128 NEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMS 187
           NEF +Y PD++CLQE+D+IQYQSFWK EF+KLGY SQ+HRK  KNHGV IIW+   F M+
Sbjct: 203 NEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMT 262

Query: 188 DRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWH 247
           D+MLI+FD E SG++ PRTTTNN  LIL+LKFT + K   K +   K+GI++GTTHLFWH
Sbjct: 263 DKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFWH 322

Query: 248 PFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMT 307
           PFGTYERTRQCYVVLNKMKEFMHRVNVLQNNND D+SHWYPFFCGDFNSQPFDSPYLSM 
Sbjct: 323 PFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSMV 382

Query: 308 CKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQPQTPVPEKFVAND 367
            KP++Y  RAKTVIECSTS+KFSKKR               KFG DQPQTPVPE+F+AN 
Sbjct: 383 RKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIANG 442

Query: 368 EQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDY 427
           EQT LV  ME+LHNSL+MRA+SLY V Y  VHPEN+ +DNE GEPEISNWAHTW GLLDY
Sbjct: 443 EQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLDY 502

Query: 428 MFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLL 487
           +  ++ W F D T+ +TL+ FE SN+++IRG LRMPP +EM+ HGQPHVGEYPSDHL +L
Sbjct: 503 LLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSML 562

Query: 488 SEVEL 492
             +EL
Sbjct: 563 CSIEL 567

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/441 (68%), Positives = 354/441 (80%), Gaps = 1/441 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR  ML  GVDPDCPPEL FI+R +L L E EPV G + K+M+YNCLAQALIRRKLFPDS
Sbjct: 73  KRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDS 132

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKW+RRS+VLLNEFK+Y+ DV+CLQE+D+IQ+QSFWK +F K+GY  Q+HR P+KNH
Sbjct: 133 GDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNH 192

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV IIW+   F+  D+MLID+D E SG I  RTTTNN  L+LALKF+++V     K    
Sbjct: 193 GVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSSK 252

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           K GIL+GTTHLFWHPFGTYERTRQCYVVL KMKEFMHRVNVLQN+NDGD+SHW+PFFCGD
Sbjct: 253 KCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGD 312

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMT KP+ Y SRAKTVIECSTSFKFSK R               KFGKD
Sbjct: 313 FNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEEGADDEEGGNIEKFGKD 372

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP++PVPE F ANDEQ ++V  M +LHNSLDMRA+SLYSV Y  VHPEN+GLDN+RGEPE
Sbjct: 373 QPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPE 432

Query: 414 ISNWAHTWRGLLDYMFMIRNWEF-DDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHG 472
           ISNWA+TWRGLLDY+F I+ W+   +R E++ L DFE  N IK RG LRMPP SEM+ HG
Sbjct: 433 ISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHG 492

Query: 473 QPHVGEYPSDHLCLLSEVELR 493
           QPHVGEYPSDHL ++ ++EL+
Sbjct: 493 QPHVGEYPSDHLSMVCDLELQ 513

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/439 (68%), Positives = 356/439 (81%), Gaps = 2/439 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR+EML +G+DPD PPELQFI+R +L LHE+EP+EGL  K+++YNCLAQALIRRKLFPDS
Sbjct: 54  KREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDS 113

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G++LKW+RRS+VL  EFKHY+ DVLCLQEIDYIQYQ FWK+E  KLGY +QF+++P KNH
Sbjct: 114 GDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNH 173

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV I WK   F+++DRMLID+D E SG IE RT T+N+ LILALKFT   K     +   
Sbjct: 174 GVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHI--R 231

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           KSGILVGT+HLFWHPFGTYERTRQCYVVL KMKEFM RVNVLQNNNDG++SHW PFFCGD
Sbjct: 232 KSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGD 291

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMT KP++Y  RAKTV+ECSTS+ FSK R               KFGKD
Sbjct: 292 FNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRNGEEDAEDEEGGNIEKFGKD 351

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QPQTPVPE F A  EQ KLV +M+ELHNS+DMRA+SLY+V Y +VHPENSG+DN+RGEPE
Sbjct: 352 QPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPE 411

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473
           +SNWA+TWRGLLDY+ +I  W+  DR ++D+LE FE  N++K+RGLLRMPP SEMS HGQ
Sbjct: 412 MSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQ 471

Query: 474 PHVGEYPSDHLCLLSEVEL 492
           PH GEY SDHL ++  +EL
Sbjct: 472 PHEGEYASDHLSMMCTIEL 490

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/441 (67%), Positives = 354/441 (80%), Gaps = 1/441 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR  ML +GVDPDCPPEL FIRR  L LHE EPV G + K+M+YNCLAQALIRRKLFPDS
Sbjct: 74  KRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDS 133

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKWYRRS+VLLNEFK+Y+ DV+CLQEID+IQ+QSFWK+EF KLGY  Q++R  +KNH
Sbjct: 134 GDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNH 193

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV I+W+ E F   D+MLID+D E S  I  RTTTNN  L+LALKF++KV     K    
Sbjct: 194 GVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSK 253

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           K GIL+GTTHLFWHPFGTYERTRQCY+VL KMKEFMHRVNVLQN NDGD+SHW+PFFCGD
Sbjct: 254 KCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGD 313

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMT KP+ Y +RAKTVI CSTS+KFSK R               K+GKD
Sbjct: 314 FNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGGNIEKYGKD 373

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP++PVPEKF AN+EQ++LV +M +LHNSLDMRA+SLYSV Y  VHPEN+GLDN+RGEPE
Sbjct: 374 QPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPE 433

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRT-EIDTLEDFENSNNIKIRGLLRMPPGSEMSTHG 472
           ISNWA+TWRGLLDY+F ++ W+      E++TL DFE  N +K RG LRMPPG+EM+ HG
Sbjct: 434 ISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHG 493

Query: 473 QPHVGEYPSDHLCLLSEVELR 493
           QPHVGEY SDHL ++ ++EL+
Sbjct: 494 QPHVGEYASDHLSMVCDLELQ 514

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/439 (68%), Positives = 350/439 (79%), Gaps = 1/439 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR+E+L +G+DPD PPELQFI+R ML LH++EPV G    +M+YNCLAQALIRRKLFPDS
Sbjct: 64  KRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDS 123

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           GEA+KW+RRS+VLL EF+HY+ DV+CLQEID+IQYQ+FWK EF+KLGY SQFHR  SKNH
Sbjct: 124 GEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNH 183

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV I+WK E F+M+DRMLIDFD E S DI PRT TNN  LIL+LKF+ K+     K    
Sbjct: 184 GVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTK- 242

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
            +GI++GTTHLFWHPFGTYERTRQCYV+LNKMKEFMHRVNVLQN NDGD+SHW PFFCGD
Sbjct: 243 TTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGD 302

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFDSPYLSMT KPI+Y  RAKTVI+CSTS+KFSK R               KFGKD
Sbjct: 303 FNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFGKD 362

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QPQTPVPE F+AN+EQT LV +M  +HN L MRA SLYSV Y  VH EN+G+DN RGEP 
Sbjct: 363 QPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPI 422

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473
           ISNWA+TWRGLLDY+F +  W+FD+R  +D+LE FE  N+I++RG LRMP  SEM  HGQ
Sbjct: 423 ISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQ 482

Query: 474 PHVGEYPSDHLCLLSEVEL 492
           PH GEY SDHL ++  +EL
Sbjct: 483 PHEGEYASDHLSMICNIEL 501

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/440 (67%), Positives = 353/440 (80%), Gaps = 1/440 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR  ML +GVDPDCPPEL FI+R  L LHE+EPV G + K+M+YNCLAQALIRRKLFPDS
Sbjct: 74  KRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDS 133

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G+ALKWYRRSRVLLNEFK+Y  DV+CLQEID+IQ+QSFWK+EF KLGY  Q++R  +KNH
Sbjct: 134 GDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNH 193

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV I+W+ E F+  D+MLID+D E S +I  RTTTNN  L+LALKF++KV     K    
Sbjct: 194 GVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSK 253

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           K GIL+GTTHLFWHPFGTYERTRQCYVVL KMKEFMHRVNVLQN NDGD+SHW+PFFCGD
Sbjct: 254 KCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGD 313

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMT KP+ Y +RAKTVIECSTSFKFSK R               K+GKD
Sbjct: 314 FNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDESADDEEGGNIEKYGKD 373

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP++PVPE + AN+EQ +LV +M +LHNSLDMRA+SLYSV Y  VHPEN+GLDN+RGEPE
Sbjct: 374 QPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPE 433

Query: 414 ISNWAHTWRGLLDYMFMIRNWEF-DDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHG 472
           ISNWA+TWRGLLDY+F ++ W+   +  E++ L DFE  N +K RG LRMPPG EM+ HG
Sbjct: 434 ISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHG 493

Query: 473 QPHVGEYPSDHLCLLSEVEL 492
           QPHVGEY SDHL ++ ++EL
Sbjct: 494 QPHVGEYASDHLSMVCDLEL 513

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/437 (69%), Positives = 348/437 (79%), Gaps = 7/437 (1%)

Query: 58  MLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEAL 117
           ML  G+DP+ PP+LQFI+R +L LHEEEPV+G K KIM+YN LAQALIRRKLFP SG A+
Sbjct: 72  MLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAV 131

Query: 118 KWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCI 177
           KW++RS+VLLNEFKHYD DV CLQEID+IQYQ+FWKEEFQKLGY+SQFHR  +KNHGV I
Sbjct: 132 KWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAI 191

Query: 178 IWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKV--KMMGKKLLDDKS 235
           +W+   F M D ML+D+D E SGDI PRTTT NA LILALKFT KV  +  G K    KS
Sbjct: 192 VWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFPGTK----KS 247

Query: 236 GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFN 295
           GIL+GTTHLFWHPFGT+ERTRQCYVVLNKMKE +HRVNVLQNN D D SHWYPF CGDFN
Sbjct: 248 GILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFN 307

Query: 296 SQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQP 355
           SQPFD+PYLSMT KP+ Y  RAKTVIECSTSF FSK R               KFGK QP
Sbjct: 308 SQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR-DGEEGEDEEGGNIEKFGKGQP 366

Query: 356 QTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEIS 415
           + PVP++F A +EQT LV QME LHNSLDMRA+SLY+V Y  VHPEN+GLDN+ GEPEIS
Sbjct: 367 EHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEIS 426

Query: 416 NWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPH 475
           NWA TWRGLLDY+F ++NW   DR+ +D ++ FE  N IKIRGLLRMPPG EM+ HGQPH
Sbjct: 427 NWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPH 486

Query: 476 VGEYPSDHLCLLSEVEL 492
            GEYPSDHL ++ E+EL
Sbjct: 487 EGEYPSDHLSMMCEIEL 503

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/442 (66%), Positives = 350/442 (79%), Gaps = 4/442 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           K++ ML +G+DPD PPELQFIRR +L L + E   G + KIM+YNCLAQALIRRKLFPDS
Sbjct: 71  KQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMTYNCLAQALIRRKLFPDS 130

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           GEA+KW+RRS+VLLNEFK+YD DV+CLQE+D IQ+Q+FWKEEF KLGY SQFH KPSKNH
Sbjct: 131 GEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNH 190

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           G+ I+WK   F M+D+MLID+D E SG+I PRTTTNN  L+LALKF+ KV  + +     
Sbjct: 191 GISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKV--LERFPNTR 248

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           KSGI+VGTTHLFWHPFGTYERTRQCY+VLNK KEFMHRVNVLQNNND    HWY FF GD
Sbjct: 249 KSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGD 308

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLSMT KP+KY +RAKTVIECSTS+ FSK R               KFGKD
Sbjct: 309 FNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEEDAEDEEGGNIEKFGKD 368

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP TPVP  F A+ EQ  LV+ ME+LHNSLDMRA+SLYSV Y  VH EN+GLDN RGEPE
Sbjct: 369 QPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPE 428

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMST--H 471
           ISNWAH W GLLDY+F+I++W+F D+ ++D+L+ FE+ N +K++  L+MP  +EM    H
Sbjct: 429 ISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGH 488

Query: 472 GQPHVGEYPSDHLCLLSEVELR 493
           GQPHVGEYPSDHL ++ ++EL+
Sbjct: 489 GQPHVGEYPSDHLSMICKLELK 510

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/441 (65%), Positives = 356/441 (80%), Gaps = 2/441 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           K+++ML  G+DPDCPPELQFIRR +L LH++EP +     +M+YNCLAQALIRRKLFPDS
Sbjct: 87  KQKKMLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDS 146

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           GEA+KWYRRSRVLLNEFK+Y+PD++CLQEID+IQ+QSFW+EEF+K+GY+SQFHR  SKNH
Sbjct: 147 GEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNH 206

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLL-D 232
           GV I+WK+  F ++DRMLIDFD E SGDI PRT TNN  LIL+LK++  V     +L  +
Sbjct: 207 GVAIVWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNN 266

Query: 233 DKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCG 292
           +KSGI++GTTHLFWHPFGTYERTRQC+V+LNK+KEF  RVNVLQNNNDG+M HW  FFCG
Sbjct: 267 NKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCG 326

Query: 293 DFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXX-XKFG 351
           DFNSQPFD+PYLS+T KP++Y  RAK VIECSTS+ +SK R                KFG
Sbjct: 327 DFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFG 386

Query: 352 KDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGE 411
           KDQPQTPVP+ +    EQ  LVS+ME LHNSL+M+A SLY+V Y KVHPENSGLDN++GE
Sbjct: 387 KDQPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGE 446

Query: 412 PEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTH 471
           PEISNWAH+WRGLLDY+F + +W+F D  E++  E FE  N++K+RG LRMPP +EMS +
Sbjct: 447 PEISNWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKY 506

Query: 472 GQPHVGEYPSDHLCLLSEVEL 492
           GQPH GEYPSDHL ++ ++EL
Sbjct: 507 GQPHQGEYPSDHLSMMCKIEL 527

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/447 (63%), Positives = 344/447 (76%), Gaps = 10/447 (2%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPV--EG--LKIKIMSYNCLAQALIRRKL 109
           KR+    +G   D P EL+FI R ML +H +  +  EG  L + +M+YNCLAQALIRRKL
Sbjct: 36  KREAAALQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKL 95

Query: 110 FPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKP 169
           FPDSG ALKWYRRS+VLLN+FKHY+PDVLCLQE+D +Q+ SFW+ EF+KLGY++QFH+K 
Sbjct: 96  FPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQ 155

Query: 170 SKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKK 229
           +KNHGV ++W+ + F M+D+MLIDFD E+SGD+ PRTTTNNA L++ALKFT++  + G +
Sbjct: 156 TKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQA-LTGHR 214

Query: 230 LLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPF 289
               +SGILVGTTHLFWHPFGT+ERTRQCYVVLNKMKEFMHRVNVLQN NDG+  HW+PF
Sbjct: 215 DT-PRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF 273

Query: 290 FCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR--XXXXXXXXXXXXXX 347
           FCGDFNSQP+D+PYLSMT KP+ Y  RA+TVIECSTS+ FSK+R                
Sbjct: 274 FCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNI 333

Query: 348 XKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDN 407
             FGKDQP  PVP  F  N EQ  LV QME LHNSLDMRAVSLYSV Y  VHPEN+G DN
Sbjct: 334 EIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADN 393

Query: 408 ERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSE 467
            RGEPEISNWAHTW GLLDY+F + +W+F DRT +DTLE+FE  + + ++ LLRMP   E
Sbjct: 394 ARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQE 453

Query: 468 MS--THGQPHVGEYPSDHLCLLSEVEL 492
           M    HGQPH GEYPSDHL ++ ++EL
Sbjct: 454 MQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/440 (64%), Positives = 332/440 (75%), Gaps = 3/440 (0%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           KR++M+ RG+DPD PP+LQFI R ML L+  E   G   K+M+YNCLAQALIRRKLFP S
Sbjct: 58  KREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTS 117

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G ALKW++RSRVLLNEF HY+ DVLCLQE+DYIQYQSFWKEEF+KLGY SQFHR  +KNH
Sbjct: 118 GNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNH 177

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           G+ I+WK + F M D+MLID+D E SG +EPRTTT N  L +AL FT+KV  + K     
Sbjct: 178 GIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKV--LAKYPGSS 235

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           K GI+VGTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHR+NVLQ+      + WYPFFCGD
Sbjct: 236 KRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGD 295

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKD 353
           FNSQPFD+PYLS++ KP+ Y  RAKTVIECSTS+ FSK R               KFG  
Sbjct: 296 FNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR-DGEECDDEEGGNIEKFGDG 354

Query: 354 QPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPE 413
           QP+ PVPEKF A +EQ  LV  M  LHNSLDMR +S+YSV Y  VH EN+GLDN   EPE
Sbjct: 355 QPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPE 414

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473
           ISNWA TWRGLLDY+F I+ W+F D+   + LE F++ N IKIRGLLRMPP  EM  HGQ
Sbjct: 415 ISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQ 474

Query: 474 PHVGEYPSDHLCLLSEVELR 493
           PH GEY SDHL ++ E+EL+
Sbjct: 475 PHEGEYGSDHLSMMCELELK 494

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/435 (63%), Positives = 323/435 (74%), Gaps = 4/435 (0%)

Query: 58  MLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEAL 117
           ML RG+DP+ PP+LQFI R ML L      EG   KIM+YNCLAQALIRRKLFP SG AL
Sbjct: 62  MLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNAL 121

Query: 118 KWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCI 177
           KW++RSRVLLNEF HY  DV CLQEIDYIQYQSFWKEEF KLGY SQFHR  +KNHG+ I
Sbjct: 122 KWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAI 181

Query: 178 IWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGI 237
           +WK + F M D+ML+D+D E SG ++PRTTT N  L+LAL F++KV  + K     K GI
Sbjct: 182 VWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKV--LDKYPGTSKRGI 239

Query: 238 LVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
           LVGTTHLFWHPFGT+ERTRQCYV+LNKMK+F+HRVNVLQ+ +  +   WYPFFCGDFN+Q
Sbjct: 240 LVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQ 298

Query: 298 PFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQPQT 357
           PFD+PYLSM+ KP+ Y  RAKTVIECSTS+ FSK R               KFG  QP+ 
Sbjct: 299 PFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR-DGEECDDEEGGNIEKFGDGQPEH 357

Query: 358 PVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNW 417
           PVP+ + A  EQ +LV  M ELHNSLDMRA+S+YSVAY  VHPEN+G DN   EPEISNW
Sbjct: 358 PVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNW 417

Query: 418 AHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVG 477
           A TWRGLLDY+F I+ W F D    + L+ FE  N++KI  LLRMPP  EM  HGQPH G
Sbjct: 418 AETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEG 477

Query: 478 EYPSDHLCLLSEVEL 492
           EY SDHL L+ E+EL
Sbjct: 478 EYGSDHLSLMCEIEL 492

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/444 (60%), Positives = 336/444 (75%), Gaps = 9/444 (2%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLK----IKIMSYNCLAQALIRRKL 109
           K++ ++ +G+DP  P +L+FI+R ML +  +   +  +    I IM+YNCLAQALIRR L
Sbjct: 75  KKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTL 134

Query: 110 FPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKP 169
           FP SG A+KW++RS+VLLNEFK+Y+ DVLCLQEID +QY+SFWK EF KLGY  QFH  P
Sbjct: 135 FPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNP 194

Query: 170 SKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKK 229
           +KNHGV I WK + F+M+D+MLID+D E +G IEPRTTT N  ++L+LKF +KV    +K
Sbjct: 195 TKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVL---EK 251

Query: 230 LLDDK-SGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYP 288
             D K SGI++GTTHLFWHPFGTYERTRQCY+VL K+KEF +R+NVLQN  DGD SHW  
Sbjct: 252 YPDTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPA 311

Query: 289 FFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXX 348
           FFCGDFNSQPFD+PYLS+T KP++Y  RAKTVIECSTSF FSK R               
Sbjct: 312 FFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRDGDEGEGEEGGNIE- 370

Query: 349 KFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNE 408
           KFGK QP+TPVPE F  N+EQ +L   M+ LHN +DMRA+SLYS+AY KVHPENSGLDN+
Sbjct: 371 KFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNK 430

Query: 409 RGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEM 468
           R EPEISNWAH WRGLLDY++ + +W+  D T+ID L  FE +  +++  LLR+PP  EM
Sbjct: 431 RNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEM 490

Query: 469 STHGQPHVGEYPSDHLCLLSEVEL 492
           + HGQPH GEYPSDHLC++ ++ +
Sbjct: 491 TEHGQPHEGEYPSDHLCMIVKLGI 514

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/423 (59%), Positives = 311/423 (73%), Gaps = 7/423 (1%)

Query: 71  LQFIRRNMLKLHEEEPV-EGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNE 129
           L+FI R ML L   + V +G    +M+YNCLAQ+LIRR LFP SG ALKW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 130 FKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDR 189
           FKHY+ DVLCLQEIDY QY SFW      LGY S+FHR  +K+HGV I WK + F   D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 190 MLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPF 249
           MLI+FD+E SG+IEPR TTNN  +ILAL F+ KVK      +  KSGI+VGT+HLFWHPF
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTV--KSGIIVGTSHLFWHPF 246

Query: 250 GTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCK 309
           GTYERTRQCYV+LNKMKEF+HRV++ QN +  D++ WYPFFCGDFNSQPFD+PYLS+T K
Sbjct: 247 GTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSK 306

Query: 310 PIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQPQTPVPEKFVANDEQ 369
           P+ Y  RAKTVIECS ++KF                     G+D+P  PVPE F    E 
Sbjct: 307 PVLYSGRAKTVIECSAAYKFPD----LGAGARGANEDGGTVGEDRPVDPVPESFQPTAEV 362

Query: 370 TKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMF 429
           + LV +ME+LHNSLDMRA+SLY+VAY  VHP+N+GLDNERGEPEISNWA+TWRGLLDY+ 
Sbjct: 363 SSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIM 422

Query: 430 MIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSE 489
            I  W+  +  E+D+LE FE  ++I ++ +LRMPP  EMS+HGQPH GEYPSDHL ++ +
Sbjct: 423 YITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCK 482

Query: 490 VEL 492
           +E+
Sbjct: 483 LEV 485

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/423 (56%), Positives = 313/423 (73%), Gaps = 4/423 (0%)

Query: 70  ELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNE 129
           ++ FI+R +L  + +E  +G   ++M+YNCLAQALIRRKLFP SG ALKW++RS+VLL+E
Sbjct: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 130 FKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDR 189
            ++Y+PDV+CLQEID+ QY+SFW +  Q  GY S+FHR   KNHG+ I+W+   F   D 
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 190 MLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPF 249
            LIDFD E+SG+IE RTTT N  LI+AL++T ++K   +     +SGI+VGT+HLFWHPF
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKR--RYPGSAQSGIVVGTSHLFWHPF 260

Query: 250 GTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCK 309
           GTYER RQCY++L++MK F+ R+ +L+  + G  S W+PFFCGDFNSQPFD+PYLSM  K
Sbjct: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320

Query: 310 PIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGKDQPQTPVPEKFVANDEQ 369
           PI Y+ RA+TVIECSTS+KFS  R               KFG  QP+TPVP+ F    EQ
Sbjct: 321 PIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIE-KFGAGQPETPVPDSFDGTPEQ 379

Query: 370 TKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMF 429
             LV  M+ LHN+LDMRA+SLYS+AY  VHPEN+G+DN RGEPEISNWAH WRGLLDY+ 
Sbjct: 380 RALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIM 439

Query: 430 MIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSE 489
            +  W+F D TE+D + +F+ + ++ +R LLR+PP SEM +HGQPH GEYPSDHL L+ E
Sbjct: 440 YVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCE 499

Query: 490 VEL 492
           +EL
Sbjct: 500 LEL 502

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  464 bits (1195), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 301/456 (66%), Gaps = 31/456 (6%)

Query: 55  RQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSG 114
           R+  ++ G +PD P ELQFI+R +L LH+++PV+G  +KIM+YNCLAQ+LI+R LFP SG
Sbjct: 54  REYRMKHGFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSG 113

Query: 115 EALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHG 174
           +ALKW RRS+VLLNE K+YD D+L LQEID++Q++ +WK    KLGY  +F++K  K HG
Sbjct: 114 QALKWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHG 173

Query: 175 VCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDK 234
           V I WK   F     + IDFD   SG I+PRT T N  L++AL+F  K K   K     K
Sbjct: 174 VLIAWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK-----K 228

Query: 235 SGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDF 294
            G+++GTTHLFWH FGT+ERTRQCYV++++M +FM ++        G +  WYPFF GDF
Sbjct: 229 KGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDF 280

Query: 295 NSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKFGK-- 352
           NSQP D+PY+S+T KP+ + +  K VIECS ++K+SKKR               +     
Sbjct: 281 NSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSD 340

Query: 353 ---------------DQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHK 397
                          +QP    P  F    EQ +LVSQ+  LHNSL++RA+SLYSV Y K
Sbjct: 341 SSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRK 400

Query: 398 VHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTE-IDTLEDFENSNNIKI 456
           V PEN+ ++N+RGEPE+S WA  W GLLDY+F +++W+     E +D+L+ FE  NN+K+
Sbjct: 401 VDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKL 460

Query: 457 RGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
           RGLL+MP   EM  H  P+ GEYPSDHLC++ ++EL
Sbjct: 461 RGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  440 bits (1132), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 217/445 (48%), Positives = 293/445 (65%), Gaps = 15/445 (3%)

Query: 55  RQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEG---LKIKIMSYNCLAQALIRRKLFP 111
           R+  +++G+DPD PPELQF RR  L LH+ EP  G    +  I++YNCLAQ LI R +FP
Sbjct: 38  RESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFP 97

Query: 112 DSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSK 171
           +SG ALKW RRS+ ++NE K+Y+PD++CLQEID+   + FW  +F+ LGYS +F +K  K
Sbjct: 98  ESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKK 157

Query: 172 NHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLL 231
            HGV I W+   F+  D+  +DFD   +GDI PRT T N  LI+AL+F         +  
Sbjct: 158 IHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDNNNNNPSR-- 215

Query: 232 DDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFC 291
            +  GI+V TTHLFWHPFGT+ERTRQCY++L++M +F+  +     N    +++WYPF  
Sbjct: 216 -ESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL-----NEHSGITNWYPFLT 269

Query: 292 GDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR---XXXXXXXXXXXXXXX 348
           GDFNSQP D+PY+SMT KPI+Y    +TVIECSTS+ +SKKR                  
Sbjct: 270 GDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDE 329

Query: 349 KFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNE 408
           +F K QP  P P  F    EQ  LV+ +++LHNSL  RA+SLYSV Y  VHPENS ++N 
Sbjct: 330 EFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNT 389

Query: 409 RGEPEISNWAHTWRGLLDYMFMIRNWEFDDRT-EIDTLEDFENSNNIKIRGLLRMPPGSE 467
           RGEPE S+W   W GLLDY+F I+ W   D+  +++TLE FE +N +KI G L++P   E
Sbjct: 390 RGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKE 449

Query: 468 MSTHGQPHVGEYPSDHLCLLSEVEL 492
           M+ H QP+ GEYPSDHL L+ +++L
Sbjct: 450 MAHHSQPYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  432 bits (1110), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 215/449 (47%), Positives = 300/449 (66%), Gaps = 17/449 (3%)

Query: 54  KRQEMLERGVDPDCPPELQFIRRNMLKL--HEEEPVEGLKIKIMSYNCLAQALIRRKLFP 111
           KR++ L +G DPD P EL FI+R +L L  H     +G K  +M+YNCLAQA+IRR++F 
Sbjct: 33  KREKKLIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFS 92

Query: 112 DSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQK-LGYSSQFHRKPS 170
           DSG ALKW+RRS+VL+NE  +Y+PD+LCLQEID  QY++FWK++ +  L  ++ ++++  
Sbjct: 93  DSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKI 152

Query: 171 KNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKF-----TQKVKM 225
           K+HGV I WK   F+  D M++DFD  K+ +I  RT T N A+ +ALKF     T+    
Sbjct: 153 KHHGVLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPN 212

Query: 226 MGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSH 285
           +      +  G ++ TTHLFWHPFGT+ERTRQCY++L KMK+F+  +NV     D   +H
Sbjct: 213 LLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTH 268

Query: 286 WYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXX 345
           WYPF CGDFNS P D+PYLSMT KPI+Y  R K VIECST++KFSK+R            
Sbjct: 269 WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRR---NGEIGDSDE 325

Query: 346 XXXKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGL 405
              K   +QP+  VP+ F    EQ KLV Q++ LHN L +RA SLY +AY  V P N  +
Sbjct: 326 EEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNI 385

Query: 406 DNERGEPEISNWAHTWRGLLDYMFMIRNWEFDD-RTEI-DTLEDFENSNNIKIRGLLRMP 463
           +N+RGEPE ++WA +W G+LDY+  + NW+ ++  +EI ++LE+FE +N + I+GLL+MP
Sbjct: 386 NNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMP 445

Query: 464 PGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
              +M  H QP   EYPSDH+ +L E+E+
Sbjct: 446 LNKDMPFHTQPFEREYPSDHISILCEMEI 474

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  372 bits (955), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 269/449 (59%), Gaps = 31/449 (6%)

Query: 55  RQEMLERGVDPDCPPELQFIRRNMLKL-HEEEPVEGLKIKIMSYNCLAQALIRRKLFPDS 113
           R+E+L RG+DPD P E QFI R +L + H +    GL + IM+YNCLAQ LIRR++FP+S
Sbjct: 42  REELLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPES 101

Query: 114 GEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNH 173
           G ALKW+ RS+VLL+E KHY+ D+ CLQEID +QY  FW EE  K GY + +  + SK+H
Sbjct: 102 GPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSH 161

Query: 174 GVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDD 233
           GV I WK E F++   M I+FD E    I+PRT TNN  L++AL FT   +    ++   
Sbjct: 162 GVMIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTS 221

Query: 234 KSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
           +SG+++GT HLFWHPFGTY+RTRQC V+  K+ EF   V        GD   +   F GD
Sbjct: 222 RSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-------GD---YCKMFTGD 271

Query: 294 FNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXXXXXXXXKF--- 350
           FNSQP   PYL +T    + +++ +T IE ST++++S++R               +    
Sbjct: 272 FNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEK 331

Query: 351 -------GKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENS 403
                  G D   TP P++F + +EQ +LV+ + +  N + + A SLYS+ YH V P + 
Sbjct: 332 REYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHI 391

Query: 404 GLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMP 463
               +  EPE+S+W+  W GLLDY+F +            T   FE +NNI I G L+MP
Sbjct: 392 A---DHHEPELSSWSTKWAGLLDYIFYVNQ-------RPSTPATFETANNIAIAGYLQMP 441

Query: 464 PGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
             ++M  H QP+ GEYPSDH+ ++  +E+
Sbjct: 442 THAQMHNHSQPYTGEYPSDHISMMCALEI 470

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/456 (42%), Positives = 273/456 (59%), Gaps = 37/456 (8%)

Query: 54  KRQEMLERGVDPDCP-PELQFIRRNMLKLHEEE-----PV------EGLKIKIMSYNCLA 101
           +R  ++ +G DPD P P+LQFI R  L ++ +      P       + L +KIM+YN LA
Sbjct: 59  RRNSLISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLA 118

Query: 102 QALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGY 161
           Q LIRR  FP+SG ALKW++RS+VL++E K Y PDV+ LQE+DY +  +FW+E F KLG+
Sbjct: 119 QTLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGF 177

Query: 162 SSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGD-IEPRTTTNNAALILALKFT 220
              F R   K HG+ + W ++KF++ +  ++D+D+  +G+ I  RT T N ALI++L F 
Sbjct: 178 DVIFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF- 236

Query: 221 QKVKMMGKKLLDDKS-GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNN 279
                  K + D  S GI+V  THLFWHPFG +ER RQ Y+VL K++E    +      N
Sbjct: 237 -------KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQE----IKACSKYN 285

Query: 280 DGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXX 339
                 W+    GDFN++P + PYL++T +P+      + ++ECS ++++SKKR      
Sbjct: 286 G-----WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESD 340

Query: 340 XXXXXXXXXKFGK---DQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYH 396
                      G+   DQPQ P PE F A  E+  LV+Q+  LHNSL ++ VSLY + Y 
Sbjct: 341 QDDEECDEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYG 400

Query: 397 KVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKI 456
           KVHPEN+  +   GEP +SNWA+TW GLLDY+F I      D  + + L  FE +NN+KI
Sbjct: 401 KVHPENA--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKI 458

Query: 457 RGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
            G LRMP   EM  H QP  GEY SDH+ L+ ++ L
Sbjct: 459 IGYLRMPCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  364 bits (935), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/451 (42%), Positives = 270/451 (59%), Gaps = 35/451 (7%)

Query: 54  KRQEMLERGVDPDCP-PELQFIRRNMLKLHEE-------EPVEGLKIKIMSYNCLAQALI 105
           +R  ++ +G DPD P P+LQFI+R  L LH E            L +KIM+YN LAQ LI
Sbjct: 61  RRNSLISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLI 120

Query: 106 RRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQF 165
           RR  FP SG ALKW++RS+VL++E K Y PD++ LQE+DY + + FW+E F+KLG+   F
Sbjct: 121 RRNFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTF 179

Query: 166 HRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEP-RTTTNNAALILALKFTQKVK 224
            R   K HG+ I W   KF++ +  ++D+D+  +G+  P RT T N ALI +L+      
Sbjct: 180 KRHDGKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRL----- 234

Query: 225 MMGKKLLDDKS--GILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGD 282
               K + D S  G++V  THLFWHPFG +ER RQ Y+VL K++E    +      N   
Sbjct: 235 ----KNISDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQE----IKACPKYNG-- 284

Query: 283 MSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXX 342
              W+    GDFN++P + PYL++T KP+     A+ + ECS ++++SKKR         
Sbjct: 285 ---WHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDD 341

Query: 343 XXXXXXKFGK---DQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVH 399
                   G+   +QPQ P P+ F A  EQ  LV Q+  LHNSL +R VSLY + Y KV 
Sbjct: 342 EECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQ 401

Query: 400 PENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGL 459
           PENS   N  GEPE+SNWA++W GLLDY+F I + +     + + ++DFEN NN+++ G 
Sbjct: 402 PENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGY 459

Query: 460 LRMPPGSEMSTHGQPHVGEYPSDHLCLLSEV 490
           L+MP   EM  H QP  GEY SDH+ L+ ++
Sbjct: 460 LKMPRAKEMPKHSQPFEGEYASDHVSLMCQL 490

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  358 bits (920), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/454 (40%), Positives = 267/454 (58%), Gaps = 34/454 (7%)

Query: 54  KRQEMLERGVDPDCP-PELQFIRRNMLKLHEEE-----------PVEGLKIKIMSYNCLA 101
           +R  ++ +G DPD P P+LQFI R  L ++ E            P   L ++IM+YN LA
Sbjct: 61  RRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLA 120

Query: 102 QALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGY 161
           Q LIRR  FP SG ALKW++RS+VL++E K Y PD++ LQE+DY +   FW E F KLG+
Sbjct: 121 QTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGF 179

Query: 162 SSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGD-IEPRTTTNNAALILALKFT 220
            S F R   K HG+ + W +EKF+  +  ++D+D+  +G+ I  RT T N ALI++L   
Sbjct: 180 GSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSVK 239

Query: 221 QKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNND 280
               +         SG++V  THLFWHPFG +ER RQ ++VL K++E             
Sbjct: 240 NMTNL-------STSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEI---------KTC 283

Query: 281 GDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXX 340
                W+    GDFN++P + PY+++T +P+     A+ + ECS ++++SK R       
Sbjct: 284 PKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQ 343

Query: 341 XXX--XXXXXKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKV 398
                     +   DQPQ P P+ FVA  EQ  LV+Q+  LHNSL ++ +SLY ++Y KV
Sbjct: 344 DEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKV 403

Query: 399 HPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRG 458
           HP+NS      GEPE+SNWA+TW GLLDY+F I   +    ++ + +++FE+ NN+KI G
Sbjct: 404 HPDNS--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIG 461

Query: 459 LLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
            LRMP   EM  H QP  GEY SDH+ L+ ++ L
Sbjct: 462 YLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  357 bits (915), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/453 (40%), Positives = 267/453 (58%), Gaps = 38/453 (8%)

Query: 58  MLERGVDPDCP-PELQFIRRNMLKLHEEEPVEGLK------------IKIMSYNCLAQAL 104
           ++ +G DPD P P+LQFI R +L +  E+     K            IKIM+YN LAQ L
Sbjct: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122

Query: 105 IRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQ 164
           IRR  FP SG ALKW++RS+VL++E K Y PD++ LQE+DY + + FW+E F KLG+   
Sbjct: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181

Query: 165 FHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGD-IEPRTTTNNAALILALKFTQKV 223
           F R   K HG+ + W +EKF++ +  ++D+D   +G+ I  RT T N ALI++L+F    
Sbjct: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTR 241

Query: 224 KMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDM 283
                      +GI+V  THLFWHPFG +ER RQ Y+VL K++E            D   
Sbjct: 242 NA-------STNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPK 284

Query: 284 SH-WYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXXXXXXXX 342
            H W+    GDFN++P + PYL++T KP+      + ++ECS ++++SKKR         
Sbjct: 285 YHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDD 344

Query: 343 XXXXXXKFGK---DQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVH 399
                   G+   +QP+ P P+ F A  E+  LV+Q+  LHNSL ++ +SLY + Y KVH
Sbjct: 345 EDYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVH 404

Query: 400 PENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGL 459
           PEN+  +   GEPE+SNWA+TW GLLDY+F I + + +   +  +L  FE +N + + G 
Sbjct: 405 PENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGY 462

Query: 460 LRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492
           LRMP   EM  H QP  GEY SDH+ L+ ++ L
Sbjct: 463 LRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  354 bits (908), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/435 (41%), Positives = 276/435 (63%), Gaps = 24/435 (5%)

Query: 73  FIRRNMLKL-HEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFK 131
           FI+R +L+L + EE    + +KIM+YN L+Q+LIRR+++PD+ +A+KW+ RS+V+LNE K
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 132 HYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHR--KPSKNHGVCIIWKHEKFEMSDR 189
           +Y+ D++C QE+D IQ+  FW  E  KLGY  +F++  +  K HGV I W+   FE  D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 190 MLIDFDSEKSGDIEPRTT-TNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHP 248
           + I+FD   +G+   +TT T N  LI+ALKF    K    K    +SGI++GTTHLFWHP
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKF----KSSNAKF---RSGIVIGTTHLFWHP 225

Query: 249 FGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTC 308
           FGT+ERTRQ  ++L K ++ +  +N    + +   + W P   GDFNSQP D PYLS+T 
Sbjct: 226 FGTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITS 285

Query: 309 KPIKYDSRAKTVIECSTSFKFSKKRXXXXXXX----------XXXXXXXXKFGKDQPQTP 358
           KP+     AKTVIECST++KFS++R                         +  +  P  P
Sbjct: 286 KPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDP 345

Query: 359 VPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWA 418
            P  F A  EQ  L++++E++HNS++++A SL+ +AY KVH  + GL N + EPE+S+ +
Sbjct: 346 RPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHTS 402

Query: 419 HTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGE 478
             W GLLDY+F++  W   ++T+  +LEDFE   +++++GLL+MP   E+  + QPH G+
Sbjct: 403 IFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQ 462

Query: 479 YPSDHLCLLSEVELR 493
           YPSDHL ++ ++ +R
Sbjct: 463 YPSDHLSMICDLNVR 477

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  334 bits (857), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/439 (41%), Positives = 256/439 (58%), Gaps = 36/439 (8%)

Query: 73  FIRRNMLKLHEEEPVEG--------LKIKIMSYNCLAQALIRRKLFPDSGEALKWYRRSR 124
           FI+R +L    E P  G        +++KIM+YN LAQ LIRR  FPD+ +A+KW+RRS+
Sbjct: 43  FIKRPLL----EVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98

Query: 125 VLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKF 184
           VL+ E ++YD DV+CLQE D IQ+  FW EEF +LGY   F   P K HGV I+WK   F
Sbjct: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158

Query: 185 EMS--DRMLIDFDSEKSG-DIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGT 241
           E +  D++ +  D   +G DI   T T   AL +AL+          K       I+  T
Sbjct: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL---------KHHKTSRPIIFST 209

Query: 242 THLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDS 301
           THLFWH FGT+ERTRQ +V+L+++ +F+ +V    + +       Y FF GDFNSQP D+
Sbjct: 210 THLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDA 266

Query: 302 PYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRXXX------XXXXXXXXXXXXKFGKDQP 355
           PYLS+T KP++   RAK++IECS S+++SK+R                     +   ++P
Sbjct: 267 PYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRP 326

Query: 356 QTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSG--LDNERGEPE 413
           Q P P  + A  EQ + V  ++ LHN + ++ VSLY + YH VHPENS     +   EP+
Sbjct: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386

Query: 414 ISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQ 473
           +S+ A  W GLLDY+F+I  W  ++ T+I  L+  E    IKI G LRMP   EM  H +
Sbjct: 387 LSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445

Query: 474 PHVGEYPSDHLCLLSEVEL 492
           PH  EYPSDHL ++ ++ L
Sbjct: 446 PHENEYPSDHLAMMCDISL 464

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 111/256 (43%), Gaps = 35/256 (13%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKW-Y 120
           V+ D  P  +F        H  +        ++SYN L Q     K++  +   AL W Y
Sbjct: 370 VNTDGEPTEEFNSLQESTQHLSKETLKRSFTLLSYNTLCQHYATPKMYRYTPSWALSWDY 429

Query: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRK----------PS 170
           RR + L  +   +  DV+CLQE++   ++ FW    QK GY+  FH K            
Sbjct: 430 RRDK-LKEQIISFQADVVCLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRARTMQSKDSK 488

Query: 171 KNHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQ 221
           K  G C+ +K+ +F++  +  +DF S        +++ D   R    +N AL + L+   
Sbjct: 489 KVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALFVKLQH-- 546

Query: 222 KVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDG 281
                    L     I V TTHL W P     +T Q  V+L+ M++ +   N + NN   
Sbjct: 547 ---------LKTNEQIWVTTTHLHWDPQFNDVKTFQVGVLLDYMEKLLRDQNGVGNNQ-- 595

Query: 282 DMSHWYPFFCGDFNSQ 297
           +M       CGDFNSQ
Sbjct: 596 EMKKVPLVICGDFNSQ 611

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 102/232 (43%), Gaps = 37/232 (15%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           I+SYN L Q     K++  +   AL W  R   L  +   Y+ D++CLQE++   Y+ FW
Sbjct: 410 ILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFW 469

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               ++ GYS  FH K            K  G C  +K  +F++  +  +DF S      
Sbjct: 470 APLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHK 529

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
             +++ D   R    +N AL++ L+               KSG  +   TTHL W P   
Sbjct: 530 KFQRTEDYLNRAMNKDNVALVVKLQHI-------------KSGEHVWAATTHLHWDPQFN 576

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPY 303
             +T Q  V+L+ M++ +   N    NN  ++       CGDFNSQ   + Y
Sbjct: 577 DVKTFQVGVLLDYMEKVIKEQN--NCNNTQELKKVPVVICGDFNSQTNSAVY 626

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 100/224 (44%), Gaps = 33/224 (14%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L       K++  +   AL W  R   L  +   +D DV+CLQE++ + Y+ +W
Sbjct: 456 LLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEEYW 515

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               +K  YS  FH K            K  G  I +K ++F++  +  IDF S      
Sbjct: 516 VPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRSHK 575

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYE 253
              ++ D   R    +N ALI  LK            L+    + V TTHL W P     
Sbjct: 576 KFHRTEDYLNRAMNKDNVALIAELKH-----------LNTNENVWVVTTHLHWDPQFNDV 624

Query: 254 RTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
           +T Q  V+L+ ++  + + + + NNN  D+       CGDFNSQ
Sbjct: 625 KTFQVGVMLDYLETLIKQHHHVNNNN--DIKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 107/241 (44%), Gaps = 40/241 (16%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKW-YRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSF 151
           ++SYN L Q     K++  +   AL W YRR++ L ++   Y  D++CLQE++   ++ F
Sbjct: 437 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRAK-LRDQILSYSCDIMCLQEVEARTFEDF 495

Query: 152 WKEEFQKLGYSSQF----------HRKPSKNHGVCIIWKHEKFEMSDRMLIDFDS----- 196
           W    +K GYS  F          HR   K  G C+ +K  KF +  +  +DF S     
Sbjct: 496 WLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKH 555

Query: 197 ---EKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
              +++ D   R    +    +AL F         KL    SG  I V TTHL W P   
Sbjct: 556 EKFQRTEDFLNRAMNKDN---IALYF---------KLQHIASGEHIWVATTHLHWDPKFN 603

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPI 311
             +T Q  V+L+ ++  +      Q+N   D+       CGDFNS    + Y  ++   +
Sbjct: 604 DVKTFQVGVLLDHLQTLIR-----QDNPRQDVKKAPVIICGDFNSYIDSAVYELLSSGSV 658

Query: 312 K 312
           K
Sbjct: 659 K 659

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 79.3 bits (194), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 110/255 (43%), Gaps = 35/255 (13%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKW-Y 120
           ++ D  P+ ++        H    +      ++SYN L Q     K++  +   AL W Y
Sbjct: 470 INTDGEPQREYDSLQQSTEHLTADLAKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDY 529

Query: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKP----------S 170
           RR++ L  +   Y  DVLCLQE++   ++ +W    +K GY+  FH K            
Sbjct: 530 RRNK-LKEQILSYSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHAKARAKTMHSKDSK 588

Query: 171 KNHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQ 221
           K  G CI +K ++F+M +R  +DF          +++ D   R    +N AL L L+   
Sbjct: 589 KVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQH-- 646

Query: 222 KVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDG 281
                    +     I V TTHL W P     +T Q  V+L+ ++  +       +N+  
Sbjct: 647 ---------VSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEDTT--HNSRQ 695

Query: 282 DMSHWYPFFCGDFNS 296
           D+       CGDFNS
Sbjct: 696 DIKKSPVLICGDFNS 710

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 100/224 (44%), Gaps = 33/224 (14%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++      AL W  R   L  E   Y  DV+CLQE++   Y+ FW
Sbjct: 447 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEEFW 506

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               +K GYS  FH K            K  G CI +K+ +F    +  IDF S      
Sbjct: 507 LPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKHK 566

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYE 253
             +++ D   R    +N ALI+ LK     ++ G+        + V TTHL W P     
Sbjct: 567 KFQRTEDYLNRAMNKDNIALIVKLKH----ELSGEH-------VWVVTTHLHWDPHFNDV 615

Query: 254 RTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
           +T Q  V+L+ +++ + + + + N  +          CGDFNSQ
Sbjct: 616 KTFQVGVLLDYIEKLLKQQSNIGNPQEKKKVPL--IICGDFNSQ 657

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 100/226 (44%), Gaps = 37/226 (16%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++      AL W  R   L +E   Y  D++CLQE++   Y+ FW
Sbjct: 400 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEEFW 459

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               +K GYS  FH K            K  G CI +K+ +F    +  IDF S      
Sbjct: 460 LPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMKHK 519

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
             +++ D   R    +N ALI+             KL  +++G  + V TTHL W P   
Sbjct: 520 KFQRTEDYLNRAMNKDNVALII-------------KLRHERTGEHVWVVTTHLHWDPHFN 566

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
             +T Q  V+L+ +++ + +   + +  D          CGDFNSQ
Sbjct: 567 DVKTFQVAVMLDYIEKLLKQHGGVGSPQDKKKIPL--VICGDFNSQ 610

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 101/230 (43%), Gaps = 36/230 (15%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++  +   AL W  R   L  +  +++ D++CLQE++   ++ FW
Sbjct: 540 MLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDFW 599

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
           +   +K GY+  FH K            K  G C  +K  KF+M  +  +DF        
Sbjct: 600 QPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKHK 659

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYE 253
             +++ D   R    +N A+++ L+  Q  ++M            + TTHL W P     
Sbjct: 660 KFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEIM-----------WLVTTHLHWDPKFNDV 708

Query: 254 RTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPY 303
           +T Q  V+L+ M+  +   N  Q     D+  +    CGD NS    S Y
Sbjct: 709 KTFQVGVLLDHMETLLKEQNPKQ-----DVKKYPLVICGDLNSYLSSSVY 753

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 110/255 (43%), Gaps = 35/255 (13%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKW-Y 120
           ++ D  P+ ++        H    +      ++SYN L Q     K++  +   AL W Y
Sbjct: 508 INTDGEPQKEYDSLQQSTEHLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSWALTWDY 567

Query: 121 RRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQF---------HRKPSK 171
           RRS+ L  +   YD DVLCLQE++   ++ +W     K GY+  F         H K SK
Sbjct: 568 RRSK-LKEQILSYDSDVLCLQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTMHSKDSK 626

Query: 172 N-HGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQ 221
              G CI +K ++F++  +  +DF          +++ D   R    +N AL L L+   
Sbjct: 627 KVDGCCIFFKRDQFKLVTKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQH-- 684

Query: 222 KVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDG 281
                    +     I V TTHL W P     +T Q  V+L+ ++  +       +N+  
Sbjct: 685 ---------VSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLESLLKEDTT--HNSRQ 733

Query: 282 DMSHWYPFFCGDFNS 296
           D+       CGDFNS
Sbjct: 734 DIKKSPVLICGDFNS 748

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 96/223 (43%), Gaps = 36/223 (16%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           I+SYN L Q     K++  +   AL+W  R   L  +   Y  D+LCLQE++   Y+ FW
Sbjct: 468 ILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFW 527

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               +K GY+  FH K            K  G C+ +K  KF++  +  +DF        
Sbjct: 528 APLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQKHK 587

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYE 253
             +++ D   R    +N A+ + L+  Q  + +            V TTHL W P     
Sbjct: 588 RFQRTEDYLNRAMNKDNVAIYMKLQHVQSGEYL-----------WVVTTHLHWDPKFNDV 636

Query: 254 RTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           +T Q  V+L+ M+  +   N  Q     D+  +     GDFNS
Sbjct: 637 KTFQVGVLLDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 107/241 (44%), Gaps = 37/241 (15%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++  +   AL W  R   L  +  +Y  D++CLQE++   Y+ FW
Sbjct: 412 LLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFW 471

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               ++ GY+  FH K            K  G C+ ++  +F++  +  +DF S      
Sbjct: 472 APLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHK 531

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
             +++ D   R    +N AL++ L+               KSG  +   TTHL W P   
Sbjct: 532 KFQRTEDYLNRAMNKDNVALLVKLQHL-------------KSGEHVWAATTHLHWDPQFN 578

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPI 311
             +T Q  V+L+ M++ +   +    NN  ++       CGDFNSQ   + Y  ++   +
Sbjct: 579 DVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQVDSAVYELLSTGSV 636

Query: 312 K 312
           +
Sbjct: 637 R 637

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 94/223 (42%), Gaps = 31/223 (13%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           IMSYN L Q     K++  +   AL W  R + L  E   Y  D++CLQE++   Y+  W
Sbjct: 526 IMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEEHW 585

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
                K GYS  FH K            K  G C+ +K  +F++  +  +DF S      
Sbjct: 586 APLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMKHK 645

Query: 197 --EKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYER 254
             +++ D   R   N   +++ +K            L     + + TTHL W P     +
Sbjct: 646 KFQRTEDYLNR-AMNKDNVVIYIKLNH---------LKSGESVWIATTHLHWDPQFNDVK 695

Query: 255 TRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297
           T Q  ++++ ++E +       +  D   S      CGDFNSQ
Sbjct: 696 TFQVGILMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQ 736

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 99/224 (44%), Gaps = 35/224 (15%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKW-YRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSF 151
           ++SYN L Q     K++  +   AL W YRR++ L  +   YD D+LCLQE++   ++ +
Sbjct: 507 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNK-LKEQILSYDSDLLCLQEVESKTFEEY 565

Query: 152 WKEEFQKLGYSSQFHRKP----------SKNHGVCIIWKHEKFEMSDRMLIDFDS----- 196
           W     K GY+  FH K            K  G CI +K ++F++  +  +DF       
Sbjct: 566 WVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKH 625

Query: 197 ---EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTY 252
              +++ D   R    +N AL L L+            +     I   TTHL W P    
Sbjct: 626 KKFQRTEDYLNRAMNKDNVALFLKLQH-----------IPSGDTIWAVTTHLHWDPKFND 674

Query: 253 ERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
            +T Q  V+L+ ++  +       +N   D+  +    CGDFNS
Sbjct: 675 VKTFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 94/223 (42%), Gaps = 33/223 (14%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++  +   AL W  R   L  +   YD D+LCLQE++   ++ +W
Sbjct: 509 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYW 568

Query: 153 KEEFQKLGYSSQFHRKP----------SKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
                K GY+  FH K            K  G CI +K ++F++  +  +DF        
Sbjct: 569 VPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHK 628

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYE 253
             +++ D   R    +N AL L L+            +     I   TTHL W P     
Sbjct: 629 KFQRTEDYLNRAMNKDNVALFLKLQH-----------IPSGDTIWAVTTHLHWDPKFNDV 677

Query: 254 RTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           +T Q  V+L+ ++  +       +N   D+       CGDFNS
Sbjct: 678 KTFQVGVLLDHLETLLREETT--HNFRQDIKKSPVLICGDFNS 718

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 102/254 (40%), Gaps = 36/254 (14%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKWYR 121
           ++ D  P  ++    +   +    +E     I+SYN L Q     K++  +   AL W  
Sbjct: 540 INADGEPTRKYDSLQLASANINPDLEKKSFTILSYNTLCQHYATPKMYRYTPSWALSWDY 599

Query: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFH----------RKPSK 171
           R   L  +   Y  D+LCLQE++   ++ FW    +K  Y   FH          ++  K
Sbjct: 600 RREKLKEQILSYQSDILCLQEVESKTFEEFWGPLLEKYDYQGVFHIKTRAKTMQTKESKK 659

Query: 172 NHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQK 222
             G CI +K  KF++  +  +DF          +++ D   R    +N AL + L+    
Sbjct: 660 VDGCCIFFKKSKFKLLAKEAMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYMKLQS--- 716

Query: 223 VKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGD 282
                   +     + V TTHL W P     +T Q  ++L+ M+  +   N  Q     D
Sbjct: 717 --------ITSGETVWVVTTHLHWDPKFNDVKTFQVGILLDHMETLLKEENPKQ-----D 763

Query: 283 MSHWYPFFCGDFNS 296
           +       CGD NS
Sbjct: 764 VKKANVVICGDLNS 777

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 109/270 (40%), Gaps = 33/270 (12%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKWYR 121
           ++ D  P+ +F    +   H    +      ++SYN L Q     K++  +    L W  
Sbjct: 511 INADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDT 570

Query: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRK----------PSK 171
           R   L N+      DV+CLQE++   Y+ FW    QK GY   FH K            K
Sbjct: 571 RREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKK 630

Query: 172 NHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQK 222
             G CI +K  +F++  +  +DF          +++ D   R    +N AL + L+    
Sbjct: 631 VDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLEH--- 687

Query: 223 VKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGD 282
                   ++    + V TTHL W P     +T Q  V+L+ ++  +   N    ++  +
Sbjct: 688 --------INSGESVWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYN--NASSKQE 737

Query: 283 MSHWYPFFCGDFNSQPFDSPYLSMTCKPIK 312
           +       CGD NS    + Y  ++   +K
Sbjct: 738 IRKCPVIICGDLNSHLQSAVYELLSTGHVK 767

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 106/256 (41%), Gaps = 37/256 (14%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKWYR 121
           ++ D  P+ ++        H    +E     ++SYN L Q     K++  +   AL W  
Sbjct: 535 INTDGEPQTEYDSIEDATSHLSRDLEKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWEY 594

Query: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRK----------PSK 171
           R   L ++   +  D+LCLQE++   Y  FW+   QK GY   FH K            K
Sbjct: 595 RRDKLKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDSKK 654

Query: 172 NHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQK 222
             G CI +K  +F++  +  +DF          +++ D   R    +N A+ + L+    
Sbjct: 655 VDGCCIFYKESEFKVLFKEAVDFSGIWMKHKNFQRTEDYLNRAMNKDNVAIYMKLQHI-- 712

Query: 223 VKMMGKKLLDDKSGIL--VGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNND 280
                      KSG +  + TTHL W P     +T Q  V+L+ ++  +   + + +   
Sbjct: 713 -----------KSGEVTWIVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHSKQ- 760

Query: 281 GDMSHWYPFFCGDFNS 296
            D+       CGD NS
Sbjct: 761 -DVKKCPIIICGDLNS 775

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 100/229 (43%), Gaps = 45/229 (19%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++  +   AL W  R   L ++   +  DV+CLQE++   Y+ FW
Sbjct: 454 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEEFW 513

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               QK GY+  F+ K            K  G CI +K  +F +  +  +DF        
Sbjct: 514 LPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHK 573

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
             +++ D   R    +N AL + L+               KSG  + V TTHL W P   
Sbjct: 574 KFQRTEDYLNRAMNKDNVALYMKLEHI-------------KSGESVWVVTTHLHWDPQFN 620

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDG----DMSHWYPFFCGDFNS 296
             +T Q  ++L+ ++E      +L++NN+     ++       CGD NS
Sbjct: 621 DVKTFQVGILLDHLEE------LLKDNNNASSKQEIRKCPVIICGDLNS 663

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 99/232 (42%), Gaps = 37/232 (15%)

Query: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152
           ++SYN L Q     K++  +   AL W  R   L  +   Y  DV+CLQE++   ++ +W
Sbjct: 466 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYW 525

Query: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196
               QK GYS  FH K            K  G C+ ++  +F+++ +  +DF        
Sbjct: 526 APLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQKHK 585

Query: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251
             +++ D   R    +N A+ L L+               KSG  + + TTHL W P   
Sbjct: 586 KFQRTEDYLNRAMNKDNVAIYLKLQHI-------------KSGESVWIVTTHLHWDPQFN 632

Query: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDSPY 303
             +T Q  V+++ ++  +   +  Q+  +          CGD NS+   + Y
Sbjct: 633 DVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPV--ILCGDLNSEIHSAVY 682

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 105/259 (40%), Gaps = 37/259 (14%)

Query: 63  VDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGE-ALKWYR 121
           +D +  P  ++    +   +    +E     ++SYN L Q     K++  +   AL W  
Sbjct: 497 IDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYATPKMYRYTPSWALSWDY 556

Query: 122 RSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRK----------PSK 171
           R   L ++   Y  D+LCLQE++   ++ FW    +K  Y   FH K            K
Sbjct: 557 RREKLKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIFHIKTRAKTMQSKDSKK 616

Query: 172 NHGVCIIWKHEKFEMSDRMLIDFDS--------EKSGDIEPRTTT-NNAALILALKFTQK 222
             G CI +K  KF++  +  +DF          +++ D   R    +N AL L L+    
Sbjct: 617 VDGCCIFFKKSKFKLLFKEAMDFSGTWMKHKKFQRTEDYLNRAMNKDNVALYLKLQS--- 673

Query: 223 VKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGD 282
                   L     + V TTHL W P     +T Q  ++L+ M+  +   N  Q     D
Sbjct: 674 --------LTSGESVWVVTTHLHWDPKFNDVKTFQVGILLDHMEALLKEENPKQ-----D 720

Query: 283 MSHWYPFFCGDFNSQPFDS 301
           +       CGD NS  FDS
Sbjct: 721 VKKANVVICGDLNSY-FDS 738

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 116/260 (44%), Gaps = 42/260 (16%)

Query: 72  QFIRRNMLKLHEEEPVEGLK----IKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVL 126
           + I R +L ++      G +      +++YN L+   +  +++    E  K W  R ++L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 127 LNEFKH-YDPDVLCLQEIDYIQYQSFWKEEFQ-KLGYSSQFHRKPSKNH---------GV 175
             E  H Y  D+LCLQE+    Y+ FW+++ + ++ + SQ+ +KP   +         GV
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 176 CIIWKHEKFE--------MSDRMLIDFDSEK----SGDIEPRTTTNNAALILALK--FTQ 221
              +  +KFE        +SD + +   +EK       +E    T +     +LK   TQ
Sbjct: 138 GTFYNADKFEHVATDLEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQ 197

Query: 222 KVKM-MGKKLLDDKSGIL--VGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQ 276
           + ++ +   LL   +G L  V  T L+W     Y+  +  QC++++ ++K  + R   L 
Sbjct: 198 RNQVCLFVTLLHKPTGSLFVVVNTQLYWK----YDEVKLAQCFIIMRRLKAIVKR---LL 250

Query: 277 NNNDGDMSHWYPFFCGDFNS 296
              D   S+      GD NS
Sbjct: 251 TRKDTSYSNIKVLLSGDLNS 270

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 107/244 (43%), Gaps = 48/244 (19%)

Query: 95  MSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEFKH-YDPDVLCLQEIDYIQYQSFW 152
           M+YN L+   +  +++    E  K W  R R+L  E  + Y  D++C+QE+    Y  FW
Sbjct: 37  MTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYDGFW 96

Query: 153 KEEFQ-KLGYSSQF---------HRKPSKNHGVCIIWKHEKFE--------MSDRM---- 190
           K  F+ K+ Y S F          R P +  GV I +  +KFE        ++D +    
Sbjct: 97  KGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIGLFN 156

Query: 191 LIDFDSEKSGDIEPRTTTNNA-------ALILALKFTQKVKMMGKKL-LDDKSGILVGTT 242
           + + +  KS  I   T TN A       +L+  L    +V +    +  + ++  +V  T
Sbjct: 157 ISELNYLKSTII---TLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 243 HLFWHPFGTYERTR--QCYVVLNKMKEFMHRV--NVLQNNNDGDMSHWYPFFCGDFNSQP 298
           HL+W     Y+  +  QC  ++ K    +HRV  ++L        S     F GD NS P
Sbjct: 214 HLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGREGVTYSKVKILFAGDLNSAP 265

Query: 299 FDSP 302
            DSP
Sbjct: 266 -DSP 268

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 96/214 (44%), Gaps = 39/214 (18%)

Query: 92  IKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNE-FKHYDPDVLCLQEIDYIQYQ 149
           + +++YN L+   +  +++    +  K W  R ++L  E F  +  D+LCLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 150 SFWKEEFQ-KLGYSSQFHRKPSKNH---------GVCIIWKHEKFEMSDRMLI---DFDS 196
            FW+++ + +L Y S F  KP   +         GV   +  EK E     +I   DF S
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 197 ----------------EKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVG 240
                           + +G  +P TT   + L + L   Q    +  +  D KS I+V 
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTT--RSLLSILLDRNQVCLFVCLREKDTKSLIVVV 207

Query: 241 TTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRV 272
            THL+W     Y+  +  QC  ++ K+K+ ++++
Sbjct: 208 NTHLYWK----YDEVKLSQCLTIMRKLKQVINKL 237

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 48/247 (19%)

Query: 94  IMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEFKH-YDPDVLCLQEIDYIQYQSF 151
           +M+YN L+   +  +++    E  K W  R R+L  E  + Y  D++C+QE+    Y+ F
Sbjct: 32  LMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYEGF 91

Query: 152 WKEEFQ-KLGYSSQFHRKPSKNH---------GVCIIWKHEKFE--------MSDRM--- 190
           WK  F+ K+ Y S +  K    +         GV I +   KFE        ++D +   
Sbjct: 92  WKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIGLF 151

Query: 191 -LIDFDSEKSGDIEPRTTTNNA-------ALILALKFTQKVKMMGKKL-LDDKSGILVGT 241
            + + +  KS  I   T TN A       +L+  L    +V +    L  + ++  +V  
Sbjct: 152 NISELNYLKSTII---TLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVN 208

Query: 242 THLFWHPFGTYERTR--QCYVVLNKMKEFMHRV--NVLQNNNDGDMSHWYPFFCGDFNSQ 297
           THL+W     Y+  +  QC  ++ K    +HRV  ++L        S     F GD NS 
Sbjct: 209 THLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGMEGVTYSKVKILFAGDLNSA 260

Query: 298 PFDSPYL 304
           P DSP +
Sbjct: 261 P-DSPVI 266

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 37/237 (15%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNE-FKHYDPDVLCLQEIDYIQY 148
           +  +++YN L+   +  +++    +  K W  R R+L +E F  Y  D++CLQE+    Y
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 149 QSFWKEE-FQKLGYSSQFHRKPSKNH---------GVCIIWKHEKFE--MSDRMLID--- 193
             FWK++   ++ Y S F  K    +         GV I +  +KFE   S  + ++   
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 194 --FDSEKSGDIEPR--TTTNNAALIL--------ALKFTQKVKMMGKKLLDDKSGILVGT 241
             FD ++   +     T TN A  ++        A    Q    +  +  + KS I+V  
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVIN 212

Query: 242 THLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           THL+W     Y+  +  QC +++ K++  +    +L        S+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 108/235 (45%), Gaps = 39/235 (16%)

Query: 94  IMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEF-KHYDPDVLCLQEIDYIQYQSF 151
           ++SYN L+ + +  +++    E  K W  R ++L  E    Y  D++CLQE+    Y +F
Sbjct: 24  LLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSNF 83

Query: 152 WKEEFQ-KLGYSS--------QFHRKPSKN-HGVCIIWKHEKFEMSDR-------MLIDF 194
           WK+  Q  + Y S        Q+ ++P +   GV I +  +KFE   R       +L  F
Sbjct: 84  WKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLGVF 143

Query: 195 DSEKSGDIE--PRTTTNNA-------ALILALKFTQKVKM-MGKKLLDDKSGILVGTTHL 244
            + +   +E  P T T+ A       +L+  LK   +V + +  K  +  +  +V  THL
Sbjct: 144 SNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINTHL 203

Query: 245 FWHPFGTYERTR--QCYVVLNKMKEFMHRVNV-LQNNNDGDMSHWYPFFCGDFNS 296
           +W     Y+  +  QC +++ ++   + +  V L+N  D  +      F GD NS
Sbjct: 204 YW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 104/244 (42%), Gaps = 37/244 (15%)

Query: 85  EPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNE-FKHYDPDVLCLQE 142
           +P    K  +++YN L+   +  +++    E  K W  R R+L +E FK Y  D++CLQE
Sbjct: 23  KPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQE 82

Query: 143 IDYIQYQSFWKEEFQK-LGYSSQFHRKPSKNH---------GVCIIWKHEKFE------- 185
           +    Y +FW ++ ++ L Y S F  K    +         GV I +  +KFE       
Sbjct: 83  LTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI 142

Query: 186 -MSDRMLIDFDSEKSGDIEPRTTTNNAA--------LILALKFTQKVKM-MGKKLLDDKS 235
            ++D + I    E     E   T  N A        L+  L+   +V + +  +  D  +
Sbjct: 143 YLNDVLGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNT 202

Query: 236 GILVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGD 293
             +V  THL+W     Y+  +  QC  ++ K++  +   ++L        S     F GD
Sbjct: 203 VFVVINTHLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFSGD 256

Query: 294 FNSQ 297
            NS 
Sbjct: 257 LNSN 260

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 107/241 (44%), Gaps = 38/241 (15%)

Query: 87  VEGLKIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEF-KHYDPDVLCLQEID 144
           + G K  +++YN L+   +  +++    +  K W  R  +L +E  + Y  DV+CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 145 YIQYQSFWKEEFQK-LGYSSQFHRKPSKNH---------GVCIIWKHEKFEM--SDRMLI 192
           +  Y S+WK  F K L Y S+F  K    +         G  I +  +KFE   S R+ +
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 193 D-----FDSEKSGDIEPRTT--TNNAA-------LILALKFTQKVKM-MGKKLLDDKSGI 237
           +     F+  +   ++ +    T+ A        L   LK   +V + +  K  +  +  
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNVF 211

Query: 238 LVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFN 295
           +V  THL+W     Y+  +  QC +++ K+ +    +N L    D  +S    F  GD N
Sbjct: 212 VVINTHLYWK----YDEVKLTQCMIIMRKLSQI---INELLIGADPSLSKDVIFITGDLN 264

Query: 296 S 296
           S
Sbjct: 265 S 265

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 98/238 (41%), Gaps = 36/238 (15%)

Query: 95  MSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNE-FKHYDPDVLCLQEIDYIQYQSFW 152
           +SYN L+   +  +++    +  K W  R  +L  E    Y  D++C+QE+  I Y SFW
Sbjct: 47  LSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELTTIDYYSFW 106

Query: 153 KEEFQK-LGYSSQFHRKPSKNH---------GVCIIWKHEKFE--------------MSD 188
           ++  +K   Y S+F  K   N+         GV I +  + F+                D
Sbjct: 107 RDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINLNDLASTFD 166

Query: 189 RMLIDFDSEKSGDI---EPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLF 245
           R  +D+ + K   I       T   +   LAL   Q    +  +    K   ++  THL+
Sbjct: 167 RKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVEHKISKDVFVIINTHLY 226

Query: 246 WHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQPFDS 301
           W     YE  +  QC +++ K+ + ++ +     + D + +     F GD N   FDS
Sbjct: 227 W----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMNYNKVKILFSGDLNDG-FDS 279

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 100/240 (41%), Gaps = 43/240 (17%)

Query: 91  KIKIMSYNCLAQALIRRKLF---PDSGEALKWYRRSRVLLNE-FKHYDPDVLCLQEIDYI 146
           K+ +++YN L+   +  +++   PD  E  KW  R ++L  E    Y  D++CLQE+  +
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPD--EYKKWNYRHKLLQKEILGLYRADIMCLQELTSL 78

Query: 147 QYQSFW-KEEFQKLGYSSQFHRKP---------SKNHGVCIIWKHEKFEMSDRMLIDFDS 196
            YQ +W K   +K  Y S++  KP         S+  GV + +   KF+      I + +
Sbjct: 79  DYQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGI-YLN 137

Query: 197 EKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG------------------IL 238
           +  G  + +        +L L   Q   M    L D   G                  ++
Sbjct: 138 DLFGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTFLI 197

Query: 239 VGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           V  THL+W     Y+  +  QC +++ ++ + +   ++L    D   +     F GD NS
Sbjct: 198 VINTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKIIFAGDMNS 251

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 102/239 (42%), Gaps = 41/239 (17%)

Query: 91  KIKIMSYNCLAQALIRRKLF---PDSGEALKWYRRSRVLLNE-FKHYDPDVLCLQEIDYI 146
           K   M+YN L+   +  +++   PD  E   W  R ++L  E    Y  D++CLQE+   
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPD--EYKDWNYRHKLLEKEILNSYRADIMCLQELTAS 85

Query: 147 QYQSFWKEEFQK-LGYSSQFHRKPSKNH---------GVCIIWKHEKFEMS-------DR 189
            Y  +W+E   +   Y S+F  KP   +         GV I +   KF+         + 
Sbjct: 86  DYHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLND 145

Query: 190 MLIDFDSEKSGDIEPRTT--TNNAA-------LILALKFTQKVKM-MGKKLLDDKSGILV 239
           ++  FD ++   ++ +    T+ A        L+  LK   +V + +  K  D  +  +V
Sbjct: 146 LIGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTIFVV 205

Query: 240 GTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
             THL+W     Y+  +  QC +++ K+ + +   ++L   +    +     F GD NS
Sbjct: 206 INTHLYW----KYDEVKLTQCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVVFAGDLNS 258

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 99/241 (41%), Gaps = 45/241 (18%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEF-KHYDPDVLCLQEIDYIQY 148
           +  +++YN L+ A +  +++    E  K W  R  +L  E    Y  D++C+QE+    Y
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 149 QSFWK----------EEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMS-------DRML 191
           Q FW            EF        + R+P +  GV I +  + F+         ++ML
Sbjct: 98  QQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQML 157

Query: 192 IDFDSEK------------SGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGI-- 237
             F+  +             G   P   TN   L+  LK   +V +    L    +G+  
Sbjct: 158 DAFNDHELEYLGQKKLGLTDGAGNPTGETN---LLNFLKLKNQVSLF-VSLQHKSTGMYF 213

Query: 238 LVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFN 295
           +V  THL+W     Y+  +  QC V++ ++ + +   ++L++  D         F GD N
Sbjct: 214 VVINTHLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLN 267

Query: 296 S 296
           S
Sbjct: 268 S 268

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 100/241 (41%), Gaps = 39/241 (16%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEF-KHYDPDVLCLQEIDYIQY 148
           K  +++YN L+   +  +++    +  K W  R ++L  E  + Y  D++CLQE+ +  Y
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 149 QSFWKEEF-QKLGYSSQFHRKPSKNH---------GVCIIWKHEKFEM--SDRML----- 191
            S+WK +  +K+ Y S+F  K    +         G  I +  EKFE   S ++      
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 192 -------IDFDSEKS---GDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGT 241
                  I++  +K     D   + T  N    +A    Q    +  +     +  +V  
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVIN 226

Query: 242 THLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYP----FFCGDFN 295
           THL+W     Y+  +  QC +++ K+   ++ + +  N    D S         F GD N
Sbjct: 227 THLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDLN 282

Query: 296 S 296
           S
Sbjct: 283 S 283

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 40/234 (17%)

Query: 94  IMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNE-FKHYDPDVLCLQEIDYIQYQSF 151
           +++YN L+Q+ +  +++       K W  R ++L  E  K Y+ D++CLQE+    Y+ +
Sbjct: 24  LLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEYY 83

Query: 152 WKEEFQKLGYSSQFHRKPSKNH---------GVCIIWKHEKFEMSDRMLIDFDSEKSGDI 202
           W+++  K    S F  K    +         GV I +  + FE+ D   I        D 
Sbjct: 84  WRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLISDF 143

Query: 203 EPRTTTNNAALILALKFTQKVKMMGKKLLD---DKSGILVGTT---------------HL 244
           E       A+  L L   +  ++    +LD   +K+ + +  T               HL
Sbjct: 144 EQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVTTHL 203

Query: 245 FWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           +W     Y+  +  QC +++ ++ + M      Q   DG  S     F GD NS
Sbjct: 204 YWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 103/238 (43%), Gaps = 42/238 (17%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-W-YRRSRVLLNEFKHYDPDVLCLQEIDYIQY 148
           K  ++SYN L+ + +  +++    +  K W YR + + L     Y  D++C+QE+    Y
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 149 QSFWKEEF-QKLGYSSQFHRKPSKNH---------GVCIIWKHEKFEMS-------DRML 191
             +W+ +    +GY S+F  K    +         GV I +  +KF+         +  L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 192 IDFDSEKSGDIEPRT--TTNNAAL---------ILALKFTQKVKMMGKKLLDDKSGILVG 240
             F+ E+   ++ +T   T+ A +         IL++K  Q    +  K  +     ++ 
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVK-NQVSLFVCLKHKETGQVFIII 207

Query: 241 TTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
            THL+W     Y+  +  QC +++ ++ + +    +LQ   D   S     F GD NS
Sbjct: 208 NTHLYWK----YDEVKLSQCIIIMRELSKIIDE--LLQ---DVRHSKVKIIFAGDLNS 256

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 22/133 (16%)

Query: 69  PELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVL- 126
           P +Q  ++N+ K   ++     +  +++YN L+ + +  +++    E  K W  R R+L 
Sbjct: 8   PVVQSTKQNIGKYVRKDA----RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLE 63

Query: 127 ---LNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ-KLGYSSQF--------HRKPSKN-H 173
              LN FK    D++CLQE+    Y+ +W +     + Y S+F         +KP K+  
Sbjct: 64  KELLNTFK---ADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMD 120

Query: 174 GVCIIWKHEKFEM 186
           GV I +   KF+ 
Sbjct: 121 GVSIFYNLAKFDF 133

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 106/240 (44%), Gaps = 44/240 (18%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVL----LNEFKHYDPDVLCLQEIDY 145
           +  +++YN L+ + +  +++    E  K W  R ++L    LN FK    D++CLQE+  
Sbjct: 26  RFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQEMTA 82

Query: 146 IQYQSFWKEEFQ-KLGYSSQF--------HRKPSKN-HGVCIIWKHEKFEMS-------D 188
             Y+ +W++     + Y S+F         + P K+  GV I +  EKF+         +
Sbjct: 83  RDYEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLN 142

Query: 189 RMLIDFDSEKSGDI--EPRTTTNNAALILA-------LKFTQKVKM-MGKKLLDDKSGIL 238
           ++L  F+  +   +  +  T T+ A+ I+        LK   +V + +  K  +  +  +
Sbjct: 143 QLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTVFV 202

Query: 239 VGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296
           V  THL+W     Y+  +  QC ++   M+E    +  L + +          F GD NS
Sbjct: 203 VLNTHLYWK----YDEVKLTQCMII---MRELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 112/259 (43%), Gaps = 42/259 (16%)

Query: 69  PELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLL 127
           P +Q  ++N+ K   ++     +  +++YN L+ + +  +++    E  K W  R ++L 
Sbjct: 8   PVVQSTKQNIGKYVRKDA----RFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLE 63

Query: 128 NEF-KHYDPDVLCLQEIDYIQYQSFWKEEFQ-KLGYSSQF--------HRKPSKN-HGVC 176
            E    +  D++CLQE+    Y+++W       + Y S+F          KP K+  GV 
Sbjct: 64  KELLTTFKADIMCLQEMTTRDYENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVS 123

Query: 177 IIWKHEKFEMS-------DRMLIDFDSEKSGDIEPR--TTTNNA-------ALILALKFT 220
           I +  EKF+         +++L  F+  +   +  +  T T+ A       +L+  LK  
Sbjct: 124 IFYNLEKFDYISSSGIYLNQLLNVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGK 183

Query: 221 QKVKM-MGKKLLDDKSGILVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQN 277
            +V + +  K  +  +  +V  THL+W     Y+  +  QC ++   M+E    +  L  
Sbjct: 184 NQVCLFVSLKHKETNTIFVVLNTHLYWK----YDEVKLTQCMII---MRELSKIIKQLLP 236

Query: 278 NNDGDMSHWYPFFCGDFNS 296
            +          F GD NS
Sbjct: 237 GDANAQEKVKILFTGDLNS 255

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 96/245 (39%), Gaps = 55/245 (22%)

Query: 91  KIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVLLNEF-KHYDPDVLCLQEIDYIQY 148
           K  +++YN L+ + +  +++    +  K W  R ++L +E    Y  D++CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 149 QSFWKEEF-QKLGYSSQF---------HRKPSKNHGVCIIWKHEKFEMS-------DRML 191
              WK      +GY S+F          R+  +  GV I +  +KF+         ++ L
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 192 IDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG--------------- 236
             F S +   +  +         L L     V +  K LLD  SG               
Sbjct: 149 NVFSSTELEYLHSKR--------LVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKET 200

Query: 237 ---ILVGTTHLFWHPFGTYERTR--QCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFC 291
               +V  THL+W     Y+  +  QC ++   M+E    ++ L    D D       F 
Sbjct: 201 GEMFVVINTHLYWK----YDEVKLTQCMII---MRELSKIIDELVKGVD-DPGKVKILFT 252

Query: 292 GDFNS 296
           GD NS
Sbjct: 253 GDLNS 257

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 62/133 (46%), Gaps = 22/133 (16%)

Query: 69  PELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEALK-WYRRSRVL- 126
           P +Q  ++N+ K   ++     +  +++YN L+ + +  +++    E  K W  R ++L 
Sbjct: 8   PVVQSTKQNIGKYVRKDA----RFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLE 63

Query: 127 ---LNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ-KLGYSSQFHRKPSKNH--------- 173
              LN FK    D++CLQE+    Y+ +W +     + Y S+F  K    +         
Sbjct: 64  KELLNSFK---ADIMCLQEMTRRDYEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMD 120

Query: 174 GVCIIWKHEKFEM 186
           GV I +  +KF+ 
Sbjct: 121 GVSIFYNLDKFDF 133

>Suva_14.76 Chr14 (135508..138708) [3201 bp, 1066 aa] {ON} YNL267W
           (REAL)
          Length = 1066

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 64/156 (41%), Gaps = 33/156 (21%)

Query: 173 HGVCIIWKHEKFEM-SDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLL 231
             +  IW  EK ++   RM I   S  +G +E   T  NA  + ++K     KM+    L
Sbjct: 812 QAMANIWVREKVDVWVKRMKILITSANTGLVE---TITNAISVHSIKKALTKKMIEDAEL 868

Query: 232 DDKSGILVGTTHLFWHPFGT-----YERTRQ------------CYVVLNKMKEFMHRVNV 274
           DDK GI     H F   FG      Y+R +             CY++  K +   H  N+
Sbjct: 869 DDKGGIASLNDH-FLRAFGNPNGFKYKRAQDNFACSLAAYSIICYLLQVKDR---HNGNI 924

Query: 275 LQNNNDGDMSHW-YPFFCGD------FNSQPFDSPY 303
           +  +N+G +SH  + F   +      F + PF   Y
Sbjct: 925 MI-DNEGHVSHIDFGFMLSNSPGSVGFEASPFKLTY 959

>Skud_14.72 Chr14 (129617..132817) [3201 bp, 1066 aa] {ON} YNL267W
           (REAL)
          Length = 1066

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 63/151 (41%), Gaps = 33/151 (21%)

Query: 178 IWKHEKFEM-SDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG 236
           IW  EK ++   RM I   S  +G +E   T  NA  + ++K     KM+    LDDK G
Sbjct: 817 IWVKEKVDVWVKRMKILITSANTGLVE---TITNAMSVHSIKKALTKKMIEDAELDDKGG 873

Query: 237 ILVGTTHLFWHPFGT-----YERTRQ------------CYVVLNKMKEFMHRVNVLQNNN 279
           I     H F   FG      Y+R +             CY++  K +   H  N++  +N
Sbjct: 874 IASLNDH-FLRAFGNPNGFKYKRAQDNFACSLAAYSVICYLLQVKDR---HNGNIMI-DN 928

Query: 280 DGDMSHW-YPFFCGD------FNSQPFDSPY 303
           +G +SH  + F   +      F + PF   Y
Sbjct: 929 EGHVSHIDFGFMLSNSPGSVGFEAAPFKLTY 959

>YNL267W Chr14 (140878..144078) [3201 bp, 1066 aa] {ON}
           PIK1Phosphatidylinositol 4-kinase; catalyzes first step
           in the biosynthesis of
           phosphatidylinositol-4,5-biphosphate; may control
           cytokinesis through the actin cytoskeleton
          Length = 1066

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 63/155 (40%), Gaps = 31/155 (20%)

Query: 173 HGVCIIWKHEKFEM-SDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLL 231
             +  IW  EK ++   RM I   S  +G +E   T  NA  + ++K     KM+    L
Sbjct: 812 QAMANIWVKEKVDVWVKRMKILITSANTGLVE---TITNAMSVHSIKKALTKKMIEDAEL 868

Query: 232 DDKSGILVGTTHL---FWHPFGTYERTRQ-------------CYVVLNKMKEFMHRVNVL 275
           DDK GI     H    F +P G   R  Q             CY++  K +   H  N++
Sbjct: 869 DDKGGIASLNDHFLRAFGNPNGFKYRRAQDNFASSLAAYSVICYLLQVKDR---HNGNIM 925

Query: 276 QNNNDGDMSHW-YPFFCGD------FNSQPFDSPY 303
             +N+G +SH  + F   +      F + PF   Y
Sbjct: 926 I-DNEGHVSHIDFGFMLSNSPGSVGFEAAPFKLTY 959

>YPL249C Chr16 complement(76669..79353) [2685 bp, 894 aa] {ON}
           GYP5GTPase-activating protein (GAP) for yeast Rab family
           members; involved in ER to Golgi trafficking; exhibits
           GAP activity toward Ypt1p that is stimulated by Gyl1p,
           also acts on Sec4p; interacts with Gyl1p, Rvs161p and
           Rvs167p; involved in recruiting Rvs167p to the bud tip
           during polarized growth
          Length = 894

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 8/94 (8%)

Query: 57  EMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKL----FPD 112
           E LE  V    PP+++ I   ++   +   +E +   ++   CL +A IRR L    F  
Sbjct: 442 ENLEAHVTNGIPPQIRGIIWQLMANSKSREMEDIYETLLDTECLHEATIRRDLRRTKFVA 501

Query: 113 SGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYI 146
             +    Y+  +V    +  YDPDV   Q + +I
Sbjct: 502 EDKMESLYKVIKV----YSVYDPDVGYTQGMGFI 531

>Smik_6.453 Chr6 (744924..747725) [2802 bp, 933 aa] {ON} YPL249C
           (REAL)
          Length = 933

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%)

Query: 57  EMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEA 116
           E LE  V    PP+++ I   ++   +   +E +   ++   CL +A IRR L      A
Sbjct: 481 EKLEAHVTDGIPPQIRGIIWQLMANSKSREMEDIYETLLDTECLHEATIRRDLRRTKFVA 540

Query: 117 LKWYRRSRVLLNEFKHYDPDVLCLQEIDYI 146
                    ++  +  YDPDV   Q + +I
Sbjct: 541 EDKMESLFKIIKVYSVYDPDVGYTQGMGFI 570

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,153,201
Number of extensions: 2290300
Number of successful extensions: 5630
Number of sequences better than 10.0: 77
Number of HSP's gapped: 5613
Number of HSP's successfully gapped: 78
Length of query: 493
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 379
Effective length of database: 40,409,475
Effective search space: 15315191025
Effective search space used: 15315191025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)