Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I01276g5.423ON38038019730.0
Smik_8.1905.423ON42035715230.0
NDAI0B055905.423ON38035615140.0
Skud_8.1735.423ON37835715100.0
YHR112C5.423ON37835715050.0
Suva_15.3085.423ON37835714990.0
NCAS0F032905.423ON40435515010.0
KAFR0E038605.423ON37835614850.0
TBLA0A036805.423ON38435714270.0
SAKL0G02222g5.423ON37835514080.0
CAGL0K05665gsingletonON37937313900.0
Kpol_1031.235.423ON37935713680.0
ZYRO0F09768g5.423ON37335713140.0
KNAG0C049905.423ON38035813090.0
KNAG0F01580singletonON37935613021e-180
KLLA0E21319g5.423ON38035812821e-177
NDAI0F00140singletonON37835712821e-177
ZYRO0F15664gsingletonON37335712801e-176
TBLA0B03020singletonON37935712791e-176
Ecym_55235.423ON38135612041e-165
TDEL0G00140singletonON38135711881e-162
TDEL0G04970singletonON38135711721e-160
NDAI0B00595singletonON37835711671e-159
AER250C5.423ON37435711621e-158
TPHA0A06070na 1ON37336111551e-157
Kwal_55.222215.423ON38035511201e-152
KLTH0E16566g5.423ON38135511031e-149
Kpol_1044.107.97ON3913813173e-32
NDAI0H024007.97ON3933823121e-31
NCAS0F015207.97ON4293823122e-31
KAFR0K007607.97ON3923833078e-31
CAGL0H06369g7.97ON3913833024e-30
Smik_1.557.97ON3943893007e-30
TPHA0L005707.97ON3913822991e-29
KLLA0F07909g7.97ON3913872981e-29
YAL012W (CYS3)7.97ON3943892972e-29
Suva_1.567.97ON3953902921e-28
SAKL0B09614g7.97ON3923802911e-28
Skud_1.497.97ON3943892912e-28
Ecym_26297.97ON3923832902e-28
TBLA0E022407.97ON3873862867e-28
KNAG0D047407.97ON3903822789e-27
AEL341W7.97ON3933782761e-26
TDEL0H035307.97ON3913812734e-26
ZYRO0D05742g7.97ON3913812701e-25
KLTH0D02728g7.97ON3923802682e-25
ZYRO0G19162g8.145ON4553892191e-18
Skud_19.6singletonON4013412162e-18
YGL184C (STR3)8.145ON4653892041e-16
CAGL0L06094g8.145ON4502632003e-16
TDEL0D06630singletonON4023051984e-16
Smik_7.375na 1ON4013051922e-15
Suva_17.6singletonON4013411922e-15
Skud_7.888.145ON4653891914e-15
YFR055W (IRC7)na 1ON3402891833e-14
Smik_7.898.145ON4654121844e-14
Ecym_84058.145ON4723981792e-13
KLTH0E06644g8.145ON4604061755e-13
TDEL0B046608.145ON4642851738e-13
Suva_7.798.145ON4653891739e-13
SAKL0H24882g8.145ON4594091711e-12
KLLA0C17028g8.145ON4602861702e-12
ACL059C8.145ON4532441631e-11
Kwal_47.172218.145ON4632431631e-11
Kpol_1028.804.354ON6892761499e-10
NCAS0A058104.53ON4473631471e-09
TPHA0F004204.53ON4423051462e-09
NDAI0D028804.53ON4473651453e-09
KLTH0G00418gsingletonON5681941419e-09
Ecym_83654.53ON4441731401e-08
KNAG0I029204.53ON4452041382e-08
KAFR0F030704.53ON4451731363e-08
KLTH0D17930g4.354ON6522641347e-08
Kpol_1041.444.53ON4441811338e-08
Kwal_14.791na 2ON5713301338e-08
TDEL0E05710singletonON5562381321e-07
YLL058Wna 2ON5752131257e-07
TPHA0L003304.354ON7172731259e-07
TBLA0C044004.53ON4451771231e-06
Kwal_47.166444.354ON6522661241e-06
ZYRO0G22198g4.53ON4453581212e-06
SAKL0H23892g4.53ON4422601203e-06
NCAS0A062704.354ON6592591204e-06
Skud_10.3534.354ON6402621186e-06
ZYRO0B08338g4.354ON6402551178e-06
YJR130C (STR2)4.354ON6392451178e-06
Suva_12.2214.354ON6392621179e-06
Ecym_51694.354ON6812481152e-05
TDEL0D006104.354ON6522691132e-05
KLLA0B04378g4.354ON6882751133e-05
Smik_10.4234.354ON6392621123e-05
ADL031W4.53ON4671691114e-05
Suva_10.8na 2ON5722731114e-05
AER164C4.354ON6453161114e-05
SAKL0G18172g4.354ON6732651098e-05
KLLA0D04037g4.53ON4441601033e-04
YLR303W (MET17)4.53ON4441601033e-04
Suva_13.684.354ON6882471034e-04
CAGL0M00550g4.354ON5692471025e-04
NDAI0D032604.354ON6962921025e-04
Smik_12.3na 2ON5662431026e-04
YML082W4.354ON6492391026e-04
Skud_12.3844.53ON4441601017e-04
Suva_10.3974.53ON4441601017e-04
Smik_12.3834.53ON4441601008e-04
Skud_12.10na 2ON5712981009e-04
Skud_13.594.354ON649264980.002
KNAG0M003304.354ON631277980.002
KLTH0D03652g4.53ON444160970.002
KAFR0B068304.354ON667299970.002
Smik_13.554.354ON699247950.004
Kwal_26.74374.53ON444100930.006
CAGL0D06402g4.53ON442160920.009
TDEL0E056204.53ON446205900.014
KAFR0E043904.370ON143195870.036
KAFR0E04410na 3ON143695840.097
SAKL0A02948g6.277ON1010108800.27
Kpol_1058.1singletonON23793731.3
Kwal_47.166744.364ON64074722.2
Kwal_33.143655.327ON43794703.9
Kwal_47.166964.370ON1430117704.3
CAGL0M00374g4.370ON1402131694.9
CAGL0I04334g1.217ON42556686.3
TPHA0H019606.277ON103136678.6
ZYRO0G19888g4.50ON1875122679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I01276g
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   764   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   591   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   587   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   586   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   584   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   582   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   582   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   576   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   554   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   546   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   540   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   531   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   510   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   508   0.0  
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   506   e-180
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   498   e-177
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                498   e-177
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   497   e-176
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   497   e-176
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   468   e-165
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      462   e-162
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   456   e-160
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              454   e-159
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   452   e-158
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   449   e-157
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   436   e-152
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   429   e-149
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   126   3e-32
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   124   1e-31
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   124   2e-31
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   122   8e-31
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   120   4e-30
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   120   7e-30
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   119   1e-29
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   119   1e-29
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   119   2e-29
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   117   1e-28
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   116   1e-28
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   116   2e-28
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   116   2e-28
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   114   7e-28
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   111   9e-27
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   110   1e-26
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   109   4e-26
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   108   1e-25
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   107   2e-25
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    89   1e-18
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    88   2e-18
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    83   1e-16
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    82   3e-16
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    81   4e-16
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    79   2e-15
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    79   2e-15
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    78   4e-15
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    75   3e-14
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    75   4e-14
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    74   2e-13
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    72   5e-13
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    71   8e-13
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    71   9e-13
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    70   1e-12
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    70   2e-12
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    67   1e-11
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    67   1e-11
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    62   9e-10
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    61   1e-09
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    61   2e-09
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      60   3e-09
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    59   9e-09
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    59   1e-08
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    58   2e-08
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    57   3e-08
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    56   7e-08
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    56   8e-08
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    56   8e-08
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    55   1e-07
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    53   7e-07
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    53   9e-07
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    52   1e-06
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    52   1e-06
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    51   2e-06
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    51   3e-06
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    51   4e-06
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    50   6e-06
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    50   8e-06
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    50   8e-06
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    50   9e-06
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    49   2e-05
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    48   2e-05
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    48   3e-05
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    48   3e-05
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    47   4e-05
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    47   4e-05
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    47   4e-05
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    47   8e-05
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    44   3e-04
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    44   3e-04
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    44   4e-04
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    44   5e-04
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    44   5e-04
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     44   6e-04
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    44   6e-04
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    44   7e-04
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    44   7e-04
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    43   8e-04
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    43   9e-04
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    42   0.002
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    42   0.002
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    42   0.002
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    42   0.002
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    41   0.004
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    40   0.006
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    40   0.009
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    39   0.014
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    38   0.036
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    37   0.097
SAKL0A02948g Chr1 complement(270179..273211) [3033 bp, 1010 aa] ...    35   0.27 
Kpol_1058.1 s1058 (1227..1940) [714 bp, 237 aa] {ON} (1227..1940...    33   1.3  
Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON...    32   2.2  
Kwal_33.14365 s33 (640933..642246) [1314 bp, 437 aa] {ON} YDR306...    32   3.9  
Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {O...    32   4.3  
CAGL0M00374g Chr13 (49330..53538) [4209 bp, 1402 aa] {ON} simila...    31   4.9  
CAGL0I04334g Chr9 complement(387102..388379) [1278 bp, 425 aa] {...    31   6.3  
TPHA0H01960 Chr8 (459288..462383) [3096 bp, 1031 aa] {ON} Anc_6....    30   8.6  
ZYRO0G19888g Chr7 complement(1644851..1650478) [5628 bp, 1875 aa...    30   9.2  

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/380 (97%), Positives = 369/380 (97%)

Query: 1   MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSR 60
           MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSR
Sbjct: 1   MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSR 60

Query: 61  LGHPNATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILS 120
           LGHPNATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILS
Sbjct: 61  LGHPNATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILS 120

Query: 121 RNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP 180
           RNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP
Sbjct: 121 RNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP 180

Query: 181 PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLES 240
           PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLES
Sbjct: 181 PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLES 240

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGG 300
           HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGG
Sbjct: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGG 300

Query: 301 YTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360
           YTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE
Sbjct: 301 YTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360

Query: 361 SXXXXXXXXXXXFIELEKLQ 380
           S           FIELEKLQ
Sbjct: 361 SADDLIADLDAAFIELEKLQ 380

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/357 (75%), Positives = 322/357 (90%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DL+T+LIHGDD  NRV DVAPPINV+TTFRYD++DLVPW ERE+L+FM++ PIYSRL HP
Sbjct: 45  DLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLAHP 104

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+TRLESIFSEIL+G+AVIYSSGLAAF+AAM H+NPK++FIGQSYHGV  IA+ILSRNY 
Sbjct: 105 NSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRNYD 164

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + Q  L+DIE+YA +GDIVH+ETPVNP+GTS D++S A +AH++GALL+VDSTFA PPLQ
Sbjct: 165 IKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPPLQ 224

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           Y WNFGADI+++SATK+FGGHSDLLSGVLV K+EE S++LKDDRIYLGTNVANLES +LL
Sbjct: 225 YVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFMLL 284

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI KQS+N TK+V+ L  ++ ++ KVL++++HSSLQ E FVKKQL+GGY PV
Sbjct: 285 RSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYGPV 344

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+ITL  KEQCKQLPLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCES
Sbjct: 345 FAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 401

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/356 (76%), Positives = 313/356 (87%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L+T LIH DD  NRV DVAPPINV TTFRYD +DLVPW ERE+L+FM++TPIYSRL HPN
Sbjct: 4   LSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLAHPN 63

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           +TRLESIFSEIL+GHAVIYSSGLAAF AAM H+NPK++FIGQSYHGV  IA+IL+RN+  
Sbjct: 64  STRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRNFQT 123

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
            Q +LD+IE++AQ GDIVH+ETPVNPFGTS DL+ FA KAH +GALL+VDSTFAPPPLQ 
Sbjct: 124 KQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPPLQN 183

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245
            W+F  DIIMHSATK+FGGHSDLLSGVLV K+E V+++L+DDRIYLGTNVANLES +LLR
Sbjct: 184 VWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFMLLR 243

Query: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305
           SLRTFEMR+LKQS+N TKIV  L SNRDKY KVL+ + HSSLQ ESFVKKQL GGY PVF
Sbjct: 244 SLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYGPVF 303

Query: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           SI+LMNKEQCK+ P  LKYFHHATSLGG+ESL+EWRAMTDPYI+QTLIR SIGCE+
Sbjct: 304 SISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCEN 359

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/357 (73%), Positives = 321/357 (89%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           +L+T LIHGDD  NRV DVAPPINV+TTFRYD++DL+PW ERE+L+FM++ P+YSRL HP
Sbjct: 3   NLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+TRLES+FSEIL+G+AVIYSSGLAAF+AAM H+NPK++FIGQSYHGV  I +IL+RNY 
Sbjct: 63  NSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARNYD 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + Q  L+DIE+YA +GDIVH+E+PVNP+GTSYD++S A +AH++GALL+VDSTFA PPLQ
Sbjct: 123 VKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           YAWNFGAD++++SATK+FGGHSDLLSGVLV KDE VS++LKDDRIYLGTNVANLES +LL
Sbjct: 183 YAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFMLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI KQS+N TK+V+ L  ++ ++ KVL+ ++HSSLQ E FVKKQL+GGY PV
Sbjct: 243 RSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+I L NKEQCKQLPLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCES
Sbjct: 303 FAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/357 (73%), Positives = 319/357 (89%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DL+T LIHGDD  NRV DVAPPINV+TTFRYD++DL+PW ERE+L+FM++ P+YSRL HP
Sbjct: 3   DLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLAHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+TRLESIFSEIL+G+AVIYSSGLAAF+AAM H+NPK++FIGQSYHGV  IA+IL+RNYG
Sbjct: 63  NSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRNYG 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + Q  L+DIE+ A +GDIVH+E+PVNP+GTS D++S A +AH++GALL+VDSTFA PPLQ
Sbjct: 123 IEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           YAWNFGADI+++SATK+FGGHSDLLSGVLV K+E  S++LKDDRIYLGTNVANLES +LL
Sbjct: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFMLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI KQS+N TK+V  L  ++ ++ KVL+ ++HSSLQ E FVKKQL+GGY PV
Sbjct: 243 RSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+ITL  KEQCKQLPLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCES
Sbjct: 303 FAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/357 (73%), Positives = 318/357 (89%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DL+T LIH DD  NRV DVAPPINV+TTFRYD++DL+PW ERE+L+FM++ P+YSRL HP
Sbjct: 3   DLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLAHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+TRLES+FS+IL+G+AV+YSSGLAAF AAM H+NPK++FIGQSYHGV  IA+IL+RNY 
Sbjct: 63  NSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRNYD 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + Q  L+DIE YA +GDIVH+E+PVNP+GTSYD++SFA +AH++GALL++DSTFA PPLQ
Sbjct: 123 IKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           YAWNFGADI+++SATK+FGGHSDLLSGVLV KDE VS+RLKDDRIYLGTNVANLES +LL
Sbjct: 183 YAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFMLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+E+RI KQS+N TKIV+ L  ++ ++ KVL+ ++HSSLQ E FVKKQL+GGY PV
Sbjct: 243 RSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYGPV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+ITL  KEQCK  PLKLKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR S+GCES
Sbjct: 303 FAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCES 359

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 313/355 (88%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L+TTLIHGDD  NRV DVAPPINV TTFRYD NDL+PW+ERE+L+FMD+TPIYSRLGHPN
Sbjct: 30  LSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGHPN 89

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           +TRLESIFSE+L GHAVIYSSG++AF AAM H+NPK+LF+GQSYHG   IA+IL+RNY +
Sbjct: 90  STRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNYNV 149

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
            Q  L+DIE+YAQKGDIVH+ETPVNP+GTS D+  FA +AH++GALL VDSTFAPPPLQ 
Sbjct: 150 EQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPLQD 209

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245
            W F ADI+MHSATK+FGGHSDLLSGVLV KDE+V+++L+DDRIYLGTNVANLES+LLLR
Sbjct: 210 VWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLLLR 269

Query: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305
           SLRTF+MRI +QS+N TK+V+ L  N+ K+  VL +++HSSLQ E FVKKQL GGY PVF
Sbjct: 270 SLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDPVF 329

Query: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360
           SITL NKEQCK+ PL LKYFHHATSLGG+ESL+EWRAMTDPYIDQTLIR SIGCE
Sbjct: 330 SITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCE 384

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/356 (71%), Positives = 319/356 (89%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L T+LIH DD  NRV DVAPPINV+TT+RYDE DL+PW ERE+L+FM++ P+YSRL HPN
Sbjct: 4   LGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLAHPN 63

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           ATRLES+FSEILEGHAVIYSSG AAF+AAM H+NPK++F+GQ YHG+  IA+I++RNYG+
Sbjct: 64  ATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRNYGV 123

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
            Q +LDDIE+YAQ+GDIV +E+P+NP+GTS D++S A+KAHS+GA+++VDSTFAPPPLQY
Sbjct: 124 EQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPPLQY 183

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245
           AW+ GAD+++HSATK+FGGHSDLLSGV+V KDEEV K+L+DDRIYLGTNV NLES++LLR
Sbjct: 184 AWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYMLLR 243

Query: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305
           SLR++E+RILKQS+N TK+VE L  N++++ KVL++V+HSSLQ E+FVKKQL+GGY PVF
Sbjct: 244 SLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYGPVF 303

Query: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           S++L   +QCK+ P KLKYFHHATSLGGVESL+EWRAMTDPYIDQTLIR SIG E+
Sbjct: 304 SMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVEN 359

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/357 (71%), Positives = 306/357 (85%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DL T LIHGDD+ NRV DVAPPIN+ATTFRYD  DL+PWNER DL FM+  PIYSRL HP
Sbjct: 8   DLETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHP 67

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N++RLE++FS+IL+G+AVIY+SG++AF AAMT+FNPK++F+GQ+YHG     +IL RN  
Sbjct: 68  NSSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGT 127

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L + +  +IEE+AQKGDIVH+E+PVNP+GTSYD++ F  KAHS+G L+M+DSTFAPPPLQ
Sbjct: 128 LKKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQ 187

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           Y W+F  DI+MHSATKFFGGHSDLLSGVLV KDE ++K L++DRIYLGTN+ANLES+LLL
Sbjct: 188 YVWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLL 247

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRTFEMRILKQS + T+IV+ L  NR K++KVL++++HSSLQ E FVKKQL GGYTPV
Sbjct: 248 RSLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPV 307

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FSI L NKEQCK LP  LKYF HATSLGGVESLIEWRA+TDPYI QTLIR S+GCE+
Sbjct: 308 FSIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCEN 364

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/355 (70%), Positives = 304/355 (85%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L TTLIH DD  NRV D+  PINVATTFRYD N+L+ WN+RE+ +F++ TP+YSRL HPN
Sbjct: 4   LPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPN 63

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           ATRLESIFSEIL GHAVIYSSGLAA+ A +TH+NPK+LFIGQSYHG HGIADI +RN G+
Sbjct: 64  ATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGM 123

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
            Q  LD IEE A +GDIVH+ETPVNPFGTSYD++ FA KAH++GALL++DSTFAPPPLQ 
Sbjct: 124 KQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQD 183

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245
            W FGAD+++HS TK+FGGHSDLLSGV+V K  EV+K++K+DRIYLGTN+ANLES+LLLR
Sbjct: 184 VWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLR 243

Query: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305
           SLRTFEMR+ KQS+N T +V++L  ++ +++KVL +++HSSLQ E FVKKQL GGY PVF
Sbjct: 244 SLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVF 303

Query: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360
           SI L +K QCK+LP KL+ F HATSLGGVESL+EWRA+TDPYI+QTLIR S+GCE
Sbjct: 304 SIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCE 358

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/373 (64%), Positives = 308/373 (82%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           +LAT LIH DD  NRV DVAPPINV+TT+RY E DL+PW +RE+ +FMD  P+YSR GHP
Sbjct: 3   ELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREGHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N TRLE+IFS+ILEGHAV+Y+SGLAAF AAM H+NPKQ+F+GQ YHGVH I+D+ +RN+ 
Sbjct: 63  NCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRNFN 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + QR+L+DI E+A+KGD+VH+E+PVNPFGT  D++  AD AHS+GA++++DSTFAPPPLQ
Sbjct: 123 VQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
           YAW+ GAD+IMHSATK+FGGHSDLL G+LVTKD+E+S+ LK+DRI LG+ + NLES+LL+
Sbjct: 183 YAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYLLM 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI+KQS+NV KIV++L  N++KY  VL  ++HSS+Q ++FVK QL+GGY  V
Sbjct: 243 RSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYNSV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESXXX 364
           FS  L ++EQCK+ P KLKYFHHATSLGG+ESLIEWRA++D  IDQ L+R S+GCES   
Sbjct: 303 FSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESAKD 362

Query: 365 XXXXXXXXFIELE 377
                     ELE
Sbjct: 363 LIDDLSQALQELE 375

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 299/357 (83%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           +L+T LIH DD  NRV DVAPPINV TTFRY+E DL+P  ERED+ F+D  P+YSR GHP
Sbjct: 3   ELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREGHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N TRLE++FSE L GHAVIYSSGL+A+ AA+  FNPK++F+ Q+YHG   IA++  RN  
Sbjct: 63  NGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRNGM 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + + +LD+IE+YA+KGDIVH+E+PVNPFGTSYD+++FA +AH++GALL+VD TFAPPPLQ
Sbjct: 123 VKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
             W+FGADI+MHSATK+FGGHSDLL GVLV KD++  + LK+DRI LGTN+ANLES+LLL
Sbjct: 183 NVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYLLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRTFEMRI+KQS+NVTKIV++L  N+ KY KVLR + HSSLQ E FVKKQL GGY PV
Sbjct: 243 RSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYNPV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FSITL   EQCK    +LKYF HATSLGGVESL+EWRA++DP+IDQTL+R S+GCES
Sbjct: 303 FSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCES 359

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 234/357 (65%), Positives = 289/357 (80%), Gaps = 1/357 (0%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DL T L+HGDD  NRV DVAPPINVA+TFRYD ++L+PW ++ +L+F+D  P+YSR GHP
Sbjct: 3   DLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N  RLE++FS  L GHA+ YS GL  F   M HFNPK++F+ Q YHGV GI  IL RNYG
Sbjct: 63  NGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYG 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + +  L DIE++AQKGDIVH+ETP+NPFGTS D+   A +AHS+GALLMVDSTFAPPPLQ
Sbjct: 123 VERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW+FGAD+IMHSATK+F GHSDLLSGVLV KD+EV+ +LK+DRIYLG+N+ANLES+LLL
Sbjct: 183 NAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+++RI +Q++N TK+V++L  ++DKY   L +++HSSLQ E FVKKQL GGYTPV
Sbjct: 243 RSLRTYDLRIRRQAENATKVVKYLNDHKDKYP-ALVELYHSSLQTEEFVKKQLSGGYTPV 301

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FS+T   +EQCK+    LK F HATSLGGVESL+EWRAM D  IDQ L+R SIGCES
Sbjct: 302 FSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/358 (66%), Positives = 295/358 (82%), Gaps = 2/358 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           LATTLIH DD  NRVPDVAPPINV+TT+RYD++DLVPW +RE LEFMD+ PIYSRL HPN
Sbjct: 4   LATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLAHPN 63

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           +TRLES+FS+IL GHAV+Y+SGLAAF AA+ H+NPK+LFI QSYHG   IA IL+R  G+
Sbjct: 64  STRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRTTGM 123

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGT-SYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
            Q SLDD+ + AQ GD+VH+E+PVNP GT   D+   A++AH RGA+L+VDSTFAPPPLQ
Sbjct: 124 QQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
             W FG D++MHSATK+FGGHSDLLSGVLVT+D++ +  L+DDRIYLGTNVANLE++LLL
Sbjct: 184 DPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAYLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQ-DESFVKKQLIGGYTP 303
           RSLRTFE+RI +QS N T +V +L  +R  +  VL +++HSSLQ  E +V +QL GG+ P
Sbjct: 244 RSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGGHPP 303

Query: 304 VFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           VF++TL + +QCK+ P  L YF HATSLGGVESL+EWRAMTDP+IDQTL+R S+GCE+
Sbjct: 304 VFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCEN 361

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  506 bits (1302), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 229/356 (64%), Positives = 290/356 (81%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT+ IH DD  NRVPDVAPPINV+ T+RYD ++L   +E+E LE MD  P+YSR  HPN
Sbjct: 4   FATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTAHPN 63

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
            TRLES+ S IL GHAV+Y+SG +AF+AA+ H+NPK+LFI +SY G+H IADI++RNYG+
Sbjct: 64  CTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRNYGM 123

Query: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
            Q + D+IE+YAQ GDIVH+E+P+NP+G S D+Q+ AD+AH++GALLMVDST APPPLQ 
Sbjct: 124 QQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPPLQN 183

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245
            W+FG DIIMHSATK+FGGHSDLL+G+LVTKD++VS +LK DRIYLGT   NLES LLLR
Sbjct: 184 TWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFLLLR 243

Query: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305
           SLRT EMR+LKQS+N TKIV++LV N++ + KVL +++HSSLQDE FV  Q+ GGYTP+F
Sbjct: 244 SLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYTPLF 303

Query: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           S  L   +Q K  P KLK F HATSLGG+ESLIEWR +++P +DQTL+R S+GCE+
Sbjct: 304 SFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCEN 359

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  498 bits (1282), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 226/358 (63%), Positives = 291/358 (81%), Gaps = 2/358 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L+T L+H DD  NRV D+  PINVATTFRY+E DL+PWNERED   +++ PIYSRL HPN
Sbjct: 3   LSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAHPN 62

Query: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125
           + R+ES+ S++LEG AV+Y++GLAA+ A +T++NPK+LFIG+ YHG   IADI +RN+ L
Sbjct: 63  SLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNWNL 122

Query: 126 IQRSL--DDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPL 183
            Q  L  D+I ++A KGD+VHIETPVNP+GTS+D+++FAD  HS+GA+L++DSTFAPPPL
Sbjct: 123 EQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPPPL 182

Query: 184 QYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLL 243
           Q  W+FG D+I+HSATK+FGGHSDLL+GVL  KD+EV+ +L+ DRIYLGTN+ANLE+ LL
Sbjct: 183 QNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAFLL 242

Query: 244 LRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTP 303
           LRSLRTFEMRI  QS+N TK+V +L+ ++  +  VL  VFHSSLQ E FVK+QL GGY P
Sbjct: 243 LRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGYGP 302

Query: 304 VFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           VF++TL +KEQC++ P  L  F HATSLGGVESL+EWRA+TDPYI  TLIR S+G E+
Sbjct: 303 VFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  498 bits (1282), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 227/357 (63%), Positives = 293/357 (82%), Gaps = 1/357 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHP 64
           L+T LIHGDD  NRV DVAPPINV+TTFR+D N+L+P NE +D L+ +D  P+Y+R  HP
Sbjct: 4   LSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARESHP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N++R++++ S++L GHAVIY+SG +AFHA M H+NPK+ F+   Y GVH IAD+++RNYG
Sbjct: 64  NSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITRNYG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L Q SLD+IEE+AQ GDIVH+ETP+NPFGTS D+++ A + H +GA+L +D+T APPPLQ
Sbjct: 124 LEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW FGADII+HSATK+FGGHSDLL+GVLV K +E +  L +DRI+LGTN+ NLES+LLL
Sbjct: 184 DAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESYLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI+KQ  N  K++ +L  N+ K++KVL +++HSSLQD+ FV+KQL G Y PV
Sbjct: 244 RSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLYCPV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+ITL + +QCK+LPL LKYF HATSLGGVESLIEWRAM+D  IDQ LIR SIGCE+
Sbjct: 304 FAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  497 bits (1280), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 229/357 (64%), Positives = 288/357 (80%), Gaps = 1/357 (0%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           DLAT L+HGDD  NRV DVAPPINVA+TFRYD ++LVPW +  +L+ +D  P+YSR GHP
Sbjct: 3   DLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREGHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N  RLE++FS  L GHAV YS GL  F +AM HFNPK++F+ Q YHGV GI  I+ RNYG
Sbjct: 63  NGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRNYG 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           + +  L DIE++AQKGDIVH+ETP+NPFGTS D+   A +AH++GALLMVDSTFAPPPLQ
Sbjct: 123 VERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW+FGAD+IMHSATK+FGGHSDLLSGVLV KD+E + +LK+DRI LG+N++NL+S+LLL
Sbjct: 183 NAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYLLL 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+++RI +QS++ TKIV++L  +++ +   L +++HSSLQ + FVKKQL GGY PV
Sbjct: 243 RSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYGPV 301

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FS+TL  +EQCK+    LK F HATSLGGVESL+EWRAM D  IDQ L+R SIGCES
Sbjct: 302 FSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 225/357 (63%), Positives = 294/357 (82%), Gaps = 1/357 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHP 64
           LATTLIH DD  NRV DVAPPINV++TFRYD N+L+P NE +D L  ++++P+YSR  HP
Sbjct: 4   LATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRESHP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N++R++SI S++L GHAVIY+SG +AFHA M H+NPK+ F+   Y GVH IAD+++RNYG
Sbjct: 64  NSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITRNYG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L Q SLD+IEE+AQ GD+VH+E+P+NPFGT+ D+++ AD+ HS+GA+L +DST APPPLQ
Sbjct: 124 LEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
             WNFGADI++HSATK+FGGHSDLL+GVL  K +E +  L +DRI+LGTN+ NLES+LLL
Sbjct: 184 NVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESYLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT+EMRI+KQS N TKIV++L ++++     L+++FH+SLQ+ESF+ KQL GG+  V
Sbjct: 244 RSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGHGAV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FSI L +  QCK+LPL LKYF HATSLGG+ESLIEWRAM+D  IDQ LIR S+GCE+
Sbjct: 304 FSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  468 bits (1204), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 217/356 (60%), Positives = 279/356 (78%), Gaps = 1/356 (0%)

Query: 6   LATTLIHGDD-IKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           L+T LIH DD + + V DVAPPINV+TTFRYD ++LV      D    +  P+YSR GHP
Sbjct: 4   LSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSREGHP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+ R  SI S  L G+AV Y+SGL+AF AA+TH+NPK+LFIGQSYHG H +ADI  RNYG
Sbjct: 64  NSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVRNYG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L++  LD+IEE AQ GD+VHIE+P+NP+GT+ D++ +  K H +GA++M+DSTFAPPPLQ
Sbjct: 124 LLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW FG DI+MHS TK+ GGHSDLL GVLV KD+ V ++L  DRIYLGTN+ANL+S+LL+
Sbjct: 184 NAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSYLLI 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRT E+R++KQS   TK+V +L  +  ++S VL ++ H+SLQ E FVKKQL GG+TPV
Sbjct: 244 RSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGHTPV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360
           FSI L   +QC++LP KLK+FHHATS GGVESLIEWRA++DP I++TL+R S+GCE
Sbjct: 304 FSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCE 359

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  462 bits (1188), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 214/357 (59%), Positives = 277/357 (77%), Gaps = 1/357 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHP 64
           L+T  IH DDI NRV DVAPPINV+TTFRYD  +LVP  E E+ +E +++TP+YSR  HP
Sbjct: 4   LSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRESHP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+ RL+++ S+IL GHA +Y+SG++AFHA + H+NPK+ F+   Y GV GIA +    +G
Sbjct: 64  NSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQEKHG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L    L  IEE+A+KGD++H+E P+NP+GT  D+ + A + H +GA+L +DST APPPLQ
Sbjct: 124 LETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW+FGAD++MHSATK+ GGHSDLL+GV+V K  E  ++L  +RI+LGTNV NLES LLL
Sbjct: 184 DAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESFLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRTFEMR+LKQS+N  KIV  L  N+ KYSKVL +V+HSSLQ E+FV++QL GG+  V
Sbjct: 244 RSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGHGAV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FS+TL + EQCK+LP KL YF HATSLGGVESLIEWRA++D  ID  L+R SIGCE+
Sbjct: 304 FSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  456 bits (1172), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 271/357 (75%), Gaps = 1/357 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHP 64
           L+TT IH DDI NRV DVAPPINV TTFR+D ++L+P  E E+ +E ++ +P+Y+R  HP
Sbjct: 4   LSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARETHP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N+ R++SI S IL GHA +Y+SG +AFHA M   NPK++F+  +Y GV  IA ++   YG
Sbjct: 64  NSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKEKYG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L    LD IEE+A+KGD+VH+ETP+NPFG   ++ + A++ H +GALL VDST APPPLQ
Sbjct: 124 LKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW+FGADI+MHSATK+ GGHSDLL+GVLV KD E  + L  +RIYLGTN+ NLES LLL
Sbjct: 184 NAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESFLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RSLRTFEMR+ KQS+N  K+V  L  N  KY KVL Q++HSSLQ E FV+KQL GG+  V
Sbjct: 244 RSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGHGAV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FS+ L + EQ K+LP KL YF HATSLGGVESLIEWRAM+D  ID  L+R S+GCE+
Sbjct: 304 FSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 212/357 (59%), Positives = 286/357 (80%), Gaps = 1/357 (0%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHP 64
           L+TTLIHGDD  NRV  VAPPINV+TTFR+D N+L+P NE +D L+ +D  P+Y++  +P
Sbjct: 4   LSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKESYP 63

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N++R++++ S++L GHAVIY+SG + FHA M H+NPK+ F+   Y GVH IAD+L+RNYG
Sbjct: 64  NSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTRNYG 123

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L Q+ LD+IEE+AQ GDIVH+ETP+NPFGTS D+++  ++ H++GA+L +D+T A PPLQ
Sbjct: 124 LEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASPPLQ 183

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
            AW FGADII+HSATK+ GGHSDLL+GVLV K +E +  L +DRI+LGTN+ NLES+LLL
Sbjct: 184 DAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESYLLL 243

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           R L T+EMRI+KQ +N  K++ +L  N+ K++KV+ +++HSS QD+ F++KQL G Y PV
Sbjct: 244 RLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLYCPV 303

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           F+ITL + +QCK+LPL LKYF HATSLG  ESLIEWRA++D  IDQ LI  SIGCE+
Sbjct: 304 FAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/357 (57%), Positives = 271/357 (75%)

Query: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64
           +L T+LIH DD  NRV DVAPPINV TTFRY E+DL+P  ER           YSR+ HP
Sbjct: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124
           N  R E + +E L G AV+YSSGLAAF AA+THFNPK+LFIG+ YHG HG+ADI  RN+G
Sbjct: 63  NGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHG 122

Query: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           L + SL+++ E ++ GD+VHIE+P+NP+GT  D+   A  AH +GA +++D+TFAPPPLQ
Sbjct: 123 LQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPPLQ 182

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244
             W  GAD+++HS TK+FGGHSDLL GV   +D  V+++L+ DR+YLGTN+ANLE++LL+
Sbjct: 183 DRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLI 242

Query: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           RS+RT EMR+++QS + TK+V +L S++ ++  VL +VFHSSLQ E +V++ L GG  PV
Sbjct: 243 RSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPV 302

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           FSI L   EQCK+LP  LK FHHATSLGGVESLIEWRAM+D  ++Q L+R S+GCES
Sbjct: 303 FSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 206/361 (57%), Positives = 277/361 (76%), Gaps = 1/361 (0%)

Query: 19  RVPDVAPPINVATTFRYDENDLVPWNERED-LEFMDRTPIYSRLGHPNATRLESIFSEIL 77
           ++ D+APPINV+TT+RYDE++L+P  E +D L  ++  P+YSR  H N++R++ + S++L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 78  EGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYA 137
            GHAVIY+SG +AFHA M H+NPK++F  +SY G+  IA++++RNYGL Q SL DI+++A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 138 QKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHS 197
           Q+GDI+HIETP+NPFGT+ +++  A KAH++ ALL VDST APPPLQ A++FGADI++HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 198 ATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQ 257
           ATK+ GGHSDLL+GVLV K E+ ++ L +DRI+LGTN+ NLES LLLRSLRT+EMR+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 258 SQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNKEQCKQ 317
           SQNV KIV  L +NR +Y  V++ ++HSSLQ E FV +QL  G+T VF++   ++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 318 LPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESXXXXXXXXXXXFIELE 377
               LKYF HATSLGGVESL+EWRAM+DP ID  LIRFSIGCE+              LE
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

Query: 378 K 378
           K
Sbjct: 368 K 368

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  436 bits (1120), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 199/355 (56%), Positives = 269/355 (75%)

Query: 7   ATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNA 66
           AT  IH DD  NRV DVAPPINV+TTFRYD   LVP      +   D   IYSRLGHPNA
Sbjct: 5   ATNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNA 64

Query: 67  TRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLI 126
            RLE++ S++L+ HAV+Y+SGLAA+HA + HF PK+LF+   YHG   +A I+SR  G+ 
Sbjct: 65  DRLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGME 124

Query: 127 QRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYA 186
             SL+DIE   Q+GD+VHIE P+NPFG + DL  +A + HS G L+M+DST  PPPL+ A
Sbjct: 125 ILSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNA 184

Query: 187 WNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRS 246
           W++GADIIMHS TK+FGGHSDLLSG++   DE ++++LK+DR YLGT  A+LES LLLRS
Sbjct: 185 WDYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRS 244

Query: 247 LRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFS 306
           LRT ++R+ +QSQN T++V +L +N +K+S V++++ H+SLQ E+FVK+Q+ GG+ PVF+
Sbjct: 245 LRTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFA 304

Query: 307 ITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           + L +++QC+++   + +F HATSLGGVESLIEWRAM+DP   +TLIR S+G E+
Sbjct: 305 LILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLEN 359

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 202/355 (56%), Positives = 263/355 (74%)

Query: 7   ATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNA 66
           +T  IHGDD  NRV DVAPPINV+TTFRYD+  L P          D   IYSRLGHPNA
Sbjct: 5   STATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNA 64

Query: 67  TRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLI 126
            RLE + +EIL+G  V+Y+SGLAA+HA + H NPK+LF    YHG   +A I+SR  G+ 
Sbjct: 65  DRLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGME 124

Query: 127 QRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYA 186
              L+++E+  Q GD+VH+E P NP+G   +L  FA+K H  GAL++VDST APPPL+  
Sbjct: 125 ILPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNT 184

Query: 187 WNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRS 246
           W FGADI+MHS TK+FGGHSDLLSG++  +DE+V+++L++DR YLGT  A+LES+LLLRS
Sbjct: 185 WEFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRS 244

Query: 247 LRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFS 306
           LRT E+R+LKQS N T++VE+L S++D+Y+ V++ + H+SLQ E FVKKQL GGY PVFS
Sbjct: 245 LRTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFS 304

Query: 307 ITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCES 361
           + L ++EQCK L      F HATSLGG ESLIEWRAM+DP+ ++ LIR S+G E+
Sbjct: 305 LLLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLEN 359

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  126 bits (317), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 120/381 (31%), Positives = 178/381 (46%), Gaps = 42/381 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQSA-PAQPIGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE   + +  G + + +SSG A     +         + IG  Y G H     ++  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVANT 117

Query: 123 YGLIQRSLDD-IEEYAQ----KGDIVHIETPVNPF--GTSYDLQSFADKAHSRGALLMVD 175
           +G+     ++ +EE  Q       +V IE+P NP    T   L S   K+  +  +L+VD
Sbjct: 118 HGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    NFGADI++HSATK+  GHSD++ GVL T D+++ +RL+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAIP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESF--V 293
           +  +S L+ R L+T  +R+ + + N TKI E L SN +    V+   +      E+F  V
Sbjct: 238 SPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNEN----VIAVNYPGLPSSENFEVV 293

Query: 294 KKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYID 349
           KKQ    +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   I 
Sbjct: 294 KKQHRDALGGGMISFRIK-GGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 350 QT----------LIRFSIGCE 360
           +           LIR S+G E
Sbjct: 353 KEQREASGVFDDLIRLSVGIE 373

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  124 bits (312), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 180/382 (47%), Gaps = 44/382 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P       E       YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQS----APAQPIGTYE-------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE+  + +  G + + +SSG A     +     N   + IG  Y G H     ++  
Sbjct: 58  RENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTKVANA 117

Query: 123 YGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
           +G+     +D+ +       +   +V IE+P NP     D+++ +   K+ ++  LL+VD
Sbjct: 118 HGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDILLVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    NFGADI++HSATK+  GHSD++ GVL T ++E+ +RL+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAVGAIP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL---QDESF 292
           +  +S L  R L+T  +R+ + S   TKI E L +N +     ++ V +  L   ++   
Sbjct: 238 SPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPN-----VKAVNYPGLPTHENYDI 292

Query: 293 VKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI 348
           VKKQ    +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   I
Sbjct: 293 VKKQHREALGGGMISFRIN-GGSEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 349 DQT----------LIRFSIGCE 360
            +           LIR S+G E
Sbjct: 352 PKESREASGVYDDLIRLSVGIE 373

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  124 bits (312), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 114/382 (29%), Positives = 182/382 (47%), Gaps = 44/382 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P N     E       YSR  +PN
Sbjct: 46  FATKAIHAGTHTDVHGSVIEPISLSTTFKQSS----PANPVGIYE-------YSRSQNPN 94

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE+  + +  G + + +SSG A     +         + IG  Y G H     ++  
Sbjct: 95  RENLENAIAALENGKYGLAFSSGSATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVANA 154

Query: 123 YGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
           +G+     +D+ +       +   +V IE+P NP     D+Q+ AD  K+ ++  +L+VD
Sbjct: 155 HGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDIILVVD 214

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    +FGADI++HSATK+  GHSD++ GVL T D+ + ++L+  +  +G   
Sbjct: 215 NTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAIGAIP 274

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL---QDESF 292
           +  +S L  R L+T  +R+ + S N TKI + L S     S +++ V +  L   ++ + 
Sbjct: 275 SPFDSWLAHRGLKTLHLRVRQASLNATKIAQFLQS-----SPLVKAVNYPGLPTHENYAV 329

Query: 293 VKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI 348
           V+KQ    +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   I
Sbjct: 330 VQKQHREALGGGMISFRIQ-GGSEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 388

Query: 349 DQT----------LIRFSIGCE 360
            +           L+R S+G E
Sbjct: 389 PKEAREASGVYDDLVRLSVGIE 410

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  122 bits (307), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 182/383 (47%), Gaps = 46/383 (12%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTFR       P       E       YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFRQS----APAQPIGTYE-------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVHGIADILSR 121
              LE   + +  G + + +SSG +A  A +    P+    + IG  Y G H     ++ 
Sbjct: 58  RENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 122 NYGL----IQRSLDDIEEYAQKG-DIVHIETPVNPFGTSYDLQSFADKAHS--RGALLMV 174
            +G+        L+D+ +  ++   +V IE+P NP     D+++ + K  S  +  LL+V
Sbjct: 117 AHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILLVV 176

Query: 175 DSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTN 234
           D+TF  P L    NFGADI++HSATK+  GHSD++ GVL T ++++ +RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIGAI 236

Query: 235 VANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL---QDES 291
            +  ++ L  R LRT  +R+ + S +  KI E L +N +     +  V +  L   +D  
Sbjct: 237 PSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNEN-----VEAVNYPGLPTHKDYD 291

Query: 292 FVKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPY 347
            VKKQ    +GG    F I     E   +     + F  A SLGGVESL+E  A MT   
Sbjct: 292 VVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVMTHGG 350

Query: 348 IDQ----------TLIRFSIGCE 360
           I +           L+R S+G E
Sbjct: 351 IPKEAREASGVYDNLVRLSVGIE 373

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  120 bits (302), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 180/383 (46%), Gaps = 46/383 (12%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH    ++    V  PI+++TTF+  E    P    E          YSR  +PN
Sbjct: 9   FATKAIHAGAHEDIHGSVIEPISLSTTFKQSE-PAKPIGTYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH----GIAD 117
              LE+  + +  G + + +SSG +A  A +    P+    + IG  Y G H     +A+
Sbjct: 58  RENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 118 ILSRNYGLIQRSLDDIEEYAQKG-DIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMV 174
               +       ++D+ +  +    +V IE+P NP     D+Q  A+  K  ++  LL+V
Sbjct: 117 AHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLVV 176

Query: 175 DSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTN 234
           D+TF  P L     FGADI++HSATK+  GHSD++ GVL T  +++ +RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGCI 236

Query: 235 VANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDE---S 291
            +  ++ L  R L+T  +R+ + S N TKI   L SN +     +  V +  LQ      
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN-----VVAVNYPGLQSHPNYD 291

Query: 292 FVKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPY 347
            VKKQ    +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   
Sbjct: 292 VVKKQHREALGGGMISFRIK-GGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 348 IDQT----------LIRFSIGCE 360
           I +           L+R S+G E
Sbjct: 351 IPKEAREASGVFDDLVRLSVGIE 373

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  120 bits (300), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 115/389 (29%), Positives = 184/389 (47%), Gaps = 42/389 (10%)

Query: 1   MTRQD---LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI 57
           MT Q+    AT  IH  +  +    V  PI+++TTF+       P N     E       
Sbjct: 1   MTLQESDRFATKAIHAGEHIDVHGSVIEPISLSTTFKQSS----PANPIGTYE------- 49

Query: 58  YSRLGHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH 113
           YSR  +PN   LE   + +    + + +SSG +A  A +    P+    + IG  Y G H
Sbjct: 50  YSRSQNPNRENLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTH 108

Query: 114 GIADILSRNYGL----IQRSLDDIEEYAQKG-DIVHIETPVNPFGTSYDLQSFAD--KAH 166
                ++  +G+        L+D+ +  +    +V IETP NP     D+Q  AD  K H
Sbjct: 109 RYFTKVANAHGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKH 168

Query: 167 SRG--ALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRL 224
           + G   +L+VD+TF  P +    NFGADI++HSATK+  GHSD++ GVL T ++++ +RL
Sbjct: 169 AAGQDVILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERL 228

Query: 225 KDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH 284
           +  +  +G   +  ++ L  R L+T  +R+ + + +  KI E L S+++    V      
Sbjct: 229 QFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENVVAVNYPGLK 288

Query: 285 SSLQDESFVK--KQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA 342
           +    +  +K  +  +GG    F I     E   +     + F  A SLGG+ESL+E  A
Sbjct: 289 THPNYDVVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 343 -MTDPYIDQT----------LIRFSIGCE 360
            MT   I +           L+R S+G E
Sbjct: 348 VMTHGGIPKEAREASGVYDDLVRISVGIE 376

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  119 bits (299), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 113/382 (29%), Positives = 176/382 (46%), Gaps = 44/382 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGSHVDVHGSVIEPISLSTTFKQSA-PAEPIGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE   + +  G + + +SSG A     +     N   + IG  Y G H     ++  
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVANT 117

Query: 123 YGLIQRSLDDI-----EEYAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
           +G+     +D+     +   +   +V IE+P NP     D++  A   K+ ++  LL+VD
Sbjct: 118 HGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    NFGADI++HSATK+  GHSD++ GVL T   ++ +RL+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAIP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL---QDESF 292
           +  ++ L  R L+T  +R+ + + N TKI E L  + +     +  V +  L    D + 
Sbjct: 238 SPFDAWLTHRGLKTLHLRVRQAALNATKIAEFLAQSDN-----VVAVNYPGLPTNPDYAI 292

Query: 293 VKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI 348
           VKKQ    +GG    F +     E   +     + F  A SLGG+ESL+E  A MT   I
Sbjct: 293 VKKQHRDALGGGMISFRVK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 349 DQT----------LIRFSIGCE 360
            +           L+R S+G E
Sbjct: 352 PKEQREASGVFDDLVRLSVGIE 373

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  119 bits (298), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 179/387 (46%), Gaps = 54/387 (13%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGTHVDVHGSVIEPISLSTTFK-QSAPAQPIGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHG---------- 111
              LE   + +  G + + +SSG +A  A +    P+    + IG  Y G          
Sbjct: 58  RKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 112 VHGIADILSRNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHS--RG 169
            HG+    + N  L+      I+E  +   +V IETP NP     D++  A  A S  + 
Sbjct: 117 AHGVETTFTNN--LVAELPSLIKENTK---LVWIETPTNPTLKVTDIELVAKTAKSINKD 171

Query: 170 ALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRI 229
            LL+VD+TF  P L    NFGADI++HSATK+  GHSD++ GVL T D+ + ++L+  + 
Sbjct: 172 ILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQN 231

Query: 230 YLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQD 289
            +G   +  +S L+ R ++T  +R+ + S +  KI E L SN +    V+   +      
Sbjct: 232 AIGAIPSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNEN----VIAVNYPGLPTH 287

Query: 290 ESF--VKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-M 343
           ES+  VKKQ    +GG    F I     E         + F  A SLGG+ESL+E  A M
Sbjct: 288 ESYAVVKKQHRDALGGGMISFRIK-GGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVM 346

Query: 344 TDPYIDQT----------LIRFSIGCE 360
           T   I +           L+R SIG E
Sbjct: 347 THGGIPKEQREASGVYDDLVRLSIGIE 373

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  119 bits (297), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 184/389 (47%), Gaps = 42/389 (10%)

Query: 1   MTRQD---LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI 57
           MT Q+    AT  IH  +  +    V  PI+++TTF+       P N     E       
Sbjct: 1   MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE------- 49

Query: 58  YSRLGHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH 113
           YSR  +PN   LE   + +    + + +SSG +A  A +    P+    + IG  Y G H
Sbjct: 50  YSRSQNPNRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTH 108

Query: 114 GIADILSRNYGL----IQRSLDDIEEYAQKG-DIVHIETPVNPFGTSYDLQSFAD--KAH 166
                ++  +G+        L+D+ +  ++   +V IETP NP     D+Q  AD  K H
Sbjct: 109 RYFTKVANAHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKH 168

Query: 167 SRG--ALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRL 224
           + G   +L+VD+TF  P +    NFGADI++HSATK+  GHSD++ GVL T ++ + +RL
Sbjct: 169 AAGQDVILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERL 228

Query: 225 KDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH 284
           +  +  +G   +  ++ L  R L+T  +R+ + + +  KI E L ++++    V      
Sbjct: 229 QFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLK 288

Query: 285 SSLQDESFVK--KQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA 342
           +    +  +K  +  +GG    F I     E   +     + F  A SLGG+ESL+E  A
Sbjct: 289 THPNYDVVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 343 -MTDPYIDQT----------LIRFSIGCE 360
            MT   I +           L+R S+G E
Sbjct: 348 VMTHGGIPKEAREASGVFDDLVRISVGIE 376

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  117 bits (292), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 113/390 (28%), Positives = 179/390 (45%), Gaps = 43/390 (11%)

Query: 1   MTRQD---LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI 57
           MT Q+    AT  IH  +  +    V  PI+++TTF+       P N     E       
Sbjct: 1   MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE------- 49

Query: 58  YSRLGHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH 113
           YSR  +PN   LE   + +    + + +SSG +A  A +    P+    + IG  Y G H
Sbjct: 50  YSRSQNPNRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTH 108

Query: 114 GIADILSRNYGLIQRSLDDI-----EEYAQKGDIVHIETPVNPFGTSYDLQSFADK---- 164
                ++  +G+     +D+     +       +V IETP NP     D+Q  AD     
Sbjct: 109 RYFTKVANAHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKH 168

Query: 165 -AHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKR 223
            A S+  +L+VD+TF  P +    NFGADI++HSATK+  GHSD++ GVL T  + + +R
Sbjct: 169 TAASQDVILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYER 228

Query: 224 LKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVF 283
           L+  +  +G   +  ++ L  R L+T  +R+ + + +  KI E L ++++    V     
Sbjct: 229 LQFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAVNYPGL 288

Query: 284 HSSLQDESFVK--KQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWR 341
            +    +  VK  +  +GG    F I     E   +     + F  A SLGG+ESL+E  
Sbjct: 289 KTHPNYDVVVKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVP 347

Query: 342 A-MTDPYIDQT----------LIRFSIGCE 360
           A MT   I +           L+R S+G E
Sbjct: 348 AVMTHGGIPKEAREASGVFDDLVRISVGIE 377

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  116 bits (291), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 116/380 (30%), Positives = 175/380 (46%), Gaps = 40/380 (10%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHTDVHGSVIEPISLSTTFKQTA-PAQPVGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE   + +    + + +SSG A     +         + IG  Y G H     ++  
Sbjct: 58  RKNLEDAVAALENAKYGLAFSSGSATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 123 YGLIQRSLDD-IEEYAQ----KGDIVHIETPVNPF--GTSYDLQSFADKAHSRGALLMVD 175
           +G+     ++ +E+ AQ       +V IE+P NP    T  +L S   K+ ++  LL+VD
Sbjct: 118 HGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    NFGADI++HSATK+  GHSD++ GVL T D+E+ +RL+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAIP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRD----KYSKVLRQVFHSSLQDES 291
           +  ++ L  R L+T  +R+ + +   TKI E L  + D     Y  +     H+ +  + 
Sbjct: 238 SPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSEDVVAVNYPGLPTHPNHNVVLKQ- 296

Query: 292 FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI-- 348
              +  +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   I  
Sbjct: 297 --HRDGLGGGMISFRIK-GGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPK 353

Query: 349 DQ--------TLIRFSIGCE 360
           DQ         LIR SIG E
Sbjct: 354 DQREASGVFDDLIRLSIGIE 373

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  116 bits (291), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 180/389 (46%), Gaps = 42/389 (10%)

Query: 1   MTRQD---LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI 57
           MT Q+    AT  IH  +  +    V  PI+++TTF+       P N     E       
Sbjct: 1   MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE------- 49

Query: 58  YSRLGHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH 113
           YSR  +PN   LE   + +    + + +SSG +A  A +    P+    + IG  Y G H
Sbjct: 50  YSRSQNPNRENLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTH 108

Query: 114 GIADILSRNYGLIQRSLDDI-----EEYAQKGDIVHIETPVNPFGTSYDLQSFAD--KAH 166
                ++  +G+     +D+     +       +V IETP NP     D+Q  AD  K H
Sbjct: 109 RYFTKVANAHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKH 168

Query: 167 SRG--ALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRL 224
           + G   +L+VD+TF  P +    +FGADI++HSATK+  GHSD++ GVL T  + + +RL
Sbjct: 169 AAGQDVILVVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERL 228

Query: 225 KDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH 284
           +  +  +G   +  ++ L  R L+T  +R+ + + +  KI E L S+++    V      
Sbjct: 229 QFLQNAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAVNYPGLK 288

Query: 285 SSLQDESFVK--KQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA 342
           +    +  +K  +  +GG    F I     E   +     + F  A SLGG+ESL+E  A
Sbjct: 289 THPNYDVVLKQHRDALGGGMISFRIK-GGAEAASKFASSTRLFTLAESLGGIESLLEVPA 347

Query: 343 -MTDPYIDQT----------LIRFSIGCE 360
            MT   I +           LIR S+G E
Sbjct: 348 VMTHGGIPKEAREASGVFDDLIRISVGIE 376

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  116 bits (290), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 116/383 (30%), Positives = 184/383 (48%), Gaps = 46/383 (12%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           ++T ++H  +  +    V  PI+++TTF+   +  VP    E          YSR  +PN
Sbjct: 9   ISTKVVHAGEHVDIHGSVIEPISLSTTFK-QASPAVPVGAYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG--HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVHGIADILS 120
              LE   + +LE   H + +SSG +A  A +    P+    + IG  Y G H   + ++
Sbjct: 58  RKNLEDAIA-VLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVA 115

Query: 121 RNYGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLM 173
             +G+     +++ E       +   +V IE+P NP     D+Q  +   K+ ++  +L+
Sbjct: 116 NAHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILV 175

Query: 174 VDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGT 233
           VD+TF  P L    NFGADI++HSATK+  GHSD++ GVL T  + +  +L+  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGA 235

Query: 234 NVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH--SSLQDES 291
             +  ++ L  R L+T  +R+   S +  +I E LV    K  KV+   +   SS  +  
Sbjct: 236 VPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFLV----KSDKVISVNYPGLSSHPNND 291

Query: 292 FVKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPY 347
            VKKQ    +GG    F I     +   +     + F  A SLGG+ESL+E  A MT   
Sbjct: 292 IVKKQHRDGLGGGMISFRIK-GGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 348 I--DQ--------TLIRFSIGCE 360
           I  DQ         LIR S+G E
Sbjct: 351 IPKDQREASGVYDDLIRLSVGIE 373

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  114 bits (286), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 175/386 (45%), Gaps = 52/386 (13%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI----YSRL 61
            AT  IH     +    V  PI+++TTF+               +     PI    YSR 
Sbjct: 9   FATKAIHAGAHIDVHGSVIEPISLSTTFK---------------QSAPSQPIGIYEYSRS 53

Query: 62  GHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVHGIAD 117
            +PN   LE   + +  G + + +SSG +A  A +    P+    + IG  Y G H    
Sbjct: 54  QNPNRKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTHRYFT 112

Query: 118 ILSRNYGLIQR-SLDDIEEYAQ----KGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGA 170
            ++  +G+    S + IEE          +V IE+P NP     D+Q   D  K  ++  
Sbjct: 113 KVANAHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDI 172

Query: 171 LLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIY 230
           L++VD+TF  P L    NFGADI++HSATK+  GHSD++ GVL T  +E+ +RL+  +  
Sbjct: 173 LVVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNA 232

Query: 231 LGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDE 290
           +G   +  ++ L  R L+T  +R+ + S +  KI E L   +D     +      S  + 
Sbjct: 233 IGAIPSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLA--QDPNVIAVNYPGLESHPNR 290

Query: 291 SFVKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLI--------- 338
             VKKQ    +GG    F I     E   +   K + F  A SLGG+ESL+         
Sbjct: 291 DIVKKQHRDGLGGGMISFRIK-GGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHG 349

Query: 339 ----EWRAMTDPYIDQTLIRFSIGCE 360
               E R  T  Y D  L+R S+G E
Sbjct: 350 GIPKEAREATGVYDD--LVRLSVGIE 373

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  111 bits (278), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 109/382 (28%), Positives = 177/382 (46%), Gaps = 44/382 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  +H  +  +    V  PI+++TTF+       P N     E       YSR  +PN
Sbjct: 7   FATLAVHAGEHTDVHGSVIEPISLSTTFKQSS----PANPIGVYE-------YSRSQNPN 55

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE+  + + +  + + +SSG AA    M         + IG  Y G H     ++  
Sbjct: 56  RDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVANT 115

Query: 123 YGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
           +G+     +++ E           +V IE+P NP     D+Q+ ++  K  ++  LL+VD
Sbjct: 116 HGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDILLVVD 175

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L     FGADI++HSATK+  GHSD++ GVL T  +++ +RL+  +  +G   
Sbjct: 176 NTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGAIP 235

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQ---DESF 292
           +  ++ L  R L+T  +R+ + S    KI E L +     SK +  V +  L+   + + 
Sbjct: 236 SPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSA-----SKHVEAVNYPGLKTHPNHAV 290

Query: 293 VKKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI 348
           V++Q    +GG    F +         +     + F  A SLGG+ESL+E  A MT   I
Sbjct: 291 VQRQHRDALGGGMISFRVKGG-AAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHGGI 349

Query: 349 DQ----------TLIRFSIGCE 360
            +           LIR S+G E
Sbjct: 350 PKESREASGVYDNLIRLSVGIE 371

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  110 bits (276), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 171/378 (45%), Gaps = 36/378 (9%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P N     E       YSR  +PN
Sbjct: 9   FATKAIHAGAHTDLHGSVIEPISLSTTFKQSS----PGNPVGAYE-------YSRGQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVHGIADILSR 121
              LE   + +    + + +SSG +A  A +    P+    + IG  Y G H     ++ 
Sbjct: 58  RQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 122 NYGL----IQRSLDDIEEYAQKGD-IVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMV 174
            +G+        L+D+ +  +    +V IE+P NP     D+Q  AD  KA +   +L+V
Sbjct: 117 AHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILVV 176

Query: 175 DSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTN 234
           D+TF  P L    NFGADI++HSATK+  GHSD++ G L T    + +RL   +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGAI 236

Query: 235 VANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQV-FHSSLQDESFV 293
            +  ++ L  R L+T  +R+ + +Q+  KI E+L  +    S     +  H   Q     
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEHVVSVNYPGLPSHRGYQIAQKQ 296

Query: 294 KKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYIDQT- 351
            +  +GG    F +     +    L    + F  A SLGG+ESL+E  A MT   I +  
Sbjct: 297 HRDGLGGGMISFRVK-GGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAGIPKEA 355

Query: 352 ---------LIRFSIGCE 360
                    L+R S+G E
Sbjct: 356 REASGVYDDLVRVSVGIE 373

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  109 bits (273), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 109/381 (28%), Positives = 172/381 (45%), Gaps = 42/381 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+   +   P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE   + +    + + +SSG A     +         + IG  Y G H     ++  
Sbjct: 58  RKNLEEALAALENAKYGLAFSSGSATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 123 YGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFADKAH--SRGALLMVD 175
           +G+     +D+ +       +   +V IE+P NP     D+      A   ++  L++VD
Sbjct: 118 HGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P L    NFG DI++HSATK+  GHSD++ GVL T D+ + ++L+  +  +G   
Sbjct: 178 NTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAIP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH--SSLQDESFV 293
           +  +S L  R L+T  +R+ + +   TKI E L    ++ S VL   +   +S  D   V
Sbjct: 238 SPFDSWLAHRGLKTLHLRVRQAALTATKIAEFL----EQDSNVLAVNYPGLASNPDREIV 293

Query: 294 KKQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYID 349
           ++Q    +GG    F I     +   +     + F  A SLGG+ESL+E  A MT   I 
Sbjct: 294 QRQHRDGLGGGMISFRIK-GGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 350 QT----------LIRFSIGCE 360
           +           LIR S+G E
Sbjct: 353 KEQREASGVYDDLIRLSVGIE 373

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  108 bits (270), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 171/381 (44%), Gaps = 42/381 (11%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P  E E          YSR  +PN
Sbjct: 9   FATKAIHAGAHVDVHGSVIEPISLSTTFKQSA-PAQPLGEYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEG-HAVIYSSGLAAFHAAMTHFNPK---QLFIGQSYHGVH----GIAD 117
              LE   + +  G H + +SSG +A  A +    P+    + IG  Y G H     +A+
Sbjct: 58  RKNLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 118 ILSRNYGLIQRSLDDIEEYAQKG-DIVHIETPVNPF--GTSYDLQSFADKAHSRGALLMV 174
               +       + D+    +    ++ IE+P NP    T   L +   K  ++  L++V
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 175 DSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTN 234
           D+TF  P L    +FG D+++HSATK+  GHSD++ GVL T   E+ +RL+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 235 VANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRD----KYSKVLRQVFHSSLQDE 290
            +  ++ L  R L+T  +R+ + +   TKI E L SN       Y  +     H  +Q +
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSNDRVIAVNYPGLASHPSHDVVQRQ 296

Query: 291 SFVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYI- 348
               +  +GG    F I     E   +     + F  A SLGG+ESL+E  A MT   I 
Sbjct: 297 ---HRDGLGGGMISFRIK-GGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGIP 352

Query: 349 -DQ--------TLIRFSIGCE 360
            DQ         LIR S+G E
Sbjct: 353 EDQREASGVYDDLIRLSVGIE 373

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  107 bits (268), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 107/380 (28%), Positives = 170/380 (44%), Gaps = 40/380 (10%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
            AT  IH     +    V  PI+++TTF+       P    E          YSR  +PN
Sbjct: 9   FATLAIHAGAHTDVHGSVIEPISLSTTFK-QSAPAQPIGAYE----------YSRSQNPN 57

Query: 66  ATRLESIFSEILEGH-AVIYSSGLAAFHAAMTHF--NPKQLFIGQSYHGVHGIADILSRN 122
              LE+  + +      + +SSG A     +     +   + IG  Y G H     ++  
Sbjct: 58  RANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVAHA 117

Query: 123 YGLIQRSLDDIEE-----YAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGA--LLMVD 175
           +G+     +D+E            +V +E+P NP     D++  AD AH+     L++VD
Sbjct: 118 HGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVVVD 177

Query: 176 STFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNV 235
           +TF  P +      GADI++HSATK+  GHSD++ GVL T +E + +RL+  +  +G   
Sbjct: 178 NTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGAVP 237

Query: 236 ANLESHLLLRSLRTFEMRILKQSQNVTKIVEHL-VSNRDKYSKVLRQVFHSSLQDESFVK 294
           +  +S L  R L+T  +R+   +Q+  +I + L  S+R ++        H +    + V+
Sbjct: 238 SPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRVEHVNYPGLSSHPAY---AVVQ 294

Query: 295 KQ---LIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA-MTDPYIDQ 350
           KQ    +GG    F I         +     + F  A SLGG+ESL+E  A MT   I +
Sbjct: 295 KQHRDALGGGMISFRIK-GGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMTHGGIPR 353

Query: 351 ----------TLIRFSIGCE 360
                      LIR S+G E
Sbjct: 354 EQREASGVFDNLIRLSVGIE 373

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 106/389 (27%), Positives = 162/389 (41%), Gaps = 82/389 (21%)

Query: 26  PINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEIL-----EGH 80
           P+ ++TTF+ D         R D +  D    YSR G+P  + L     ++      + H
Sbjct: 23  PVYMSTTFKVDL--------RSDGQAYD----YSRSGNPTRSLLHRQLGQLYNVPESQVH 70

Query: 81  AVIYSSGLAAFHAAM-------THFNPKQLFIGQSYHGVHGIADIL-----SRNYGLIQR 128
           AV  SSG+ A  A M       T   P  L     Y G   +   L     +R   +   
Sbjct: 71  AV--SSGMTALDAIMRGLILSNTSHVPTILAGDDLYGGSDRLLTFLKTRCHARTINVDTS 128

Query: 129 SLDDIEEY---AQKGDIVHIETPVNPFGTSYDLQ---SFADKAHSRGALLMVDSTFAPPP 182
           + D  +E      K D VHIE+P NP     D+    SF  K+ S    ++VD+T     
Sbjct: 129 NFDKFQEAFLSVDKVDCVHIESPTNPMCKVVDVPRIISFV-KSVSPQTYVIVDNTMMSGL 187

Query: 183 LQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYL-----GTNVAN 237
           L    + GAD +  SATKF  GH D+++GV+V+++++++     D IY      G  +A 
Sbjct: 188 LCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVNATGCGLAP 242

Query: 238 LESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSN----RDKYSKVLRQVF---------- 283
           ++S LL+R L+T  +R+ +Q  N   + E L  +    + K + +LR  +          
Sbjct: 243 MDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVGLQSHPQFS 302

Query: 284 -HSSLQDESFVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEW-- 340
            H S  D          G TP+    + +K         LK +    S G V SLI    
Sbjct: 303 LHRSFNDGPGAVLSFETGSTPLSRRIVSSKA--------LKIWSVTVSFGCVNSLISLPC 354

Query: 341 ---RAMTDPYI------DQTLIRFSIGCE 360
               A  DP +       + LIR  +G E
Sbjct: 355 SMSHASIDPNVRKEREFPEDLIRLCVGIE 383

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 144/341 (42%), Gaps = 30/341 (8%)

Query: 16  IKNRVPD-----VAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLE 70
           +  R PD     V PP+   +T  + + D        D+E M     Y   G P    LE
Sbjct: 18  VIGRNPDEQNGFVNPPLYKGSTIIHKKLD--------DVEHMKGRFFYGTAGSPTIANLE 69

Query: 71  SIFSEILEGHAVIYS-SGLAAFHAAMTHFNPKQ---LFIGQSYHGVHGIADILSRNYGLI 126
             ++ +  G   + S SGL +   A+          L     Y     + D L   +G+ 
Sbjct: 70  DAWTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLCDGLLAKFGIE 129

Query: 127 QRSLD-----DIEEYAQKGD-IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP 180
               D     DI++  +    ++ +E+P +      D+ +    A   G   ++D+T+A 
Sbjct: 130 TEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNTWAT 189

Query: 181 PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLES 240
           P    A   G DI + + TK+ GGHSDLL G L + +EE    L+     +       + 
Sbjct: 190 PLFFDAHGHGIDISLEAGTKYLGGHSDLLIG-LTSANEECWPLLRSTYDAMAMLPGADDC 248

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGG 300
            L LR +RT  +R LK+++     +   + +RD+  KVL   F      E +V+     G
Sbjct: 249 LLALRGMRTLHLR-LKEAERKALDLAAWLEDRDEVEKVLHPAFKDCPGHEYWVRDY--KG 305

Query: 301 YTPVFSITLMN---KEQCKQLPLKLKYFHHATSLGGVESLI 338
            + +FSI L +   +   + +  K+K FH   S GG ESLI
Sbjct: 306 SSGLFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLI 346

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 103/389 (26%), Positives = 163/389 (41%), Gaps = 71/389 (18%)

Query: 24  APPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEIL---EGH 80
            PP+ ++TTF+ D N+       ED +  D    YSR G+P  + L+    ++    + +
Sbjct: 24  VPPVYLSTTFKVDLNN-------EDAQNYD----YSRSGNPTRSVLQHQIGKLYRVPQEN 72

Query: 81  AVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIA-DILSRNYGLIQRSLD-------- 131
            +  SSG+ A    +       L  G   H    IA D L   YG  QR L+        
Sbjct: 73  VLAVSSGMTALDVILRGL---VLLNGTDNHTPTIIAGDDL---YGGTQRLLNFFKQQSHA 126

Query: 132 --------DIEEYA------QKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
                   D E++        K D V +E+P NP     D+       K  S    ++VD
Sbjct: 127 VSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPDTTVVVD 186

Query: 176 STFAP----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYL 231
           +T        PLQ   N G D++  SATK+  GH DL+ GV+++K  E++ +L       
Sbjct: 187 NTMMSGLNCNPLQL--NPGCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVINST 244

Query: 232 GTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNR-----DKYSKVLRQVFHSS 286
           G  ++ ++S LL+R L+T  +R+ +Q +N   I+ H + N       + +K  +  F   
Sbjct: 245 GAGLSPMDSWLLVRGLKTLGVRLYQQQRNAM-ILAHWLENSCGFKPTRTNKATKTRFVGL 303

Query: 287 LQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PLKLKYFHHATSLGGVESLIEW--- 340
             +  F + K    G   V S    + E  K+L    KL  +    S G V SL+     
Sbjct: 304 RSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCK 363

Query: 341 --RAMTDPYI------DQTLIRFSIGCES 361
              A  DP +       + L+R   G E+
Sbjct: 364 MSHASIDPELRKERDFPEDLVRLCCGIEN 392

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 121/263 (46%), Gaps = 37/263 (14%)

Query: 26  PINVATTFRYD-ENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLE----SIFSEILEGH 80
           P+ ++TTF+ D EN+    N + D         YSR G+P  T L+     ++ +I    
Sbjct: 11  PLYLSTTFKVDLENE----NNQYD---------YSRSGNPTRTLLQQQVAKLYDDIDPNF 57

Query: 81  AVIYSSGLAAFHAAMTHFNPKQ-----LFIGQS-YHGVHGIADILSRNYGLIQRSLDDIE 134
               SSG+ A    +  F P +     +  G   Y G   + ++L  +   +   L   E
Sbjct: 58  VFAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTE 117

Query: 135 EYAQK-----------GDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVDSTFAPP 181
            +  K            DI+ +E+P NP     D+       + +S   L+++D+T    
Sbjct: 118 NFKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMSG 177

Query: 182 PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESH 241
                  FGAD++  SATK+  GH D+++GV++ K++ +++++       G+ +  ++S 
Sbjct: 178 LNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDSW 237

Query: 242 LLLRSLRTFEMRILKQSQNVTKI 264
           LL+R L+T  +R+ KQ  N   I
Sbjct: 238 LLIRGLKTLSIRLHKQQLNALAI 260

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 134/305 (43%), Gaps = 17/305 (5%)

Query: 47  EDLEFMDRTPIYSRLGHPNATRLESIFSEILEGHAVIYS-SGLAAFHAAMTHF--NPKQL 103
           E LE +     Y   G P    LE  ++E+      + S +GL +   A+     +   +
Sbjct: 46  ESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHI 105

Query: 104 FIGQSYHG-VHGIADILSRNYGLIQRSLD-----DIEEYAQKG-DIVHIETPVNPFGTSY 156
            +  S +G      + + R +G+     D     DIEE  +    ++ +E+P +      
Sbjct: 106 LLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQ 165

Query: 157 DLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTK 216
           D+ +    A       ++D+T+A P    A ++G DI + + TK+ GGHSDLL G L + 
Sbjct: 166 DVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG-LTSA 224

Query: 217 DEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYS 276
           +      L+     +G      + HL LR LRT ++R+ K+++    I+   +  R++  
Sbjct: 225 NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRV-KEAERKALILAEWLEARNEVE 283

Query: 277 KVLRQVFHSSLQDESFVKKQLIGGYTPVFSITL---MNKEQCKQLPLKLKYFHHATSLGG 333
           ++L   F        +V+     G T VF+  L    ++   K +  K++ F    S GG
Sbjct: 284 RILHPAFEDCPGHSLWVRD--YSGSTGVFTFILKDQFSRAGLKDMLEKMQIFKLGYSWGG 341

Query: 334 VESLI 338
            ESL+
Sbjct: 342 YESLL 346

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 127/305 (41%), Gaps = 17/305 (5%)

Query: 47  EDLEFMDRTPIYSRLGHPNATRLESIFSEILEGHAVIYS-SGLAAFHAAMTHFNPKQ--- 102
           EDLE       Y   G P    LE  ++ +      + S SGL +   A+   +      
Sbjct: 46  EDLEQRKGRFFYGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHI 105

Query: 103 LFIGQSYHGVHGIADILSRNYGLIQRSLD-----DIEEYAQKGD-IVHIETPVNPFGTSY 156
           L     Y     + D L   +G+     D     DIE+  +    ++ +E+P +      
Sbjct: 106 LITDSVYFPTRMLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQ 165

Query: 157 DLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTK 216
           ++ +    A   G   ++D+T+A P    A   G DI + + TK+ GGHSDLL G LV+ 
Sbjct: 166 NIPALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLG-LVSA 224

Query: 217 DEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYS 276
           +EE    L+     +       +  L LR +RT  +R LK+++     +      RD+  
Sbjct: 225 NEECWPLLRSTYDAMAMLPGADDCLLALRGMRTLHLR-LKEAERKALDLAAWFKKRDEVE 283

Query: 277 KVLRQVFHSSLQDESFVKKQLIGGYTPVFSITL---MNKEQCKQLPLKLKYFHHATSLGG 333
           KVL   F      E +V+     G + +FSI L     +   + +   +K F    S GG
Sbjct: 284 KVLHPAFEDCPGHEYWVRDY--KGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWGG 341

Query: 334 VESLI 338
            +SLI
Sbjct: 342 YDSLI 346

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 138/341 (40%), Gaps = 30/341 (8%)

Query: 16  IKNRVPD-----VAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLE 70
           +  R PD     V PP+   +T  +         +  D+E M     Y   G P    LE
Sbjct: 18  VIGRNPDEQNGFVNPPLYKGSTIIH--------KKLSDVESMKGRFFYGTAGSPTIANLE 69

Query: 71  SIFSEILEGHAVIYS-SGLAAFHAAMTHFNPKQ---LFIGQSYHGVHGIADILSRNYGLI 126
             ++ +      + S SGL +   A+          L     Y     + D L   +G+ 
Sbjct: 70  DAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTRVLCDGLLAKFGIQ 129

Query: 127 QRSLD-----DIEEYAQKG-DIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP 180
               D     DIE+  +    ++ +E+P +      D+ +    A   G   ++D+T+A 
Sbjct: 130 TEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTILDNTWAT 189

Query: 181 PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLES 240
           P    A   G DI + + TK+ GGHSD L G L + ++E    L+     +       + 
Sbjct: 190 PLFFDAHGHGIDISLEAGTKYLGGHSDFLLG-LTSANQECWPLLRSTYDAMAMLPGADDC 248

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGG 300
            L LR +RT  +R LK+++     +   +  RD+   VL   F      + +++     G
Sbjct: 249 QLALRGMRTLHLR-LKEAERKALDLAAWLGKRDEVETVLHPAFEDCPGHKYWLRD--YKG 305

Query: 301 YTPVFSITL---MNKEQCKQLPLKLKYFHHATSLGGVESLI 338
            + +FSI L     +   + +  K+K FH   S GG ESLI
Sbjct: 306 SSGLFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLI 346

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 100/389 (25%), Positives = 163/389 (41%), Gaps = 71/389 (18%)

Query: 24  APPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEIL---EGH 80
            PP+ ++TTF+ D N+       E  +  D    YSR G+P  + L++   ++    + +
Sbjct: 24  VPPVYLSTTFKVDLNN-------EAAQNFD----YSRSGNPTRSVLQNQIGKLYRVPQEN 72

Query: 81  AVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIA-DILSRNYGLIQRSLD-------- 131
            +  SSG+ A    +       L  G   H    IA D L   YG  QR L+        
Sbjct: 73  VLAVSSGMTALDIILRGL---VLLNGTDNHTPTIIAGDDL---YGGTQRLLNFFKHQTHA 126

Query: 132 --------DIEEY------AQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
                   D E++        K D V +E+P NP     D+       K  S   +++VD
Sbjct: 127 VTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFVKRISPETIVIVD 186

Query: 176 STFAP----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYL 231
           +T        PLQ   N   D++  SATK+  GH DL+ GV+++K  E++ +L       
Sbjct: 187 NTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVVNST 244

Query: 232 GTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKY-----SKVLRQVFHSS 286
           G  ++ ++S LL+R L+T  +R+ +Q +N   I+ H + N   +     +K  +  F   
Sbjct: 245 GAGLSPMDSWLLVRGLKTLGVRLHQQQRNAM-ILAHWLENSCGFKPTETNKATKTRFVGL 303

Query: 287 LQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PLKLKYFHHATSLGGVESLIEW--- 340
             +  F + +    G   V S    + E  K+L    KL  +    S G V SL+     
Sbjct: 304 RSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCK 363

Query: 341 --RAMTDPYI------DQTLIRFSIGCES 361
              A  DP +       + L+R   G E+
Sbjct: 364 MSHASIDPELRKERDFPEDLVRLCCGIEN 392

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 122/289 (42%), Gaps = 17/289 (5%)

Query: 58  YSRLGHPNATRLESIFSEILEGHAVIYS-SGLAAFHAAMTHFNPKQ---LFIGQSYHGVH 113
           Y   G P    LE+ ++ +  G   + S SGL +   A+   +      L     Y    
Sbjct: 56  YGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTR 115

Query: 114 GIADILSRNYGLIQRSLD-----DIEEYAQKGD-IVHIETPVNPFGTSYDLQSFADKAHS 167
            + D L   +G+     D     DIE+  +    ++ +E+P +      D+ +    A  
Sbjct: 116 MLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKK 175

Query: 168 RGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDD 227
            G   ++D+T+A P    A   G DI + + TK+ GGHSDLL G L + +EE    L+  
Sbjct: 176 HGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIG-LASANEECWPLLRST 234

Query: 228 RIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL 287
              +       +  L LR +RT  +R LK+ +     +   + NRD+  KVL   F    
Sbjct: 235 YDAMAMLPGAEDCQLALRGMRTLHLR-LKEVERKALDLAAWLGNRDEVEKVLHPAFEDCP 293

Query: 288 QDESFVKKQLIGGYTPVFSITLMN---KEQCKQLPLKLKYFHHATSLGG 333
             E +V+     G + +FSI L N   +   +++   +K      S GG
Sbjct: 294 GHEYWVRDY--KGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 103/412 (25%), Positives = 173/412 (41%), Gaps = 71/412 (17%)

Query: 1   MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSR 60
           M  + L T +++     ++     PP+ ++TTF+ D ++       E  +  D    YSR
Sbjct: 1   MAFKTLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSN-------ETAQDYD----YSR 49

Query: 61  LGHPNATRLESIFSEIL---EGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIA- 116
            G+P  + L++   ++    + + +  SSG+ A    +       LF G   H    IA 
Sbjct: 50  SGNPTRSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGL---VLFNGTDNHTPTIIAG 106

Query: 117 DILSRNYGLIQRSLD----------------DIEEYA------QKGDIVHIETPVNPFGT 154
           D L   YG  QR L+                D E++        K D V +E+P NP   
Sbjct: 107 DDL---YGGTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCK 163

Query: 155 SYDLQSFAD--KAHSRGALLMVDSTFAPP----PLQYAWNFGADIIMHSATKFFGGHSDL 208
             D+       K  S    ++VD+T        PLQ   + G D++  SATK+  GH DL
Sbjct: 164 VVDIPRILRFVKCISPETTVVVDNTMMSGLNCNPLQL--DPGCDVVYESATKYLNGHHDL 221

Query: 209 LSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHL 268
           + GV+++K  E++ +L       G  ++ ++S LL+R L+T  +R+ +Q +N   I+ H 
Sbjct: 222 MGGVIISKTAEIAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAM-ILAHW 280

Query: 269 VSNRDKY-----SKVLRQVFHSSLQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PL 320
           + +   +     +K  +  F     +  F + +    G   V S    + E  K+L    
Sbjct: 281 LEDSCGFKPTETNKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSK 340

Query: 321 KLKYFHHATSLGGVESLIEW-----RAMTDPYI------DQTLIRFSIGCES 361
           KL  +    S G V SL+        A  DP +       + LIR   G E+
Sbjct: 341 KLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIEN 392

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 164/398 (41%), Gaps = 56/398 (14%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           L T L++    K+      PP+  +TTF+  +    P  +  D         Y+R G+P 
Sbjct: 16  LHTRLVNVTQQKDPYGASVPPLYQSTTFK--QESFEPGCQEYD---------YTRSGNPT 64

Query: 66  ATRLESIFSEI--LEGHAVI-YSSGLAAFHAAMTHF--------NPKQLFIGQSYHGVHG 114
            + +E    ++  + G  V+  SSG++A    +            P  +     Y G   
Sbjct: 65  RSVVERQVGKLYGVCGEQVLAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQR 124

Query: 115 IADILSRNYGLIQRSLDDIEEYAQKGDI---------VHIETPVNPFGTSYDLQSFAD-- 163
           +  IL    G ++    D  + A+  D+         V +E+P NP     DL       
Sbjct: 125 LLGILGIQ-GHVKVLHVDTSDAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFV 183

Query: 164 KAH--SRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVS 221
           K+H    G  ++VD+T            GAD++  SATKF  GH D+++GV+V    E++
Sbjct: 184 KSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELA 243

Query: 222 KRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKV--- 278
           + +      +G  +A ++S LL+R L+T  +R+ +Q  N   ++ H + +   ++     
Sbjct: 244 QDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQHNAM-VLAHWLQDSCGFAPTEQN 302

Query: 279 --LRQVFHSSLQDESF-VKKQLIGGYTPVFSITLMNKEQCKQLPL--KLKYFHHATSLGG 333
             LR  F        F + +    G   V SI   + E  +++    K KY++   S G 
Sbjct: 303 SQLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIELSEKIVCSKKFKYWNVTVSFGC 362

Query: 334 VESLIEW-----RAMTDPYI------DQTLIRFSIGCE 360
           V SLI        A  DP +       + LIR   G E
Sbjct: 363 VNSLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIE 400

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 92/406 (22%), Positives = 168/406 (41%), Gaps = 61/406 (15%)

Query: 1   MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFR---YDENDLVPWNEREDLEFMDRTPI 57
           M++Q L T L+      ++     PPI  +TTF+    +++   P++             
Sbjct: 1   MSQQSLQTKLVSVVQHVDQHGSSVPPIYQSTTFKIGSLEDDASQPYD------------- 47

Query: 58  YSRLGHPNATRLESIFSEILE---GHAVIYSSGLAAFHA---AMTHFNPKQ---LFIGQS 108
           Y+R G+P  T ++    ++ +      +  SSG+ A      A+   N  +   +  G  
Sbjct: 48  YTRSGNPTRTVVQHQIGKLYDVDAAQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDD 107

Query: 109 YHGVHGIADIL----SRNYGLI-------QRSLDDIEEYAQKGDIVHIETPVNPFGTSYD 157
            +G  G   +L    SRN+  +         +  ++ +  +  D V +E+P NP     D
Sbjct: 108 LYG--GTQRLLTHLESRNHARVLHVDTANYETFVEVFKQQEHVDCVLLESPTNPLLKVAD 165

Query: 158 LQSFAD--KAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT 215
           L       K+ +   L+ +D+T     L     F  D++  SATK+  GH D+++G++VT
Sbjct: 166 LPRLTHFIKSANEACLVAIDNTMMSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVT 225

Query: 216 KDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSN---- 271
           +  ++++ +       G+ ++  +S LL+R L+T  +R+ +Q  N   ++ H + N    
Sbjct: 226 QTLKMAQEIYFVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQHNAM-VLAHWLENSCGF 284

Query: 272 --RDKYSKVLRQVFHSSLQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PLKLKYFH 326
             +       R  F        F + K    G   V S    + E  ++L    K+K + 
Sbjct: 285 VGKKGVKGSPRTRFVGLKSHPQFELHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWA 344

Query: 327 HATSLGGVESLIEW-----RAMTDPYIDQT------LIRFSIGCES 361
              S G V SLI        A  DP + Q       L+R   G E+
Sbjct: 345 VTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIEN 390

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 131/285 (45%), Gaps = 35/285 (12%)

Query: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65
           +++ L+    I+++      P+ ++TTF+ D ++  P ++  D         YSR G+P 
Sbjct: 9   MSSQLVTNLKIRDKHGASVQPLYLSTTFKVDLDN--PESQVFD---------YSRSGNPT 57

Query: 66  ATRLESIFSEILE---GHAVIYSSGLAAFH--------AAMTHFNPKQLFIGQSYHGVHG 114
            + L+    ++ E    H +  +SG+ A          ++ TH     +  G   +G   
Sbjct: 58  RSLLQYQIGKLYEVPVEHVLAVASGMTALDVILRGLVISSATHV--PTIIAGDDLYGGSN 115

Query: 115 --IADILSRNYG-LIQRSLDDIEEYA------QKGDIVHIETPVNPFGTSYDLQSFAD-- 163
             +A + S+++   +     D+E++        K D V +E+P NP     D+       
Sbjct: 116 RLLAYLESKSHARAVHVDTTDMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYV 175

Query: 164 KAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKR 223
           K  S   +++VD+T           +G D++  SATK+  GH D++ G++V K  E+++ 
Sbjct: 176 KRISPSTVVIVDNTMMSGLQCNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQE 235

Query: 224 LKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHL 268
           +       G+ ++ ++S LL R L+T  +R+ +Q  N   I + L
Sbjct: 236 IYYVVNATGSGLSPMDSWLLNRGLKTLGVRMYQQQYNSMVIAQWL 280

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 96/389 (24%), Positives = 160/389 (41%), Gaps = 71/389 (18%)

Query: 24  APPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFSEIL---EGH 80
            PP+ ++TTF+ D N+       +D +       YSR G+P  + L++   ++    + +
Sbjct: 24  VPPVYLSTTFKVDLNN----EAAQDYD-------YSRSGNPTRSVLQNQIGKLYRVPQEN 72

Query: 81  AVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIA-DILSRNYGLIQRSLD-------- 131
            +  SSG+ A    +       L  G   H    IA D L   YG  QR L+        
Sbjct: 73  VLAVSSGMTALDIILRGL---VLLNGTEDHTPTIIAGDDL---YGGTQRLLNFFKHQTHA 126

Query: 132 --------------DIEEYAQKGDIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVD 175
                          + +   K D V +E+P NP     D+       K  S    ++VD
Sbjct: 127 VTVHVDTSNFDRFKTVFQSLDKVDCVLLESPTNPLCKVVDIPKILRYVKCVSPDTKVIVD 186

Query: 176 STFAP----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYL 231
           +T        PLQ   N   D++  SATK+  GH DL+ GV+++K  E++ +L       
Sbjct: 187 NTMMSGLNCNPLQL--NPSCDVVYESATKYLNGHHDLMGGVIISKTAEIASKLYFVVNST 244

Query: 232 GTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKY-----SKVLRQVFHSS 286
           G  ++ ++S LL+R L+T  +R+ +Q +N   I+ H + +   +     +K  +  F   
Sbjct: 245 GAGLSPMDSWLLVRGLKTLGVRLHQQQRNAM-ILAHWLEDSCGFKPTATNKATKTRFVGL 303

Query: 287 LQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PLKLKYFHHATSLGGVESLIEW--- 340
             +  F + +    G   V S    + E  K+L    KL  +    S G V SL+     
Sbjct: 304 RSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCK 363

Query: 341 --RAMTDPYI------DQTLIRFSIGCES 361
              A  DP +       + L+R   G E+
Sbjct: 364 MSHASIDPEVRKERDFPEDLVRLCCGIEN 392

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 166/409 (40%), Gaps = 70/409 (17%)

Query: 1   MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYD--ENDLVPWNEREDLEFMDRTPIY 58
           M    L T L+     K++     PP+  +TTF+    E+D             D+   Y
Sbjct: 1   MPDHSLHTKLVSVTHHKDQHGSSVPPLYQSTTFKQSSLEDD------------ADQEYDY 48

Query: 59  SRLGHPNATRLESIFSEI--LEGHAVI-YSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGI 115
           +R G+P  + L+   +++  + G  V   SSG+      +     + L +G S H    I
Sbjct: 49  TRSGNPTRSVLQEQIAKLYNVPGFQVFAVSSGMTCLDVIL-----RALVLGNSNHTPTII 103

Query: 116 A-DILSRNYGLIQRSLDDIEEY------------------AQKG----DIVHIETPVNPF 152
           A D L   YG  QR L  +E                    A  G    D V +E+P NP 
Sbjct: 104 AGDDL---YGGTQRLLTFLERKNHARVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPL 160

Query: 153 GTSYDL---QSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLL 209
               DL     F  +A+ +   ++VD+T           F  D++  S TK+  GH D++
Sbjct: 161 CKVADLPGLTKFIKQANPK-CHVVVDNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIM 219

Query: 210 SGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLV 269
           +GV++ + +E+++ L       G  ++ ++  LL+R L+T  +R+ +Q  N   +   L 
Sbjct: 220 AGVIIGRSKEIAQELYFVINSTGCGLSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLY 279

Query: 270 SNR----DKYSKVLRQVFHSSLQDESF-VKKQLIGGYTPVFSITLMNKEQCKQL--PLKL 322
           S+     +  +K+LR  +        F + +    G   V S    + E  K+L    KL
Sbjct: 280 SSCGFRPNSENKLLRTRYVGLKSHPQFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKL 339

Query: 323 KYFHHATSLGGVESLIEW-----RAMTDPYI------DQTLIRFSIGCE 360
           K +    S G V SLI        A  DP +       + L+R   G E
Sbjct: 340 KIWAVTVSFGCVNSLISMPCKMSHASIDPELRKERDFPEDLVRLCCGIE 388

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 124/286 (43%), Gaps = 42/286 (14%)

Query: 1   MTRQDLATTLI---HGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPI 57
           M++  L T+L+   H D   + VP    P+  +TTF+    D         L+  D    
Sbjct: 1   MSKPSLNTSLVSVSHNDKYGSSVP----PLYQSTTFKASSFD--------QLQEYD---- 44

Query: 58  YSRLGHPNATRLESIFS---EILEGHAVIYSSGLAAFHAAM------THFNPKQLFIGQS 108
           Y+R G+P  T L+   +   ++        SSG+ A    +      +   P  +     
Sbjct: 45  YTRSGNPTRTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDL 104

Query: 109 YHGVHGIADIL-SRNYG-LIQRSLDDIEEYAQ------KGDIVHIETPVNPFGTSYDLQS 160
           Y G   +   L +RN+  +I     D E + +      + DIV +E+P NP     DL  
Sbjct: 105 YGGTQRLLTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPR 164

Query: 161 FADKAHSRG-----ALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT 215
                  +G       ++VD+T           FGAD++  S TK+  GH D+++GV++ 
Sbjct: 165 LCQFVKQKGGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIA 224

Query: 216 KDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNV 261
           K ++V+  +       G  ++ ++S LL+R L+T  +R+ KQ  N 
Sbjct: 225 K-KDVAPSVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINA 269

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 101/244 (41%), Gaps = 36/244 (14%)

Query: 145 IETPVNPFGTSYDLQSFAD--KAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFF 202
           +E+P NP     D+ +     KAH+ G  ++VD+T            GAD +  SATK+ 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 203 GGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVT 262
            GH D+++GV+V     +++        +G  +A +++ LL+R L+T  +R+ KQ  N  
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 263 KIVEHLVSNRDKYSKVLRQVFHSSLQDESFVK----------KQLIGGYTPVFSI----- 307
            +   L     +     R V  +      FV           +    G   V SI     
Sbjct: 268 VLAHWL-----REVCGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDT 322

Query: 308 TLMNKEQCKQLPLKLKYFHHATSLGGVESLIEW-----RAMTDPYIDQT------LIRFS 356
            L  +  C +   KL+++    S G V SLI        A  DP + +       LIR S
Sbjct: 323 ALSERIVCSK---KLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLS 379

Query: 357 IGCE 360
            G E
Sbjct: 380 CGVE 383

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 103/243 (42%), Gaps = 22/243 (9%)

Query: 141 DIVHIETPVNPFGTSYDLQSFAD--KAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSA 198
           D V +E+P NP     DL       K  +   ++ +D+T     L    +F  D++  SA
Sbjct: 151 DCVLLESPTNPLLKVADLPRITRFVKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESA 210

Query: 199 TKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQS 258
           TK+  GH D+++G++V +  +++  +       G  ++  +S LL+R L+T  +RI +Q 
Sbjct: 211 TKYLNGHHDIMAGIVVARSAQLAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQ 270

Query: 259 QNVTKIVEHL------VSNRDKYSKVLRQVFHSSLQDESF-VKKQLIGGYTPVFSITLMN 311
            N   +   L      VS+  K    L+  F        F + K    G   V S    +
Sbjct: 271 HNAMVLAHWLENSCGFVSHGKKGKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGS 330

Query: 312 KEQCKQL--PLKLKYFHHATSLGGVESLIEW-----RAMTDPYIDQT------LIRFSIG 358
            E  ++L    K+K +    S G V SLI        A  DP + Q       L+R   G
Sbjct: 331 FEHSRRLVSSKKIKLWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCG 390

Query: 359 CES 361
            E+
Sbjct: 391 IEN 393

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 119/276 (43%), Gaps = 58/276 (21%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----P 181
           SL D+E     G+    V +ETP NP     DL      A+  G  +++D T        
Sbjct: 411 SLKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNID 470

Query: 182 PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESH 241
            L YA     DI+  S TK F G S++++G +V   +E  K     ++++ + +   E H
Sbjct: 471 VLPYA-----DIVCSSLTKIFSGSSNVIAGSMVLNPQE--KLYSFAQVFM-SQLGEYEDH 522

Query: 242 L-------LLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQD-ESFV 293
           L       L R+ R F  R +K +QN   +++ ++  ++  SK+ +++F+ SL   ES V
Sbjct: 523 LWCEDAIYLERNSRDFIARTIKTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKV 582

Query: 294 KKQLI------------GGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWR 341
               +            GGY  +FS+     EQ        K F +  +L    SL    
Sbjct: 583 NYDAVRCKSIDKDSDEEGGYGGLFSLAFNKIEQA-------KIFFNELNLSKGPSLGTNF 635

Query: 342 AMTDPY----------------IDQTLIRFSIGCES 361
            ++ PY                ++++L+R SIG ES
Sbjct: 636 TLSCPYTVLMYYDKLDEVAKYEVEESLVRVSIGIES 671

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 146/363 (40%), Gaps = 71/363 (19%)

Query: 14  DDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIF 73
           DD KNR   V  PI   T++ +  ND     +   LE      +YSR  +P     E   
Sbjct: 18  DDNKNRPRAV--PIYATTSYVF--NDSKHGAQLFGLEVPGY--VYSRFQNPTNNVFEERI 71

Query: 74  SEILEGHA-VIYSSGLAAFHAAMT---HFNPKQLFIGQSYHGVHGIADILSRNYGLIQRS 129
           + +  G A V  SSG AA   A++   H     +     Y G +    +  +  G+  R 
Sbjct: 72  AALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFKVAFKRLGVEARF 131

Query: 130 LD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPP-- 181
           +D     D E+ + ++   V++E+  NP     D +     AH  G  ++VD+TF     
Sbjct: 132 VDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHKHGIPVVVDNTFGAGGF 191

Query: 182 ---PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT------KD--EEVSKRLKDDRIY 230
              PL+    FGADI+ HSATK+ GGH   ++GV+V       KD  E+  +  K    Y
Sbjct: 192 FCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWKDYPEKFPQFSKPAEGY 247

Query: 231 -------------------------LGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIV 265
                                    LG  +    + LLL+ + T  +R  + + N   + 
Sbjct: 248 HGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVETLSLRCERHASNALALA 307

Query: 266 EHLVSNRDKYSKVLRQVFHSSLQDESF---VKKQLIGGYTPVFSITL-----MNKEQCKQ 317
           + L     + S  +  V +  L+  S     KK L  G+  V S  +      ++E+ K+
Sbjct: 308 KWL-----EKSPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLSFGVKDLPNQSEEEVKK 362

Query: 318 LPL 320
            P 
Sbjct: 363 NPF 365

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 125/305 (40%), Gaps = 62/305 (20%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAAMT---HFNPKQLFIGQSYHGV 112
           +YSR+G+P    LE  + +      AV  SSG AA   A+T   H     +     Y G 
Sbjct: 55  MYSRVGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGT 114

Query: 113 HGIADILSRNYGLIQRSL-----DDIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R +     +D E+ + +K   V+IE+  NP     D +     AH
Sbjct: 115 YNQFKVAFKRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT------ 215
             G  ++VD+TF        P+++    G DI+ HSATK+ GGH   ++GV+V       
Sbjct: 175 KHGIPVVVDNTFGAGGFFCQPIKH----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPW 230

Query: 216 KD--EEVSKRLKDDRIY-------------------------LGTNVANLESHLLLRSLR 248
           KD  E+  +  K    Y                         LG  +  + + LLL+ + 
Sbjct: 231 KDYPEKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVE 290

Query: 249 TFEMRILKQSQNVTKIVEHLVS----NRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304
           T  +R  +Q QN  K+ + L      N   Y  +    +H +       KK L  G+  V
Sbjct: 291 TLSLRAERQGQNALKLAQWLEKSPHVNWVSYPGLPSHPYHDN------AKKYLDNGFGGV 344

Query: 305 FSITL 309
            SI +
Sbjct: 345 LSIGV 349

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 87/365 (23%), Positives = 143/365 (39%), Gaps = 75/365 (20%)

Query: 14  DDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTP--IYSRLGHPNATRLES 71
           DD  NR   V  PI   T++ ++++      E     F  + P  +YSR  +P    LE 
Sbjct: 18  DDNANRPRAV--PIYATTSYVFNDS------EHGSNLFGLKVPGYVYSRFQNPTQNVLEE 69

Query: 72  IFSEILEG-HAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQ 127
             + +  G  AV  +SG AA   A   + H     +     Y G +    +  +  G+  
Sbjct: 70  RMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFKVAFKRLGIEA 129

Query: 128 RSL-----DDIEEYAQ-KGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPP 181
           R +     DD E+    K   V++E+  NP     D +   + AH  G  ++VD+TF   
Sbjct: 130 RFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVPVVVDNTFGAG 189

Query: 182 -----PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKD--------EEVSKRLKDDR 228
                P++Y    GADI+ HSATK+ GGH   ++G++V           E+  +  K   
Sbjct: 190 GFFCQPIKY----GADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPEKFPQFSKPAE 245

Query: 229 IY-------------------------LGTNVANLESHLLLRSLRTFEMRILKQSQNVTK 263
            Y                         LG  ++   + LL++ + T  +R  +  QN  K
Sbjct: 246 GYHGTIFNEAYGNLAYIVHVRVELLRDLGPAISPFAAFLLIQGIETLSLRGERHGQNALK 305

Query: 264 IVEHLVSNRDKYSKVLRQVFHSSLQDESF---VKKQLIGGYTPVFSITLMN-----KEQC 315
           + + L     + S  +  V +  L    +    KK L  G+  V S  + +     KE+ 
Sbjct: 306 LAQWL-----EQSPYVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSFGVKDIPGQTKEEL 360

Query: 316 KQLPL 320
              P 
Sbjct: 361 AAKPF 365

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 93/194 (47%), Gaps = 18/194 (9%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP---PPLQYAWNFGADIIMHSAT 199
           V +ETP NP     DL+   + A+  G  ++VD T        L Y     ADI+  S T
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNVDVLPY-----ADIVCTSLT 374

Query: 200 KFFGGHSDLLSG--VLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRS-LRTFEMRILK 256
           K F G S+++ G  +L  K    S  L+  R      +  LE  ++L +  R FE R  +
Sbjct: 375 KLFSGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTR 434

Query: 257 QSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQD-ESFVKKQLI----GGYTPVFSITLMN 311
            ++N  K+++ ++   +   K+ ++V++ ++   E+F   + +    GGY  +FS++  N
Sbjct: 435 TNENTMKLIQEVLLPEE--GKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFN 492

Query: 312 KEQCKQLPLKLKYF 325
           +E  K+    L  F
Sbjct: 493 EEDAKKFYNSLTVF 506

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 19/173 (10%)

Query: 57  IYSRLGHPNATRLESIFSEILEGHAVI-YSSGLAAFH---AAMTHFNPKQLFIGQSYHGV 112
           +YSR+G+P    LE   + +  G   +  +SG AA      A+       +     Y G 
Sbjct: 54  LYSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGT 113

Query: 113 HGIADILSRNYGLIQRSLD--DIEEYAQ----KGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R  +  + E+Y Q    K   +++E+  NP  T  D +   + AH
Sbjct: 114 YNQLKVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAH 173

Query: 167 SRGALLMVDSTFAPP-----PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV 214
             G  ++VD+TF        P++    FGADII HSATK+  GH   ++G +V
Sbjct: 174 KHGIPVVVDNTFGAAGFFCKPIE----FGADIITHSATKWINGHGTAIAGAIV 222

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 87/204 (42%), Gaps = 48/204 (23%)

Query: 109 YHGVHGIADILSRNYGLIQR-----SLDDIEE-YAQKGDIVHIETPVNPFGTSYDLQSFA 162
           Y G +    +  + +G+  R     S +D E+ + ++   V++E+  NP     D +   
Sbjct: 111 YGGTYNQFKVAFKRFGIEARFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIV 170

Query: 163 DKAHSRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT-- 215
             AH  G  +MVD+TF        PL+Y    GADI+ HSATK+ GGH   L G++V   
Sbjct: 171 AVAHKHGIPVMVDNTFGAGGFFCQPLKY----GADIVTHSATKWIGGHGTTLGGIIVDSG 226

Query: 216 ----KD--EEVSKRLKDDRIY-------------------------LGTNVANLESHLLL 244
               KD  E+  +  K    Y                         LG+ ++   + LL+
Sbjct: 227 KFPWKDYPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGSMISPFAAFLLI 286

Query: 245 RSLRTFEMRILKQSQNVTKIVEHL 268
           + + T  +R  +  QN  K+ + L
Sbjct: 287 QGVETLSLRGERHGQNALKLAKWL 310

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 19/173 (10%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           +YSR  +P +  LE  I +      A+  +SG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVASGQAAQTLAIQGLAHNGDNIVATSYLYGGT 114

Query: 113 HGIADILSRNYGLIQR-----SLDDIE-EYAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  + +G+  R     + DD E ++ ++   V++E+  NP     D +     AH
Sbjct: 115 YNQFKVAFKRFGIEARFVEGDNQDDFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV 214
             G  +MVD+TF        P++Y    G DI+ HSATK+ GGH   L GV++
Sbjct: 175 KHGIPVMVDNTFGAGGFFCQPIKY----GVDIVTHSATKWIGGHGTTLGGVII 223

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 114/264 (43%), Gaps = 41/264 (15%)

Query: 127 QRSLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPL 183
           Q+S+D +++    G+    V +E P NP     DL    + A++ G  ++VD T      
Sbjct: 378 QKSMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDET------ 431

Query: 184 QYAWNF-------GADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVA 236
             A  F        ADI+  S TK F G S++++G +V             + +   +  
Sbjct: 432 --AGGFVNIDVLPHADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFA-QQFFSSDSFE 488

Query: 237 NL----ESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESF 292
           +L    ++  L R+ R F  R L  ++N  +++E ++  ++   K+ +++F  SL  E  
Sbjct: 489 DLLWCEDAIYLERNSRDFATRTLTVNKNTQRLLEDVLLPQE--GKLFKKIFFPSLTSEET 546

Query: 293 VKKQLI-----GGYTPVFSITLMNKEQ----------CKQLPLKLKYFHHATSLGGVESL 337
            +   +     GGY  +FS+T   +EQ          CK   L    F  A     +   
Sbjct: 547 KRNYDVVLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTN-FTLACPYAILAHY 605

Query: 338 IEWRAMTDPYIDQTLIRFSIGCES 361
            E   +    ++++L+R S+G ES
Sbjct: 606 AELEEVAKYGVERSLVRVSVGLES 629

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 84/181 (46%), Gaps = 21/181 (11%)

Query: 51  FMDRTP--IYSRLGHPNATRLESIFSEILEG-HAVIYSSGLAAFHAAMT---HFNPKQLF 104
           F   TP  IYSR+ +P     E   + +  G  A+  SSG AA   A+T   H     + 
Sbjct: 47  FGLETPGYIYSRIMNPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVS 106

Query: 105 IGQSYHGVHGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDL 158
               Y G +    +  +  G+  + ++     D E+ + +K   V++ET  NP     D 
Sbjct: 107 TSYLYGGTYNQFKVAFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDF 166

Query: 159 QSFADKAHSRGALLMVDSTFAPP-----PLQYAWNFGADIIMHSATKFFGGHSDLLSGVL 213
           +   + AH  G  ++VD+TF        P++Y    G DI+ HSATK+ GGH   ++G +
Sbjct: 167 EKITEVAHKHGIPVVVDNTFGAGGYFCQPIKY----GCDIVTHSATKWIGGHGTTVAGAI 222

Query: 214 V 214
           +
Sbjct: 223 I 223

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 82/330 (24%), Positives = 126/330 (38%), Gaps = 62/330 (18%)

Query: 15  DIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPNATRLESIFS 74
           D K  V  V+  ++   T R   N L  W ER   E              NA+ LE   +
Sbjct: 217 DTKRDVQLVSTGMSAIFTAR---NVLAFWEERRSFE--------------NASTLEKSLN 259

Query: 75  EILEGHA---VIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSLD 131
           E  E       I           M  F   Q F         GI+D  SR    +Q  L 
Sbjct: 260 EQNEAKCDTVAILGLPFKDTRVLMETFGTCQFF---------GISD--SRGIAELQNCLS 308

Query: 132 DIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP---PPLQYAWN 188
                  +   V +ETP NP     DL      A   G  +++D T        L Y   
Sbjct: 309 S---RKNRFLAVFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNVDILPY--- 362

Query: 189 FGADIIMHSATKFFGGHSDLLSG-VLVTKD-------EEVSKRLKDDRIYLGTNVANLES 240
             ADI+  S TK F G S+++ G VL+  D       +E  +  + + +    +   LE+
Sbjct: 363 --ADIVCTSLTKLFSGTSNVMGGSVLLNPDSSLYPYAQEYFQSCEFEDLLWSEDAVVLEA 420

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVK-----K 295
           +      R FE R L+ ++N   ++  ++   +   K++++V++ ++  E   K     +
Sbjct: 421 N-----SRDFEARTLRTNENTVNLLTKVLLPEE--GKLIKKVYYPTVSSEETFKNYERVR 473

Query: 296 QLIGGYTPVFSITLMNKEQCKQLPLKLKYF 325
              GGY  +FSI   N+E  K     LK F
Sbjct: 474 NRQGGYGCLFSIAFHNEEDAKCFYDSLKVF 503

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 31/238 (13%)

Query: 145 IETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP---PPLQYAWNFGADIIMHSATKF 201
           +ETP NP     DL      A+  G  +++D T        L YA     DI+  S TK 
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLTKL 358

Query: 202 FGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTN-----VANLESHLLLRSLRTFEMRILK 256
           F G S+++ G L+   +  S      R ++ ++     +   ++ +L  + R FE R ++
Sbjct: 359 FNGSSNVMGGSLILNPK--SSLYSSARAFVESDGFEDLLWCEDAKVLEINSRDFEDRTVR 416

Query: 257 QSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVK-----KQLIGGYTPVFSITLMN 311
            ++N  +++  L+   +   KV +++++ ++  E   K     +  +GGY  +FS+   +
Sbjct: 417 ANKNTERLLSELILVNE--GKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFYS 474

Query: 312 KEQCKQLPLKLKYFHH---------ATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCE 360
           +E  K     LK F           A     +    E   ++    D  LIR S+G E
Sbjct: 475 EEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLE 532

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (43%), Gaps = 26/213 (12%)

Query: 133 IEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP---PPLQYAWNF 189
           +E   Q+   V +ETP NP     DL+     A   G  +++D T        L Y    
Sbjct: 311 LETSKQRILAVFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLNVDILPY---- 366

Query: 190 GADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHL------- 242
            ADI+  S TK F G S+++ G +V   +  S      R Y  +  AN E  L       
Sbjct: 367 -ADIVSTSLTKLFNGASNVMGGSVVLNPK--SSLYPYAREYFRS--ANFEDLLWCEDAIV 421

Query: 243 LLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL-QDESFVKKQLI--- 298
           L R+ R FE R L+ + N   ++  L+   +   K+ +++++ ++   E+F   + +   
Sbjct: 422 LERNSRDFEDRTLRANANTGILLNDLLLPEE--GKICKKIYYPTVTSKETFENYESVRNE 479

Query: 299 -GGYTPVFSITLMNKEQCKQLPLKLKYFHHATS 330
            GGY  +FS+   N+   K     LK F   ++
Sbjct: 480 RGGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSN 512

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 117/273 (42%), Gaps = 52/273 (19%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
           S+ ++E+    G+    V IE P NP     DL+   + A+  G  +++D T        
Sbjct: 439 SMKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNID 498

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGT-----NVANLES 240
              F ADI+  S ++ FGG S++++G +V   +E  K  +  +++L       N    E 
Sbjct: 499 VLPF-ADIVCSSLSQSFGGDSNVMAGSMVLNPQE--KLYQFAQLFLNQLGEYENYVWCED 555

Query: 241 HLLL-RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL-QDES------- 291
            ++L R+ R F  R +  + N   ++  ++   +   K+ +++++ SL  DE+       
Sbjct: 556 AIILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKENYDKL 615

Query: 292 -------FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMT 344
                  F K++  GGY  + S+T  N +  K+       F    ++    SL     + 
Sbjct: 616 RCKKIPNFEKEE--GGYGGIISLTFHNLDTSKR-------FFDEINITKGPSLSTNHTLA 666

Query: 345 DPY----------------IDQTLIRFSIGCES 361
            PY                +++ LIR  IGCES
Sbjct: 667 CPYTILSYFDNLAQVEKFGVEENLIRIKIGCES 699

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 43/177 (24%)

Query: 131 DDIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPP-----PLQ 184
           +D E+ + +K   V++ET  NP     D       AH  G  ++VD+TF        P++
Sbjct: 138 EDFEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK 197

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKD--------EEVSKRLKDDRIY------ 230
           Y    GADI+ HSATK+ GGH   ++G ++           E+  +  K    Y      
Sbjct: 198 Y----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFN 253

Query: 231 -------------------LGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHL 268
                              LG  ++   S LLL+ + T  +R  +Q +N   + + L
Sbjct: 254 EAMGNLAFIGHVRTELLRDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWL 310

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 115/266 (43%), Gaps = 45/266 (16%)

Query: 127 QRSLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPL 183
           ++S++ ++E    G+    V +E P NP     +L    + A + G  +++D T      
Sbjct: 382 EKSMEQLKEILHSGEQILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDET------ 435

Query: 184 QYAWNF-------GADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLG--TN 234
             A  F        AD++  S TK F G S++++G LV   +           + G   +
Sbjct: 436 --AGGFVNIDVLPHADMVCSSLTKIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFED 493

Query: 235 VANLESHLLL-RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQ----- 288
           +   E  + L R+ R F  R L  ++N  +++E ++  ++K  K+ +++F+ SL      
Sbjct: 494 LLWCEDVIYLERNSRDFVTRTLTVNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPETK 551

Query: 289 ---DESFVKKQLIGGYTPVFSITLMNKEQ----------CKQLPLKLKYFHHATSLGGVE 335
              D     K   GGY  +FS+T  N++Q          CK   L    F  A     + 
Sbjct: 552 RNYDAILCPK---GGYGGLFSLTFYNEKQARVFFDTLELCKGPSLGTN-FTLACPYAILA 607

Query: 336 SLIEWRAMTDPYIDQTLIRFSIGCES 361
              E   +    ++++L+R S+G ES
Sbjct: 608 HYTELEEVAKFGVERSLVRVSVGLES 633

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 89/358 (24%), Positives = 146/358 (40%), Gaps = 79/358 (22%)

Query: 24  APPINVATTFRYDENDLVPWNEREDLEFMDRTP--IYSRLGHPNATRLESIFSEILEG-H 80
           A PI   T++ +D++      +     F   TP  IYSR+ +P A   E   + +  G  
Sbjct: 26  AVPIYSTTSYVFDDS------KHGSQLFGLETPGYIYSRIMNPTADVFERRIAALEGGVG 79

Query: 81  AVIYSSGLAAFHAAMT---HFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYA 137
           A+  SSGLAA   A+T   H     +     Y G +    I  + +G+  R ++  +   
Sbjct: 80  ALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKIAFKRFGIESRFIEGDDPSG 139

Query: 138 QKGDI------VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP-----PPLQYA 186
            +  I      V++ET  NP     D +     AH  G  ++VD+TF        P+++ 
Sbjct: 140 LEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGVPVVVDNTFGAGGYYCQPIKH- 198

Query: 187 WNFGADIIMHSATKFFGGHSDLLSGVLVTKD----EEVSKR------------------- 223
              GAD+++HSATK+ GGH   + GV+V       +E  K+                   
Sbjct: 199 ---GADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKEYPKKFPQFSEPSEGYHGLVFNEA 255

Query: 224 --------------LKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLV 269
                         L+D    LG +++   + LLL+ L T  +R  + + N  K+ + L 
Sbjct: 256 LGNQAFIGHVRAELLRD----LGPSLSPFAAFLLLQGLETLSLRAERHASNALKLAQWL- 310

Query: 270 SNRDKYSKVLRQVFHSSLQDESF---VKKQLIGGYTPVFSIT---LMNKEQCKQLPLK 321
               + S  +  V +  L + S     KK L  G+  V S     L +  + K+ P K
Sbjct: 311 ----EKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLSFGAKDLPDNPEEKENPFK 364

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 108/260 (41%), Gaps = 52/260 (20%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAAMT---HFNPKQLFIGQSYHGV 112
           IYSR+ +P    LE  + +      A+  +SG AA   A+T   H     +     Y G 
Sbjct: 54  IYSRIMNPTNDVLEQRLAALEGGAAALAVASGQAAQTVAITGLAHAGDNIVSTSFLYGGT 113

Query: 113 HGIADILSRNYGLIQRSLD-----DIE-EYAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R +D     D E ++ +K   +++E+  NP     D +     AH
Sbjct: 114 YNQFKVAFKRLGIEARFVDGDKPEDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAH 173

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVT------ 215
             G  ++VD+TF        P+++    GADI+ HSATK+ GGH   ++G ++       
Sbjct: 174 KHGIPVVVDNTFGAGGFFCQPIKW----GADIVTHSATKWIGGHGTTIAGAIIDSGKFPW 229

Query: 216 KD--EEVSKRLKDDRIY-------------------------LGTNVANLESHLLLRSLR 248
           KD  E+  +  K    Y                         LG  ++   S LLL+ L 
Sbjct: 230 KDYPEKFPQFSKPSEGYHGLVFNDAFGPLAFIGHARTELLRDLGPALSPFSSFLLLQGLE 289

Query: 249 TFEMRILKQSQNVTKIVEHL 268
           T  +R  + + N  K+ + L
Sbjct: 290 TLSLRGERHAYNALKLAQWL 309

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 110/259 (42%), Gaps = 31/259 (11%)

Query: 128 RSLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           +SL D++     G+    V IE P NP     DL      +   G  ++VD T     + 
Sbjct: 389 KSLQDLQTILHSGEQILAVFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGF-VN 447

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLV----TKDEEVSKRLKDDRIYLGTNVANLES 240
               F ADI+  S TK F G S++++G +V    +K  E +++  +    +  ++   + 
Sbjct: 448 LDGLFHADIVCSSLTKVFNGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDL 507

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSN--RDKYSKVLRQVFHSSLQDESF------ 292
             L ++ R F  + L+    +    E+L+ N  +    K+ +++++ S   E        
Sbjct: 508 IYLEKNSRDFVAKTLR----INYTTEYLLDNVFKPHVGKLFKRIYYPSQNSEEIKQNYEA 563

Query: 293 VKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLI----------EWRA 342
           +K +  GGY  VFS+T    +Q K     LK     T LG   + +          E   
Sbjct: 564 IKCKKDGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELER 622

Query: 343 MTDPYIDQTLIRFSIGCES 361
           + +  ++  LIR  +G E+
Sbjct: 623 VKEYGLEDNLIRVCVGLEN 641

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 111/262 (42%), Gaps = 39/262 (14%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----P 181
           S+D +++    G+    V IE P NP     DLQ     +      ++VD T        
Sbjct: 371 SMDALKKILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNID 430

Query: 182 PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKD-----EEVSKRLKDDRIYLGTNVA 236
            L YA     DII  S TK F G S++++G LV        E   K +K +  Y   +  
Sbjct: 431 VLPYA-----DIICSSLTKIFSGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGY--EDCL 483

Query: 237 NLESHLLL-RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESF--- 292
             E  L L R+ R F  R +K + N   ++  ++    +  K+ +++++ SL  E     
Sbjct: 484 WCEDALCLERNSRDFVERTIKVNTNTDILLTKVL--LPQVGKLFKKIYYPSLTSEETKRN 541

Query: 293 ---VKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY-- 347
              V     GGY  +FS+T  + E+ K+    L+      SLG   +L    A+   Y  
Sbjct: 542 YDSVMATRDGGYGGLFSLTFFDIEKAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQE 600

Query: 348 --------IDQTLIRFSIGCES 361
                   +++ L+R S+G E+
Sbjct: 601 LDEIAQYGVEKNLVRVSVGLEN 622

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 114/255 (44%), Gaps = 28/255 (10%)

Query: 128 RSLDDIEEYAQKGDIV---HIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184
           ++++++++    G+ +    +E P NP     DL    + A+S G  ++VD T       
Sbjct: 372 KAMEELKKILHSGEQILALFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNI 431

Query: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANL----ES 240
               F ADI+  S TK F G S++++G +V   +  SK       ++     +     ++
Sbjct: 432 DVLPF-ADIVCSSLTKIFSGDSNVIAGSIVLNPQ--SKLYSFAETFMEQQYEDCLWCEDA 488

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVK-----K 295
             L R+ R F  R LK +QN  +++  ++  ++   K+ +++++ SL  +   K     +
Sbjct: 489 LYLERNSRDFVARTLKVNQNTERLLNKVLLPQE--GKLFKKIYYPSLTSKETKKNYDAVR 546

Query: 296 QLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY-------- 347
              GGY  +FS+T  N +  K     L+      SLG   +L    A+   Y        
Sbjct: 547 GHQGGYGGLFSLTFYNLDSAKTFFNTLQ-LCKGPSLGTNFTLACPYAIIAHYQELDRVAK 605

Query: 348 --IDQTLIRFSIGCE 360
             ++  L+R S+G E
Sbjct: 606 YGVESNLVRVSVGLE 620

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 103/245 (42%), Gaps = 36/245 (14%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----PPLQYAWNFGADIIMHSA 198
           V IE P NP     DLQ     +      ++VD T         L YA     DI+  S 
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPYA-----DIVCSSL 441

Query: 199 TKFFGGHSDLLSGVLVTKD-----EEVSKRLKDDRIYLGTNVANLESHLLL-RSLRTFEM 252
           TK F G S++++G LV        E   K +K +  Y   +    E  L L R+ R F  
Sbjct: 442 TKIFSGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGY--EDCLWCEDALCLERNSRDFVE 499

Query: 253 RILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESF------VKKQLIGGYTPVFS 306
           R +K + N   +++ ++    +  K+ +++++ SL  E        V     GGY  +FS
Sbjct: 500 RTIKVNTNTDILLKRVL--LPQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFS 557

Query: 307 ITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY----------IDQTLIRFS 356
           +T  N E+ K+    L+      SLG   +L    A+   Y          ++  L+R S
Sbjct: 558 LTFFNIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVS 616

Query: 357 IGCES 361
           +G E+
Sbjct: 617 VGLEN 621

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 110/262 (41%), Gaps = 39/262 (14%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----P 181
           S+D ++     G+    V IE P NP     DLQ     +      ++VD T        
Sbjct: 370 SMDALKNILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNID 429

Query: 182 PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGT-----NVA 236
            L YA     DI+  S TK F G S++++G LV       K  +  R ++ T     +  
Sbjct: 430 VLPYA-----DIVCSSLTKIFSGDSNVIAGSLVLNPR--GKIYEFARKFMSTEDGYEDCL 482

Query: 237 NLESHLLL-RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKK 295
             E  L L R+ R F  R +K + N   ++  ++    +  K+ +++++ SL  E   K 
Sbjct: 483 WCEDALCLERNSRDFVERTIKVNTNTDVLLTKVL--LPQVGKLFKKIYYPSLTSEETKKN 540

Query: 296 ------QLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY-- 347
                    GGY  +FS+T  N E+ K+    L+      SLG   +L    A+   Y  
Sbjct: 541 YDNVMSTKDGGYGGLFSLTFFNIERAKKFFNSLE-LCKGPSLGTNFTLACPYAIIAHYQE 599

Query: 348 --------IDQTLIRFSIGCES 361
                   +++ L+R S+G E+
Sbjct: 600 LDEIAQYGVEKNLVRVSVGLEN 621

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 102/248 (41%), Gaps = 45/248 (18%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----PPLQYAWNFGADIIMHSA 198
           V IETP NP     DL      A +    +++D T         LQYA     DI+  S 
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQYA-----DIVCSSL 481

Query: 199 TKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANL----ESHLLLRSLRTFEMRI 254
           TK F G S++++G LV        +L   R +   +  +L    +S  L R+ R    R 
Sbjct: 482 TKIFSGDSNVMAGSLVLNPSSRLYKLA-RRFFASDDYEDLLWCEDSIYLERNSRDCVSRS 540

Query: 255 LKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDES------FVKKQLIGGYTPVFSIT 308
           +K ++N  ++++  +   +    + +++++ SL           VK Q  GGY  +FS+T
Sbjct: 541 MKINENAERLLKGTLLPLE--GTLFKKIYYPSLTSSETKANYDAVKCQPNGGYGGLFSLT 598

Query: 309 LMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY----------------IDQTL 352
             + E  K        F ++  L    SL     +  PY                +++ L
Sbjct: 599 FFDDECAKA-------FFNSLDLCKGPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNL 651

Query: 353 IRFSIGCE 360
           +R SIG E
Sbjct: 652 VRVSIGLE 659

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 115/269 (42%), Gaps = 53/269 (19%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
           +++D+++  Q G+    V +E P NP     DL      A+  G  ++VD T        
Sbjct: 380 AMEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDET-------- 431

Query: 186 AWNF-------GADIIMHSATKFFGGHSDLLSGVLVTKDEE----------VSKRLKDDR 228
           A  F        AD++  S TK F G S+L++G LV   +           ++++  +D 
Sbjct: 432 AGGFVNIDVLPHADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDT 491

Query: 229 IYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQ 288
           ++    +A      L R+ R F  R ++ + N   ++  ++   +   K+ +++++ SL 
Sbjct: 492 LWCEDALA------LERNSRDFVQRTIQVNHNTEYLLNKVLIPLE--GKLFKKIYYPSLT 543

Query: 289 DES------FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA 342
                     VK  +  GY  +FS+T  N  Q +     L+      SLG   +L    A
Sbjct: 544 SPETKRHYDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQ-LCKGPSLGTNFTLACPYA 602

Query: 343 MTDPY----------IDQTLIRFSIGCES 361
           +   Y          ++++L+R S+G E+
Sbjct: 603 ILAHYQELDEVARYGVEKSLVRVSVGLEN 631

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 116/275 (42%), Gaps = 59/275 (21%)

Query: 128 RSLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP---- 180
           +++++++E    G+    V IE+P NP     DL      +   G  +++D T       
Sbjct: 413 QAMNELKEILHGGEQILAVFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNI 472

Query: 181 PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV-----------TKDEEVSKRLKDDRI 229
             L YA     D++  S TK F G S++++G +V           T    ++++  +D +
Sbjct: 473 DVLPYA-----DVVCSSLTKIFSGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLL 527

Query: 230 YLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFH----- 284
           +    +       L R+ R F  R +  ++N   ++E ++  +    K+ ++VF+     
Sbjct: 528 WCEDAIC------LERNSRDFISRSILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTN 581

Query: 285 -SSLQDESFVKKQLIG-GYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRA 342
             + ++   VK +  G GY  +FS+T  N EQ K        F ++ +L    SL     
Sbjct: 582 AETKKNYDQVKAKTAGSGYGGLFSVTFYNIEQAKM-------FFNSLNLCKGPSLGTNFT 634

Query: 343 MTDPY----------------IDQTLIRFSIGCES 361
           +  PY                ++  L+R S+G ES
Sbjct: 635 LACPYTVLAHYQEMEEVAKFGLEDNLVRVSVGLES 669

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 110/262 (41%), Gaps = 39/262 (14%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----P 181
           S+D ++     G+    V IE P NP     DLQ     +      ++VD T        
Sbjct: 370 SMDALKSILHAGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNID 429

Query: 182 PLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKD-----EEVSKRLKDDRIYLGTNVA 236
            L YA     DI+  S TK F G S++++G LV        E   K +K +  Y   +  
Sbjct: 430 VLPYA-----DIVCSSLTKIFSGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGY--EDCL 482

Query: 237 NLESHLLL-RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESF--- 292
             E  L L R+ R F  R +K + N   ++  ++    +  K+ +++++ SL  E     
Sbjct: 483 WCEDALCLERNSRDFVERTIKVNTNTNILLTKVL--LPQVGKLFKKIYYPSLTSEETKRN 540

Query: 293 ---VKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY-- 347
              V     GGY  +FS+T  + E+ K+    L+      SLG   +L    A+   Y  
Sbjct: 541 YDSVISTKDGGYGGLFSLTFFSIEEAKKFFNNLE-LCKGPSLGTNFTLACPYAIIAHYQE 599

Query: 348 --------IDQTLIRFSIGCES 361
                   +++ L+R S+G E+
Sbjct: 600 LDEIAQYGVEKNLVRVSVGLEN 621

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 77/169 (45%), Gaps = 11/169 (6%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           IYSR+ +P    LE  I +      A+  +SG AA   A   + H     +     Y G 
Sbjct: 55  IYSRIMNPTNDVLEKRIAALEGGAAALAVASGQAAQLVAIGGLAHAGDNIVSTSYLYGGS 114

Query: 113 HGIADILSRNYGLIQRSL--DDIEEYAQKGD----IVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R +  D+ E++  + D     V +E+  NP     D +     AH
Sbjct: 115 YNQFKVAFKRLGIECRFVEGDNAEDFEARFDSKTKAVFLESIGNPKYNVPDFERIVAVAH 174

Query: 167 SRGALLMVDSTF-APPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV 214
             G  ++VD+TF A         FGADI+ HSATK+ GGH   + G++V
Sbjct: 175 RHGIPVVVDNTFGAGGYFCQPIKFGADIVTHSATKWIGGHGTAIGGLVV 223

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 111/273 (40%), Gaps = 54/273 (19%)

Query: 120 SRNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFA 179
           SR+   +Q  LD  +   Q+   V +ETP NP     DL+     A + G  ++VD T  
Sbjct: 298 SRDITELQSFLDTSK---QRILAVFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIG 354

Query: 180 P---PPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDE--------EVSKRLKDDR 228
                 L Y     ADI+  S TK F G S+ + G ++   +        E  K  + + 
Sbjct: 355 GLNVDVLPY-----ADIVCTSLTKLFNGSSNAMGGSIILNPKSSLYSSACEYFKSAEFED 409

Query: 229 IYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQ 288
           +    +   LE++      R F+ R L+ + N  K++  ++   +   K+ +++++ ++ 
Sbjct: 410 LLWCEDAVVLEAN-----SRDFQDRTLRANINTEKLLNEVLLPEE--GKICKKIYYPTVS 462

Query: 289 D-ESFVKKQLI----GGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAM 343
             E+F   + +    GGY  +FS+   N+   K     LK F   ++            +
Sbjct: 463 SKETFNNYESVRNKHGGYGCLFSMAFYNEGDAKTFYDTLKVFKGPSNGTNF-------TL 515

Query: 344 TDPYI----------------DQTLIRFSIGCE 360
             PY+                D  LIR S+G E
Sbjct: 516 ACPYVHLAHHSELEEVSKFGADPNLIRVSVGLE 548

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 130/316 (41%), Gaps = 55/316 (17%)

Query: 86  SGLAAFHA---AMTHFNP---KQLFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYAQK 139
           SG A+ H+   A+  + P   K +  G  Y     I  + +  + L      D +  AQ 
Sbjct: 322 SGYASPHSPNGALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFL---GSGDHKAMAQL 378

Query: 140 GDIVH---------IETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFG 190
            DI+H         IETP NP     DLQ+    A   G  L+VD T     L    N  
Sbjct: 379 EDILHSGEPILAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDT-----LGGFVNID 433

Query: 191 ----ADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKD--DRIYLGTNVANL----ES 240
               AD++  S TK F G S++++G LV      + RL D     +   +  +L    ++
Sbjct: 434 VLPHADLVCSSLTKIFSGDSNVMAGSLVVNP---ASRLYDFAQGFFHNGSYEDLLWCEDA 490

Query: 241 HLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDES------FVK 294
             L R+ R    R L+ ++N   ++E ++        + +++F+ +L  E        V+
Sbjct: 491 IYLERNSRDCASRSLRVNKNTELLLEKVLLPHQ--GSLFKKIFYPTLTSEETKRNYDAVR 548

Query: 295 KQLIGGYTPVFSITLMNK----------EQCKQLPLKLKYFHHATSLGGVESLIEWRAMT 344
            +  GGY  +FS+T   +          E CK   L    F  A     +    E   + 
Sbjct: 549 CKPDGGYGGLFSLTFHEENRAKVFFDTLELCKGPSLGTN-FTLACPYTVLAHYAEMDVVA 607

Query: 345 DPYIDQTLIRFSIGCE 360
           +  ++++L+R S+G E
Sbjct: 608 EYGLERSLVRVSVGLE 623

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 104/265 (39%), Gaps = 48/265 (18%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
           ++D ++E    G+    V +ETP NP     DL      A   G  ++VD T        
Sbjct: 402 AMDTLKEILHSGEQILAVFMETPSNPLLKMGDLLELKRLADIYGFYVVVDET-------- 453

Query: 186 AWNF-------GADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANL 238
           A  F        AD++  S TK F G S++++G LV            +    G     L
Sbjct: 454 AGGFVNIDVLPHADLVCSSLTKIFSGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCL 513

Query: 239 ---ESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDK--YSKVL--RQVFHSSLQDES 291
              ++  L R+ R F  R LK + N   ++  ++   +   +SK+   R     + Q+  
Sbjct: 514 WCEDAIYLERNSRDFVTRTLKVNSNAEMLLNDVLIPEEGHLFSKIYYPRLTSEETKQNYD 573

Query: 292 FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY---- 347
            V+ +  GGY  +FS+T    EQ K+       F +A  L    SL     +  PY    
Sbjct: 574 TVRCKPNGGYGGLFSLTFYEIEQAKK-------FFNALELCKGPSLGTNFTLACPYAVLA 626

Query: 348 ------------IDQTLIRFSIGCE 360
                       ++  L+R S+G E
Sbjct: 627 HYAELEKVAQYGVEANLVRVSVGLE 651

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLESIFSEILEGHAVIY-SSGLAAFHAAMT---HFNPKQLFIGQSYHGV 112
           IYSR+ +P    LE   + +  G A +  SSG AA   A+T   H     +     Y G 
Sbjct: 54  IYSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGT 113

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R +D     D E+ + +K   +++E+  NP     D +     AH
Sbjct: 114 YNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAH 173

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 174 KHGIPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKW 209

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           +YSR  +P +  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 113 HGIADILSRNYGLIQRSL--DDIEEYAQKGD----IVHIETPVNPFGTSYDLQSFADKAH 166
           +    I  + +G+  R +  D+ EE+ +  D     V++ET  NP     D +     AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKW 210

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 104/247 (42%), Gaps = 38/247 (15%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFF 202
           V IETP NP     +L      +   G  +++D T           F AD++  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 203 GGHSDLLSGVLVTKDEEVSKRLKDDRIY-LGTNVANLESH-----------LLLRSLRTF 250
            G S+++ G +V   +         R+Y   T    LE              L R+ R F
Sbjct: 493 SGDSNVIGGSMVLNPQ--------SRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDF 544

Query: 251 EMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDES------FVKKQLIGGYTPV 304
             R ++ + N   +++ ++      + + +++++ +L  +        V+ +  GGY  +
Sbjct: 545 IARTIRINYNTEYLLDKIIKPHVGENALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGL 604

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLI---------EWRAMTDPY-IDQTLIR 354
           FS+T  +++  +     L+  +   SLG   +L+            AM + + +++ L+R
Sbjct: 605 FSLTFHDEDHAEAFYDNLQ-LNKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLR 663

Query: 355 FSIGCES 361
            S+G E+
Sbjct: 664 ISVGLEN 670

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 104/247 (42%), Gaps = 41/247 (16%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP----PPLQYAWNFGADIIMHSA 198
           V +E P NP     D+      +   G  ++VD T +       L Y      DI+  S 
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSYC-----DIVCSSL 372

Query: 199 TKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHL-------LLRSLRTFE 251
           TK F G S++++G LV      + +L D  I    +    E  L       L R+ R F 
Sbjct: 373 TKIFSGDSNVIAGSLVVNP---ASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDF- 428

Query: 252 MRILKQSQNVTKIVEHLVSN--RDKYSKVLRQVFHSSLQD-ESFVKKQLI----GGYTPV 304
              + ++Q + KI E LVS    ++  ++L ++++ SL   ES +    +    GGY  +
Sbjct: 429 ---IDRAQKINKIAEDLVSTVLLEEEGQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGL 485

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYID----------QTLIR 354
            SI    ++Q K     L   +   SLG   +L+   A+   Y +          + L+R
Sbjct: 486 ISIVFKREDQAKVFYDNLS-LNKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVR 544

Query: 355 FSIGCES 361
            S+G ES
Sbjct: 545 ISVGLES 551

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 121/292 (41%), Gaps = 46/292 (15%)

Query: 103 LFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFA 162
           L + Q ++  H ++D    N  + +  L +I    ++   V IE P NP     DL    
Sbjct: 400 LEVLQKFNHTHFLSDNDEENSAMSK--LKEILHSGEQILAVFIEAPSNPLLKMGDLIELK 457

Query: 163 DKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV----TKDE 218
             +   G  ++VD T A   +       ADII  S TK F G S++++G +V    +K  
Sbjct: 458 RLSDMYGFFIIVDETIAGF-VNIDAIIHADIICSSLTKVFTGDSNVIAGSMVLNPMSKIY 516

Query: 219 EVSKRL------------KDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQN-VTKIV 265
           + +KR              +D +YL  N          R   +   RI   ++  V  ++
Sbjct: 517 DFAKRFLSFPDGFEDCLWCEDILYLEKNS---------RDFLSKTTRINNTTEYLVNTVL 567

Query: 266 EHLVSNRDKYSKVLRQVFHSSLQDESF------VKKQLIGGYTPVFSITLMNKEQCKQLP 319
              V  ++   K+ +++++ +   +        +K +  GGY  VFSIT  + E+ K   
Sbjct: 568 SPYVGKKEANGKLFKKIYYPTTTSKETKMCYDAIKCKTYGGYGGVFSITFHDIEKAKLFF 627

Query: 320 LKLKYFHHATSLGGVESLI----------EWRAMTDPYIDQTLIRFSIGCES 361
             LK      SLG   + +          E   +++  +D+TLIR  +G E+
Sbjct: 628 NNLK-LSKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLDETLIRVCVGLEN 678

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 101/243 (41%), Gaps = 37/243 (15%)

Query: 143 VHIETPVNPF---GTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSAT 199
           V +ETP NP        DL+  AD+      +           L YA     DI+  S T
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINVDILPYA-----DIVCTSLT 366

Query: 200 KFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHL-------LLRSLRTFEM 252
           K F G S+++ G +V   +  S      R Y  +  A+ E  L       L R+ R FE 
Sbjct: 367 KLFNGASNVMGGSIVLNPK--SSIYPYAREYFKS--ADFEDLLWCEDAVVLERNSRDFEN 422

Query: 253 RILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL-QDESFVKKQLI----GGYTPVFSI 307
           R L  + N  K++  ++    +  K+ ++V++ ++  +E+F   + +    GGY  +FS+
Sbjct: 423 RTLHANANTEKLLNEVLI--PEQGKLCKKVYYPTVTSEETFRNYESVRNERGGYGCLFSV 480

Query: 308 TLMNKEQCKQLPLKLKYFHHATSLGGVESLI----------EWRAMTDPYIDQTLIRFSI 357
              N+   K     LK F    S G   +L           E  A++    D  +IR S+
Sbjct: 481 AFYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVSV 539

Query: 358 GCE 360
           G E
Sbjct: 540 GLE 542

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 101/239 (42%), Gaps = 22/239 (9%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFF 202
           V IETP NP     +L      +   G  +++D T           F ADI+  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 203 GGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANL----ESHLLLRSLRTFEMRILKQS 258
            G S+++ G +V   +          + L     +L    ++  L R+ R F  R ++ +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 259 QNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDES------FVKKQLIGGYTPVFSITLMNK 312
            +   +++ ++      +K+ +++++ +L  +        V+ +  GGY  +FS+T  ++
Sbjct: 514 YSTEYLLDKILKPHVGENKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 573

Query: 313 EQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY----------IDQTLIRFSIGCES 361
           +        LK  +   SLG   +L     +   Y          +++ L+R S+G ES
Sbjct: 574 DHAAAFYDNLK-LNKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLES 631

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           +YSR  +P +  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    I  + +G+  R ++     D E+ + ++   V++ET  NP     D +     AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKW 210

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           +YSR  +P +  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    I  + +G+  R ++     D E+ + ++   V++ET  NP     D +     AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKW 210

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFHAA---MTHFNPKQLFIGQSYHGV 112
           +YSR  +P +  LE  I +      A+  SSG AA   A   + H     +     Y G 
Sbjct: 55  VYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGT 114

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    I  + +G+  R ++     D E+ + ++   V++ET  NP     D +     AH
Sbjct: 115 YNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKY----GADIVTHSATKW 210

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 119/298 (39%), Gaps = 65/298 (21%)

Query: 95  MTHFNPKQLFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGT 154
           MT F   + F         G  D  SR+   +Q+ LD      Q+   V +ETP NP   
Sbjct: 283 MTKFGKCKFF---------GFGD--SRDITELQKFLD---ASNQRLLAVFVETPSNPLLN 328

Query: 155 SYDLQSFADKAHSRGALLMVDSTFAP---PPLQYAWNFGADIIMHSATKFFGGHSDLLSG 211
             +L+     A + G  +++D T        L YA     DI+  S TK F G S+++ G
Sbjct: 329 MPNLKELRRLADAYGFFIVIDDTIGGLNVDILPYA-----DIVCTSLTKLFNGASNVMGG 383

Query: 212 VLV--------TKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTK 263
            +V         +  E  K  + + +  G +   LE     R+ R FE R L+ + N  K
Sbjct: 384 SVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLE-----RNSRDFEDRTLRANTNTEK 438

Query: 264 IVEHLVSNRDKYSKVLRQVFHSSLQDESFVK-----KQLIGGYTPVFSITLMNKEQCKQL 318
           +++ L+    +  K  +++++ ++  +  +      +   GGY  +FS+   ++   +  
Sbjct: 439 LLKELLL--PEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEGDAEAF 496

Query: 319 PLKLKYFHHATSLGGVESLIEWRAMTDPYI----------------DQTLIRFSIGCE 360
              LK F   ++            +  PY+                D ++IR S+G E
Sbjct: 497 YDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADSSIIRVSVGLE 547

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 111/264 (42%), Gaps = 41/264 (15%)

Query: 129 SLDDIEEYAQKGD---IVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185
           S+D++ +    G+    V IETP NP     +L      +   G  +++D T        
Sbjct: 378 SMDELTKILHSGEQILAVFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNID 437

Query: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIY-LGTNVANLESH--- 241
              F ADI+  S TK F G S+++ G +V   +         R+Y   T    LE     
Sbjct: 438 GLPF-ADIVCSSLTKTFSGDSNVIGGSMVLNPQ--------SRVYEFATRFMRLEDEYED 488

Query: 242 --------LLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDES-- 291
                    L R+ R F  R ++ + +   +++ ++      +++ +++++ +L  +   
Sbjct: 489 LLWCEDAIYLERNSRDFIARTVRINYSTEYLLDKILKPHVGGNELFKKIYYPNLTSKETL 548

Query: 292 ----FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLI--------- 338
                V+ +  GGY  +FS+T  ++         L+  +   SLG   +L          
Sbjct: 549 TNYDMVRCKKEGGYGGLFSLTFHDEHHAAAFYDNLQ-LNKGPSLGTNFTLAFPYTLMTYY 607

Query: 339 EWRAMTDPY-IDQTLIRFSIGCES 361
           +  AM + + +++ L+R S+G ES
Sbjct: 608 QELAMAEKFGVERNLLRISVGLES 631

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/277 (21%), Positives = 108/277 (38%), Gaps = 23/277 (8%)

Query: 101 KQLFIGQSYHGVHGIADILSRNYGLIQRSLD---DIEEYAQKGD---IVHIETPVNPFGT 154
           K + +G   H  + +   LS++Y + +   D    ++E    G+    V  ETP N    
Sbjct: 346 KTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLKEILHSGEQILAVITETPTNGLLD 405

Query: 155 SYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLV 214
             +L      +   G  ++VD +        A  +  DI+  S  K F G  D++SG +V
Sbjct: 406 VTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTEDVVSGSMV 464

Query: 215 TKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMR---ILKQSQNVTKIVEHLVSN 271
              +    +L D       +     S L    +   E      + +S+ +    + L+  
Sbjct: 465 VNPQ---SKLYDFAQTFMASEHEPSSVLWCEDIIQLEQNSRDFVSKSKRINTATKRLL-- 519

Query: 272 RD----KYSKVLRQVFHSSLQDES---FVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKY 324
           RD    +   +  +V H S+ D +    +K +  GGY  VF++     E+ +    +L  
Sbjct: 520 RDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERARSFYDRLNV 579

Query: 325 FHHATSLGGVESLIEWRAMTD-PYIDQTLIRFSIGCE 360
                  G       W+ +     +D+TLIR S+G E
Sbjct: 580 CKGPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLE 616

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLESIFSEILEGHAVI-YSSGLAAFHAAMT---HFNPKQLFIGQSYHGV 112
           +YSR+ +P     E   + +  G A +  +SG AA   A++   H     +     Y G 
Sbjct: 55  MYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGT 114

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  R  G+  R ++     D E+ +  K   V++ET  NP     D +     AH
Sbjct: 115 YNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGYFAQPIKY----GADIVTHSATKW 210

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 121/299 (40%), Gaps = 50/299 (16%)

Query: 101 KQLFIGQSYHGVHGIADILSRNYGL-------IQRSLDDIEEYAQKGDIVHIETPVNPFG 153
           K +  G SY   + +   L+  Y L           L +I    ++   V IE P  P  
Sbjct: 361 KTVVFGFSYPDTYKMLKTLNNVYCLPYVSEIDCMNKLKNILHSGEQILAVLIEAPSTPLL 420

Query: 154 TSYDLQSFADKAHSRGALLMVDST----FAPPPLQYAWNFGADIIMHSATKFFGGH-SDL 208
              +L    + ++  G +++VD T    F    L +A     D++  S TK F G   ++
Sbjct: 421 KMGNLLELKELSNLFGFIIIVDETVGGFFNVDALVHA-----DVVCTSLTKIFSGDVGNV 475

Query: 209 LSGVL-VTKDEEVSKRLKD---DRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKI 264
           ++G + +  +  +    KD   D      N+   ++ ++ R+ R F  ++LK +     +
Sbjct: 476 MAGAMALNSNSTIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKINYTTDYL 535

Query: 265 VEHLVSNRDKYSKVLRQVFHSSL------QDESFVKKQLIGGYTPVFSITLMNKEQCKQL 318
           ++ ++        + ++++H  L      Q+   +K +  GGY  VFSI   N EQ    
Sbjct: 536 LDKVLIPHIGEHNLFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNNLEQA--- 592

Query: 319 PLKLKYFHHATSLGGVESLIEWRAMTDPY----------------IDQTLIRFSIGCES 361
               K F++  ++    SL     +  PY                + ++LIR S+G E+
Sbjct: 593 ----KLFYNCLNVAKGPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLEN 647

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 101/247 (40%), Gaps = 38/247 (15%)

Query: 143 VHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFF 202
           V IETP NP     +L      +   G  +++D T           F ADI+  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 203 GGHSDLLSGVLVTKDEEVSKRLKDDRIY-LGTNVANLESH-----------LLLRSLRTF 250
            G S+++ G +V   +         R+Y   T    LE              L R+ R F
Sbjct: 504 SGDSNVIGGSMVLNPQ--------SRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDF 555

Query: 251 EMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSL-QDESFVKKQLI-----GGYTPV 304
             R ++ + +   +++ ++      + + +++++ SL   E+ +   ++     GGY  +
Sbjct: 556 IARTIRINYSTEYLLDKILKAHVGENGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGL 615

Query: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPY----------IDQTLIR 354
           FS+T  +++        L+  +   SLG   +L     +   Y          +++ L+R
Sbjct: 616 FSLTFHDEDHAAAFYNNLQ-LNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLR 674

Query: 355 FSIGCES 361
            S+G ES
Sbjct: 675 ISVGLES 681

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 7/100 (7%)

Query: 109 YHGVHGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFA 162
           Y G +    +  +  G+  R +D     D E+ +  K   V++E+  NP     D +   
Sbjct: 111 YGGTYNQFKVAFKRLGIETRFIDGDSPEDFEKAFDDKTKAVYLESIGNPKYNVPDFEKIV 170

Query: 163 DKAHSRGALLMVDSTF-APPPLQYAWNFGADIIMHSATKF 201
             AH  G  ++VD+TF A       + FGADII HSATK+
Sbjct: 171 AVAHKHGIPVVVDNTFGAGGFFAQPFKFGADIITHSATKW 210

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 19/160 (11%)

Query: 57  IYSRLGHPNATRLES-IFSEILEGHAVIYSSGLAAFH---AAMTHFNPKQLFIGQSYHGV 112
           IYSR  +P    LE  I +      A+  SSG AA     A + H     +     Y G 
Sbjct: 55  IYSRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGT 114

Query: 113 HGIADILSRNYGLIQRSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAH 166
           +    +  +  G+  R ++     D E+ + ++   V++E+  NP     D ++    AH
Sbjct: 115 YNQFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAH 174

Query: 167 SRGALLMVDSTFAP-----PPLQYAWNFGADIIMHSATKF 201
             G  ++VD+TF        P++Y    GADI+ HSATK+
Sbjct: 175 KHGIPVVVDNTFGAGGFFCQPIKY----GADIVTHSATKW 210

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 91/205 (44%), Gaps = 29/205 (14%)

Query: 14  DDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTP--IYSRLGHPNATRLES 71
           DD  NR   V  PI   T++ ++++      +     F   TP  IYSR+ +P    LE 
Sbjct: 18  DDNANRPRAV--PIYATTSYVFNDS------KHGSQLFGLETPGYIYSRIMNPTVDVLEK 69

Query: 72  -IFSEILEGHAVIYSSGLAAFHAAMT---HFNPKQLFIGQSYHGVHGIADILSRNYGLIQ 127
            I +      A+  +SG A+   A++   H     +     Y G +    +  +  G+  
Sbjct: 70  RIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGTYNQFKVAFKRLGIET 129

Query: 128 RSLD-----DIEE-YAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAP- 180
           R ++     D E+ + ++   V++ET  NP     D     + AH  G  ++VD+TF   
Sbjct: 130 RFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIPVVVDNTFGAG 189

Query: 181 ----PPLQYAWNFGADIIMHSATKF 201
                P++Y    GADI+ HSATK+
Sbjct: 190 GFFAQPIKY----GADIVTHSATKW 210

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 265 VEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNKEQ--------CK 316
           +E+++     Y KVL+Q+F S+LQ  +    + + G +P F   L   EQ          
Sbjct: 331 IENVLHLESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIV 390

Query: 317 QLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQT 351
           +  L +  FH   +   VE L EW A++D  +D++
Sbjct: 391 KSCLDVSLFHTENANRLVELLSEWLALSDEPLDES 425

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 265 VEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNKEQ--------CK 316
           +E+++     Y KVL+Q+F S+LQ  +    + + G +P F   L   EQ          
Sbjct: 335 IENVLHLESAYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIV 394

Query: 317 QLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQT 351
           +  L    FH   +   VE L EW A+ D  +D++
Sbjct: 395 KSCLDASLFHTENANRLVELLSEWLALNDKPLDES 429

>SAKL0A02948g Chr1 complement(270179..273211) [3033 bp, 1010 aa]
           {ON} highly similar to uniprot|P49095 Saccharomyces
           cerevisiae YMR189W GCV2 P subunit of the mitochondrial
           glycine decarboxylase complex required for the
           catabolism of glycine to 5 10-methylene-THF expression
           is regulated by levels of levels of 5 10-methylene-THF
           in the cytoplasm
          Length = 1010

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 20/108 (18%)

Query: 157 DLQSFADKAHSRGALLMVDS-----TFAPPPLQYAWNFGADIIMHSATKF-----FGGHS 206
           ++Q+ AD  HS  ALL V S     T   PP Q    FGADI++ S+ +F     +GG  
Sbjct: 277 NVQTIADILHSNKALLSVASDLMALTLLKPPAQ----FGADIVLGSSQRFGVPLGYGGPH 332

Query: 207 DLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRI 254
                V+   + ++  R+      +G +   L+   L  +L+T E  I
Sbjct: 333 AAFFAVIDKLNRKIPGRI------VGVSKDRLDKPALRLALQTREQHI 374

>Kpol_1058.1 s1058 (1227..1940) [714 bp, 237 aa] {ON} (1227..1940)
           [714 nt, 238 aa]
          Length = 237

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 63  HPNATRLESIFSEILEGHAVIYSS--GLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILS 120
           +P A  L+S+ SEI + + V+ +   G A F   +   + K L  G+   G   I +++ 
Sbjct: 114 YPKAKSLQSLASEIYDKNGVVAAVCHGPAIFDGLIEKKSGKPLIEGKVITGFTDIGEVIL 173

Query: 121 RNYGLI-QRSLDDIEEYAQKGDIVHIETPVNPF 152
           +  G++ ++SL  +E+ A+K +  ++  P+ P+
Sbjct: 174 QVDGIMKEKSLLSVEDIAKKYNAKYVP-PIGPW 205

>Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON}
           YJR134C (SGM1) - Product of gene unknown [contig 376]
           FULL
          Length = 640

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 231 LGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDE 290
           LG  V  LE+ L   SL     R+LK  Q+V   +  L+   DK + V +Q+  +S + E
Sbjct: 534 LGGQVRRLETELA--SLHDSNTRLLKDKQDVNDTIVRLMEENDKATAVQKQLEDASQRAE 591

Query: 291 SFVKK-----QLIG 299
           S  +K     QL+G
Sbjct: 592 SLEEKLNTALQLLG 605

>Kwal_33.14365 s33 (640933..642246) [1314 bp, 437 aa] {ON} YDR306C -
           Hypothetical ORF [contig 104] FULL
          Length = 437

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 253 RILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNK 312
           R  +  +NV ++   L+    K S V + +   S + ESFV  Q   GY P+ S+     
Sbjct: 149 RKKRMGENVVELDLSLIIQSGKNSYVSKLLRRCSPKLESFVAPQTSFGYAPLISL----- 203

Query: 313 EQCKQLP-LKLKYFHHATSLGGVESLI-EWRAMT 344
           + C+QL  L L        LG + S I E+ A+T
Sbjct: 204 KSCRQLKYLDLGLVSETVQLGELLSAINEFPALT 237

>Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {ON}
           YJR137C (ECM17) - Putative sulfite reductase [contig
           376] FULL
          Length = 1430

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 51/117 (43%), Gaps = 17/117 (14%)

Query: 204 GHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTK 263
           G +D +   L T    V+ +  D  +++G + +N  S                 +++   
Sbjct: 285 GEADDVPSALHTVITNVNSKNPDQALFIGKSSSNTTS-----------------AESTQT 327

Query: 264 IVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNKEQCKQLPL 320
           ++ +++S  D Y K+L+Q+F S+LQ  +    + +   TP +   L   +  K+  L
Sbjct: 328 LISNVISLEDAYLKILKQLFSSNLQILNKYTDENVNSATPEYGFGLFKSQDKKRQSL 384

>CAGL0M00374g Chr13 (49330..53538) [4209 bp, 1402 aa] {ON} similar
           to uniprot|P47169 Saccharomyces cerevisiae YJR137c ECM17
          Length = 1402

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 14/131 (10%)

Query: 235 VANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSN----RDKYSKVLRQVFHSSLQDE 290
           ++NLES   +++L  F   ++  S++VT+   + + N     D Y KVL+Q+  ++L   
Sbjct: 268 ISNLESAKPVKNL--FVGEVVDISKDVTEDYSNSIKNILKLEDAYIKVLKQLLGNNLSII 325

Query: 291 SFVKKQLIGGYTPVFSIT--LMNKE-QCKQLPLKLK-----YFHHATSLGGVESLIEWRA 342
           +      I   +P F     L  KE Q K + L  K      FH   S   V+ L +W +
Sbjct: 326 NEYSNSTINTLSPEFGYGRYLQEKEIQNKLVELARKSLDPQLFHSQESDEFVKKLSKWVS 385

Query: 343 MTDPYIDQTLI 353
                +DQ L+
Sbjct: 386 FKSSSLDQNLL 396

>CAGL0I04334g Chr9 complement(387102..388379) [1278 bp, 425 aa] {ON}
           similar to uniprot|P47013 Saccharomyces cerevisiae
           YJL134w LCB3 or uniprot|P23501 Saccharomyces cerevisiae
           YKR053c YSR3
          Length = 425

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILS 120
           NAT +  +F   L   +  YS    AF  AM  F    L +G+ Y G+HG+ D++S
Sbjct: 181 NATGVSLLFLIALM-QSTRYSGFSKAFLFAMVMFYYLTLVLGRIYCGMHGVLDLVS 235

>TPHA0H01960 Chr8 (459288..462383) [3096 bp, 1031 aa] {ON} Anc_6.277
           YMR189W
          Length = 1031

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 109 YHGVHGIADILSRNYGLIQRSLDDIEEYAQKGDIVH 144
           YHG  G+ DI  R YG+     ++I+    KG++++
Sbjct: 408 YHGPKGLTDIAKRIYGMTSILAEEIKSANSKGNLIN 443

>ZYRO0G19888g Chr7 complement(1644851..1650478) [5628 bp, 1875 aa]
           {ON} similar to uniprot|P37297 Saccharomyces cerevisiae
           YLR305C STT4 Phosphatidylinositol-4-kinase that
           functions in the Pkc1p protein kinase pathway required
           for normal vacuole morphology cell wall integrity and
           actin cytoskeleton organization
          Length = 1875

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 14/122 (11%)

Query: 240 SHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIG 299
           + LL   L  F ++I K+  ++ K    ++   D++ + L   F    Q  + V   L+G
Sbjct: 101 TELLTFELTNFLIKICKRFPSLLKNCTAII---DQFFEALSNRFE---QTNAVVS--LLG 152

Query: 300 GYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIR-FSIG 358
                F  + ++  +   LPL    ++H + + G + L++   + + + D+TL+R +  G
Sbjct: 153 -----FMGSFIDGSEGVSLPLGAHVWYHLSDILGPQGLLKSSGIANEFTDETLVRYYESG 207

Query: 359 CE 360
           CE
Sbjct: 208 CE 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,310,830
Number of extensions: 1709201
Number of successful extensions: 5116
Number of sequences better than 10.0: 142
Number of HSP's gapped: 5085
Number of HSP's successfully gapped: 142
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)