Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I01100g5.434ON31031016440.0
Skud_15.2835.434ON31230911751e-163
Smik_15.2985.434ON31230911691e-162
Suva_8.1735.434ON31230911671e-161
NDAI0C016005.434ON31331111661e-161
YOR120W (GCY1)5.434ON31230911651e-161
YDR368W (YPR1)5.434ON31230911361e-157
Suva_2.5405.434ON31230911291e-156
KNAG0C049105.434ON31331111141e-153
Smik_4.6345.434ON31230911071e-152
Skud_4.6375.434ON31230911071e-152
NCAS0H020605.434ON32230611011e-151
CAGL0A02816g5.434ON31030810751e-147
TBLA0A02825singletonON31130910701e-147
SAKL0G02530g5.434ON31230710691e-146
KAFR0E03850singletonON31129510631e-146
ZYRO0F10032g5.434ON31031010571e-145
TDEL0E019105.434ON31130910441e-143
TPHA0E017605.434ON31030910261e-140
Kpol_1062.295.434ON31130710251e-140
TPHA0G00210singletonON31131010181e-139
Kwal_47.18084na 1ON30930710001e-136
KLTH0E00220gsingletonON3063009961e-136
KLTH0A00528gsingletonON3063009961e-136
KLTH0E15532gsingletonON3093079881e-134
TBLA0A065105.434ON3123119781e-133
KAFR0E038405.434ON3103109681e-131
NCAS0F033805.434ON3133109661e-131
KLLA0B14707gsingletonON3103039611e-130
NDAI0B056705.434ON3183179611e-130
KLTH0F16060g5.434ON3093059581e-130
TDEL0D00230singletonON3123119551e-129
KLTH0A03476gna 1ON3083089451e-128
TBLA0A02835singletonON3113119421e-127
Kwal_55.214265.434ON3083049351e-126
KLLA0D10109gsingletonON3093018611e-115
AER401W5.434ON3133098391e-111
NDAI0A070003.108ON3202875905e-74
NCAS0I024203.108ON3202985351e-65
KLTH0C10010g3.108ON3213085245e-64
YBR149W (ARA1)3.108ON3443145124e-62
Kwal_56.226113.108ON3213085105e-62
KAFR0G013503.108ON3243105106e-62
Smik_2.289singletonON3443145082e-61
SAKL0C10626gsingletonON3222915045e-61
KNAG0K020703.108ON3233015045e-61
SAKL0C09922g3.108ON3223015036e-61
Smik_2.2883.108ON3443155031e-60
Skud_2.2763.108ON3443144934e-59
Suva_4.3983.108ON3443154909e-59
KLLA0F02728g3.108ON3303024742e-56
TDEL0D051603.108ON3252904732e-56
ACL107C5.409ON3543114448e-52
ZYRO0B06138g3.108ON3283104393e-51
KLLA0F03256g7.468ON2852794302e-50
KLTH0F16610g5.409ON3293114281e-49
Kwal_47.182197.468ON2932874232e-49
Ecym_55085.409ON3263094253e-49
SAKL0F14278g7.468ON2862774205e-49
Kpol_1013.827.468ON2852894162e-48
SAKL0G01914g5.409ON3293144123e-47
KLTH0G05786g7.468ON2862874083e-47
Kwal_47.18893na 2ON2892944084e-47
KAFR0G009207.468ON2862924066e-47
TDEL0E021505.409ON3293094096e-47
Smik_10.3847.468ON2822894023e-46
TDEL0C033207.468ON2832883998e-46
TPHA0E018605.409ON3263094002e-45
ZYRO0A06336g5.409ON3272863992e-45
YHR104W (GRE3)5.409ON3273053992e-45
KLTH0G02420gna 2ON2893113962e-45
YJR096W7.468ON2822893953e-45
TBLA0F01720singletonON3263093983e-45
KNAG0D013707.468ON2822903911e-44
Suva_15.3005.409ON3273063941e-44
KLLA0E21627g5.409ON3293023931e-44
KNAG0B03780singletonON3263163913e-44
KLTH0F01892gna 3ON3022773903e-44
Kwal_55.215365.409ON3292903913e-44
Smik_8.1825.409ON3273073913e-44
Skud_8.1655.409ON3273073913e-44
Kwal_33.13276na 3ON3022713885e-44
TBLA0A00630singletonON3282883896e-44
ZYRO0G17600g7.468ON2832883822e-43
NCAS0A066605.409ON3263053834e-43
CAGL0I01122g5.409ON3263083835e-43
KAFR0C05320singletonON3273083826e-43
Suva_12.1847.468ON2822893797e-43
SAKL0F02574gna 2ON2893143772e-42
Ecym_7160na 4ON2712803725e-42
CAGL0C04543g7.468ON2872753711e-41
Skud_10.3187.468ON2822893692e-41
NDAI0D016005.409ON3273093696e-41
NCAS0A137407.285ON3092953652e-40
ABL209Cna 4ON3102913633e-40
NCAS0H005607.468ON2842883613e-40
KLLA0F05775g7.285ON3093173623e-40
Smik_4.1137.285ON3123183538e-39
Kpol_1020.137.285ON3133233521e-38
ZYRO0E09614gna 5ON3083093502e-38
CAGL0J09394g7.285ON3113173485e-38
SAKL0F09746g7.285ON3123163442e-37
TDEL0D02790singletonON3293253417e-37
Skud_4.1317.285ON3123163398e-37
YDL124W7.285ON3123163372e-36
KAFR0B012007.285ON3153143363e-36
SAKL0F00704gna 5ON3153123293e-35
KLTH0G00638gna 5ON3133223275e-35
NDAI0A023007.285ON3133183276e-35
KNAG0C041107.285ON3113173241e-34
TBLA0F019807.285ON3023153222e-34
ZYRO0C09196g7.285ON3123023215e-34
Kwal_47.19278na 5ON3143203206e-34
Kpol_381.8singletonON3093023153e-33
Ecym_32647.285ON3113142498e-24
Kwal_33.13274singletonON108811641e-13
Suva_4.1227.285ON2061791242e-07
Suva_12.272singletonON2652441147e-06
Ecym_22962.604ON3401811112e-05
ABR094W2.604ON359183960.001
TBLA0G01120singletonON343140920.005
KLTH0E01474gsingletonON313211880.016
Suva_9.17singletonON30895870.019
TBLA0B10110singletonON345233870.019
Kpol_449.4singletonON341229850.035
TBLA0E05040singletonON342101850.040
NCAS0A129502.604ON32381840.042
TPHA0C025602.604ON34081830.057
NCAS0C02450singletonON343195830.066
Kpol_400.9singletonON341329820.083
NDAI0G012103.441ON164871810.17
NDAI0C01480singletonON343196790.20
KNAG0M023402.604ON309236770.33
ZYRO0F00858g2.604ON34688750.58
KAFR0F03890singletonON319306730.93
YNL331C (AAD14)na 6ON37690740.94
KLTH0E16852gsingletonON37590731.1
YDL243C (AAD4)singletonON32990721.3
NDAI0J00730singletonON343204721.4
KLTH0E02530g5.402ON372183712.3
Ecym_54172.169ON39444702.6
Suva_6.2681.149ON72365702.6
YFL056C (AAD6)singletonON21289692.7
Smik_14.1na 6ON37690693.0
Suva_14.10na 6ON37690693.0
CAGL0K00693g1.149ON87671694.1
TBLA0J012001.149ON120686684.8
Kwal_55.200115.402ON372583685.1
Smik_3.208singletonON344305675.4
TBLA0H037208.560ON901116685.7
SAKL0G07458g5.402ON372583677.1
Skud_10.383na 7ON37690668.4
Kpol_526.123.401ON2392143669.2
KNAG0B058304.196ON103355669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I01100g
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   637   0.0  
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   457   e-163
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   454   e-162
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   454   e-161
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   453   e-161
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   453   e-161
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   442   e-157
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   439   e-156
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   433   e-153
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   431   e-152
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   431   e-152
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     428   e-151
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   418   e-147
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     416   e-147
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   416   e-146
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     414   e-146
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   411   e-145
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   406   e-143
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   399   e-140
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   399   e-140
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 396   e-139
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   389   e-136
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   388   e-136
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   388   e-136
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   385   e-134
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   381   e-133
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   377   e-131
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     376   e-131
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   374   e-130
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   374   e-130
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   373   e-130
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   372   e-129
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   368   e-128
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     367   e-127
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   364   e-126
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   336   e-115
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   327   e-111
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   231   5e-74
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   210   1e-65
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   206   5e-64
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   201   4e-62
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   201   5e-62
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   201   6e-62
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   200   2e-61
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   198   5e-61
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   198   5e-61
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   198   6e-61
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   198   1e-60
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   194   4e-59
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   193   9e-59
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   187   2e-56
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   186   2e-56
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   175   8e-52
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   173   3e-51
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   170   2e-50
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   169   1e-49
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   167   2e-49
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   168   3e-49
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   166   5e-49
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   164   2e-48
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   163   3e-47
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   161   3e-47
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   161   4e-47
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   160   6e-47
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   162   6e-47
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   159   3e-46
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   158   8e-46
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   158   2e-45
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   158   2e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   158   2e-45
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   157   2e-45
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   156   3e-45
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     157   3e-45
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   155   1e-44
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   156   1e-44
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   155   1e-44
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               155   3e-44
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   154   3e-44
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   155   3e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   155   3e-44
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   155   3e-44
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   154   5e-44
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     154   6e-44
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   151   2e-43
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             152   4e-43
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   152   5e-43
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   151   6e-43
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   150   7e-43
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   149   2e-42
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   147   5e-42
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   147   1e-41
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   146   2e-41
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               146   6e-41
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   145   2e-40
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   144   3e-40
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   143   3e-40
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   144   3e-40
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   140   8e-39
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   140   1e-38
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   139   2e-38
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   138   5e-38
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   137   2e-37
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     135   7e-37
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   135   8e-37
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   134   2e-36
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   134   3e-36
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   131   3e-35
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   130   5e-35
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     130   6e-35
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   129   1e-34
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   128   2e-34
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   128   5e-34
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   127   6e-34
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   125   3e-33
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   100   8e-24
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    68   1e-13
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    52   2e-07
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    49   7e-06
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    47   2e-05
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    42   0.001
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    40   0.005
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    39   0.016
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     38   0.019
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    38   0.019
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    37   0.035
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             37   0.040
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    37   0.042
TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.6...    37   0.057
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    37   0.066
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    36   0.083
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    36   0.17 
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               35   0.20 
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    34   0.33 
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    33   0.58 
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      33   0.93 
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    33   0.94 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    33   1.1  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    32   1.3  
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    32   1.4  
KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa]...    32   2.3  
Ecym_5417 Chr5 (862054..862083,862150..863304) [1185 bp, 394 aa]...    32   2.6  
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    32   2.6  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    31   2.7  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    31   3.0  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    31   3.0  
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    31   4.1  
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    31   4.8  
Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa]...    31   5.1  
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    30   5.4  
TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {O...    31   5.7  
SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa]...    30   7.1  
Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331...    30   8.4  
Kpol_526.12 s526 (25596..32774) [7179 bp, 2392 aa] {ON} (25596.....    30   9.2  
KNAG0B05830 Chr2 (1146636..1149737) [3102 bp, 1033 aa] {ON} Anc_...    30   9.2  

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE
Sbjct: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL
Sbjct: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNS 180
           IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNS
Sbjct: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNS 180

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
           KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 301 PNWGPFKPFV 310
           PNWGPFKPFV
Sbjct: 301 PNWGPFKPFV 310

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  457 bits (1175), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 254/309 (82%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +T TL LNTGA IP +GLGTWQS +N+ Y + L ALK GYRHIDTAAIY+NE+++
Sbjct: 3   ATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AIRDS +PR ++FVTTKLW TQH  P +ALDQSL+RLGLDYVDLYLMHWPV L  D I
Sbjct: 63  GQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
           KDGN+L +P ++DGSR VD+ +WNF+KTWELMQELPK  KA+A+GVSNFSINNLK+LL S
Sbjct: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
           KGNK+ PAANQ+EIHPLLPQ+ELI+FC+ KGI++E YSPLGSTDAP+LKE  I EIAKKN
Sbjct: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
            V    +VISWHAQRGYVVLPKSV P+R+  N++ F LSDEDF  ++  +K  GE+RVV 
Sbjct: 243 NVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVH 302

Query: 301 PNWGPFKPF 309
           PNW PF+ F
Sbjct: 303 PNWSPFEAF 311

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  454 bits (1169), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/309 (67%), Positives = 256/309 (82%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
             LH +T TL LNTGA IP +GLGTWQS +N+ Y + L ALKAGY+HIDTAAIY+NE+++
Sbjct: 3   TTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AI+DS +PR E+FVTTKLW TQH  P +ALD+SL+RLGLDYVDLYL+HWP  L T+ I
Sbjct: 63  GQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
           KDG++L +P + DGSR VD+ +WNF+KTWELMQELPK  K +AIGVSNFSINNLK+LL S
Sbjct: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
            GNK+ PAANQ+EIHPLLPQ+ELINFCK K I++EAYSPLGSTDAP+LKE  I +IAKKN
Sbjct: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
            V  G +VISWHAQRGYVVLPKSV P+RI  N++ F LS+EDF  ++N +K+ GE+RVV+
Sbjct: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302

Query: 301 PNWGPFKPF 309
           PNW PF+ F
Sbjct: 303 PNWSPFEAF 311

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  454 bits (1167), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 211/309 (68%), Positives = 256/309 (82%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +T TL LNTGA IP +GLGTWQS +N+ Y + + ALK GYRHIDTAAIY NE+++
Sbjct: 3   ATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AI+DS +PR E+FVTTKLW TQH  P +ALDQSLKRLGLDYVDLYLMHWPV L  + I
Sbjct: 63  GQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPNYI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPK-EKARAIGVSNFSINNLKELLNS 180
           KDG++L IP +EDGSR VD+ +WNF+KTWELMQELPK  K RA+GVSNFSINNLK+LL S
Sbjct: 123 KDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLLAS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
            GN++ PAANQ+E+HPLLPQ+ELI+FCK KGI++EAYSPLGSTDAP+LKE  + EIAKKN
Sbjct: 183 PGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAKKN 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
            V  G +VISWHAQRGYVVLPKSV P+RI  N++ F LSDEDF  ++N +K+ GE+RVV+
Sbjct: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRVVN 302

Query: 301 PNWGPFKPF 309
           P+W PF+ F
Sbjct: 303 PDWSPFEAF 311

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  453 bits (1166), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 255/311 (81%), Gaps = 2/311 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSS-ENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           + L  +T+T KLNTGA IP +GLGTWQS+ ENEGY A + ALKAGYRHIDTAAIYKNE++
Sbjct: 3   STLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQ 62

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +G+AI DS IPR E+FVTTKLWGTQHR+P  AL+QSL+RLGLDYVDLYLMHWPVA K D 
Sbjct: 63  VGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKPDS 122

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           IKDGN   +P   +G RD+DL  WNFVKTWELMQELPK  K RA+GVSNFSINNLK LL+
Sbjct: 123 IKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKALLS 182

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           S GNK+VPAANQ+E HPLLPQDEL  FCKEKGI+LEAYSPLGST+APIL E +I EIAKK
Sbjct: 183 SPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIAKK 242

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
           + V   Q+VISWH Q+G+VVLPKSV  ERI  N +TF+LS ++  +L+N +K+ GERR+V
Sbjct: 243 HNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERRIV 302

Query: 300 SPNWGPFKPFV 310
            PNW PF PFV
Sbjct: 303 QPNWAPFVPFV 313

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  453 bits (1165), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/309 (69%), Positives = 251/309 (81%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A LH +T  L LNTGA IP IGLGTWQS EN+ Y A L ALK GYRHIDTAAIY+NE+++
Sbjct: 3   ATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AI+DS +PR E+FVTTKLW TQH  P  ALDQSLKRLGLDYVDLYLMHWP  L    I
Sbjct: 63  GQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
           K+ ++L +P ++DGSR VD+ +WNF+KTWELMQELPK  K +A+GVSNFSINNLK+LL S
Sbjct: 123 KNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLAS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
           +GNK+ PAANQ+EIHPLLPQDELINFCK KGIV+EAYSPLGSTDAP+LKE  I EIAKKN
Sbjct: 183 QGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKN 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
            V  G +VISWH QRGYVVLPKSV P+RI  N++ F LS EDF  ++N +K+ GE+RVV 
Sbjct: 243 NVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVH 302

Query: 301 PNWGPFKPF 309
           PNW PF+ F
Sbjct: 303 PNWSPFEVF 311

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  442 bits (1136), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 250/309 (80%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +++TLKLNTGA IPV+G GTW+S +N GY++ + ALKAGYRHID AAIY NEEE+
Sbjct: 3   ATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           GRAI+DS +PR E+F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKTD +
Sbjct: 63  GRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
            DGN+L IP  EDG+ D+D ++WNF+KTWELMQELPK  K +A+GVSNFSINN+KELL S
Sbjct: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
             NKVVPA NQIEIHPLLPQDELI FCKEKGIV+EAYSP GS +AP+LKE+ I ++AKK+
Sbjct: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV   QL+ISW  QRGYVVL KSV PERI  N + F L ++DF T+SN +K HG +RVV 
Sbjct: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302

Query: 301 PNWGPFKPF 309
             WG F  F
Sbjct: 303 MKWGSFPIF 311

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  439 bits (1129), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 206/309 (66%), Positives = 250/309 (80%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +++TLKLNTGA IPV+G GTW+S +N GY++ + ALKAGYRHID AAIY NEEE+
Sbjct: 3   ATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEEV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AI+DS +PR E+F+TTKLWGT+ R+P  ALD+SLKRLGLDYVDLYLMHWPV LKTD I
Sbjct: 63  GKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTDTI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
            DG+ L IP  EDG+ DVD ++WNFVKTW+LMQ+LPK  K +A+GVSNFSINN+KELL S
Sbjct: 123 TDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLKS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
             NK+VPA NQIEIHPLLPQDELI FCKEKGIV+EAYSP GS +AP+LKE+ I ++AKK+
Sbjct: 183 PSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV   QL+ISW  QRGYVVL KSV PER+  N + F L ++DF T+SN +K HGE+RVV+
Sbjct: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRVVN 302

Query: 301 PNWGPFKPF 309
             W  F  F
Sbjct: 303 MQWNSFPIF 311

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 249/311 (80%), Gaps = 2/311 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSE-NEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           A L KNTS LKLNTGA I  IGLGTW+S+   + Y++ + AL+AGYRHIDTAAIY NE E
Sbjct: 3   ATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE 62

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +GRAIR+S +PR E+FVTTKLW TQH+ P  ALDQSLKRLGLDYVDLYLMHWPV ++ + 
Sbjct: 63  VGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGEN 122

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           + +G+ +  P   +G RD+D+ DWNFVKTWELMQ+LP+  K RAIGVSNFSINNLK+LL 
Sbjct: 123 MPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLA 182

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           S GNK+VPAANQ+E+HPLLPQ EL++FC  KGIV+EAYSPLGS DAPILKE  I EIAKK
Sbjct: 183 SPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKK 242

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
           NGV+A Q+VISW+ QRGY+VLPKSV  ERI  N  TF L+ EDF  ++N +K  G +R++
Sbjct: 243 NGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRII 302

Query: 300 SPNWGPFKPFV 310
            P+W PFKPFV
Sbjct: 303 DPDWEPFKPFV 313

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 248/309 (80%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  ++++LKLNTGA IPV+G GTW+S EN GY++ + ALKAGYRHID AAIY NEEE+
Sbjct: 3   ATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           GRAI+DS +PR ++F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKT+ I
Sbjct: 63  GRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
            DGN+L IP  +DG+ DVD  +WNF+KTW+LMQELPK  K +A+GVSNFSINN+K LL S
Sbjct: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
             NK+VPAANQIEIHPLLPQ+ELI FCKEKGIV+EAYSP GS +AP+L+E+ I ++AKK+
Sbjct: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV   QL+ISW  QRGYVVL KSV PERI  N + F L ++DF  +SN +K HGE+RVV 
Sbjct: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302

Query: 301 PNWGPFKPF 309
             W  F  F
Sbjct: 303 MKWSSFPIF 311

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 246/309 (79%), Gaps = 1/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +++TLKLNTGA IP +G GTW+S +N GY++ + ALK GYRHID AAIY NEEE+
Sbjct: 3   ATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           GRAI+DS I R E+F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKTD +
Sbjct: 63  GRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTV 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
            DGN+L IP  EDG+ DVD ++WNF+KTW+LMQELPK  K RA+GVSNFSINN+KELL S
Sbjct: 123 TDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKS 182

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
             NK+VPA NQ+EIHPLLPQDELI FCKEKGIV+EAYSP GS +AP+LKE+ I ++AKK+
Sbjct: 183 PSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV   QL+ISW  QRGYVVL KSV PER+  N + F L ++DF  + + +K HGE+RVV+
Sbjct: 243 GVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVN 302

Query: 301 PNWGPFKPF 309
             W  F  F
Sbjct: 303 MKWASFPIF 311

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  428 bits (1101), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/306 (66%), Positives = 244/306 (79%), Gaps = 2/306 (0%)

Query: 7   NTSTLKLNTGAHIPVIGLGTWQSS-ENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI 65
           +T+T KLNTGA I  +GLGTWQS+ ENEGY A + ALKAGYRHIDTAAIY NE ++G+AI
Sbjct: 17  STTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKAI 76

Query: 66  RDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGN 125
            DS +PR E+FVTTKLW TQH +P   L+ SLKRLGLDYVDLYLMHWPV L    IKDGN
Sbjct: 77  NDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDGN 136

Query: 126 LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNK 184
            L IP   DG RDV+++ W++VKTWELMQELPK  K RA+GVSNFSINNLK++L+S GNK
Sbjct: 137 FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGNK 196

Query: 185 VVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNA 244
           VVPA NQ+EIHPLLPQ+EL+ +C  KGI+LEAYSPLGST+APIL E  +  +AKK+GV  
Sbjct: 197 VVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQT 256

Query: 245 GQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWG 304
            Q+VISWH QRGY+VLPKSV  ERI  N +T KLSDE+   ++N +K+ GERR+V P+W 
Sbjct: 257 AQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHWE 316

Query: 305 PFKPFV 310
           PF PFV
Sbjct: 317 PFVPFV 322

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  418 bits (1075), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 194/308 (62%), Positives = 242/308 (78%), Gaps = 1/308 (0%)

Query: 3   ALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG 62
           +L  +T+TLKLNTGA IPV+GLGTW+S+ N+GY++ L ALK GYRHID AAIY NE+++G
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 63  RAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIK 122
           RAI+DS +PR E+F+TTKLWGT+HRNP +ALD SLKRLGLDYVDLYLMHWPVALK    +
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSK 181
           + +LL IP++ DG  D+D+EDW+F+KTWELMQELPK  K +AIGVSNFSINNLK L NS 
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
               VPAANQ+EIHPL PQ ELI +CK + I++EAYSP GS DAP+LKE E+ ++A+K  
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSP 301
           ++  QL+ISW  QRGYVVLPKSV  ERI  N +   L DED  T++N +K  GE+R+V  
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 302 NWGPFKPF 309
           +W PF  F
Sbjct: 302 DWSPFPTF 309

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  416 bits (1070), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 239/309 (77%), Gaps = 2/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           AAL   T+T+KLNTGA+IP IGLGTW+S  N+GY++ + A K GYRHIDTAAIY NE+++
Sbjct: 3   AALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AI +  + R+ELFVTTKLWGTQ R+P  AL+QSLKRLGLDYVDLYL+HWPVA KTD I
Sbjct: 63  GKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTDTI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
           KDGNLL IP ++DG  D+D  +WNF+KTWELMQ L K  K +AIG+SNFSINN+KELL +
Sbjct: 123 KDGNLLTIP-KKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLAA 181

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
               V PA NQ+E+HPLLPQDELI FCKEKGIV+EAYSPLG  +AP+LK+E I EIAK+N
Sbjct: 182 PTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKRN 241

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
            V+AGQ+V SWH QRGYVVLPKSVK  RI  N +TF LSD+D   ++N  K  GE R   
Sbjct: 242 NVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRTCD 301

Query: 301 PNWGPFKPF 309
                F  F
Sbjct: 302 LGIKGFPMF 310

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  416 bits (1069), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 242/307 (78%), Gaps = 1/307 (0%)

Query: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63
           L  +++T+KLNTGA IP +GLGTW+SS+ E YN+ L A+K GYRHID+AAIY NEE +G+
Sbjct: 5   LKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPVGK 64

Query: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
           AIRDS +PRNELFVTTKLWGTQ RNP +ALD SLKRLGLDYVDLYL+HWP+A KTD IKD
Sbjct: 65  AIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNIKD 124

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182
            + L +P  +DG  DVD++DWNFVKTWEL+QELP   KA+A+GVSNFS+NNLKELL S G
Sbjct: 125 DDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLASPG 184

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
           NK+VPA NQ+E+HPLLPQDELI F K KGIV+EAYSPLGS  +P+LKE  I E+AKK GV
Sbjct: 185 NKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKYGV 244

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPN 302
              Q++I+W  QRGYV+LPKSV P+R+  N + F LS ED   +   +K+ G +R V P+
Sbjct: 245 EPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVHPD 304

Query: 303 WGPFKPF 309
           W  F  F
Sbjct: 305 WPSFPIF 311

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  414 bits (1063), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/295 (64%), Positives = 242/295 (82%), Gaps = 2/295 (0%)

Query: 16  GAHIPVIGLGTWQSSEN-EGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNE 74
           GA +P++GLGTW+++++ EGYNA   AL+AGYRHIDTAAIY+NEE +GRAIR+S IPR+E
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVVGRAIRESGIPRDE 76

Query: 75  LFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPERED 134
           +FVTTKLWGTQHR+P  ALDQSL+RLGLDYVDLYLMHWPV ++    K  +LL+ P R D
Sbjct: 77  IFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEAKYSKSSSLLEFPYRPD 136

Query: 135 GSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSKGNKVVPAANQIEI 194
           GS  V+  DW+F+KTWELMQELPK K RAIGVSNFSINN+ +LL S GNK+VPAANQ+E+
Sbjct: 137 GSLAVE-SDWDFIKTWELMQELPKTKTRAIGVSNFSINNINDLLKSPGNKIVPAANQVEL 195

Query: 195 HPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNAGQLVISWHAQ 254
           HPLLPQ EL+ FC+EKGIV+EAYSP GS  AP+L E+ I E+AKK+ V+A Q+++SWH +
Sbjct: 196 HPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKHDVSAAQVILSWHIK 255

Query: 255 RGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWGPFKPF 309
           RG  VLPKSV  ER+  N +TF L ++DFAT++N +K+ GE+RVV+ +W PFK F
Sbjct: 256 RGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVVNFDWSPFKIF 310

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 237/310 (76%), Gaps = 2/310 (0%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M  L  +TSTLKLNTG  IP +GLGTW+S ENEGY A +EALKAGYRHID AA+Y NE E
Sbjct: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +G+AI+DS +PRNE+F+TTKLW TQ RNP EALDQSL+RLGLDYVDLYL+HWPV L+T+ 
Sbjct: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           IKDGNL Q  E+ DGS+DVDLE WNF+KTWELMQ+L +  K +AIGVSNFS+NNLK+LL 
Sbjct: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           +   KV PA NQ+E+HPLLPQ++LI F KE GIV+EAYSPLG  +APIL +  + EIAK 
Sbjct: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
           NGV AG +VISW  Q+G V LPKSV P RI GN +   LSD D A +    K  GERR  
Sbjct: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299

Query: 300 SPNWGPFKPF 309
             ++ PF  F
Sbjct: 300 YQDFSPFPIF 309

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 236/309 (76%), Gaps = 2/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  NTST+KLNTG  IP +GLGTW+S E +GY A   ALKAGYRHID AAIY NEEE+
Sbjct: 3   ATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEV 62

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+AIRDS IPR ELF+TTKLW TQ RNP EAL+QSL+RLGL+YVDLYLMHWPV LKT  I
Sbjct: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPK-EKARAIGVSNFSINNLKELLNS 180
            DGNLL  P +EDG  DVD E W+FVKTWELMQELPK +KAR++GVSNFSINNLKELL S
Sbjct: 123 TDGNLLSSPAKEDGKPDVDTE-WDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
            GNK+VPA  Q+EIHPLLPQ  L +FCKE  I +EAYSPLG   AP+L +  I +IA ++
Sbjct: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRH 241

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
             +AG +V+SW  QRG V LPKS  PER+  N  TFKLSDE+  +++N +K  G++R  +
Sbjct: 242 NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNA 301

Query: 301 PNWGPFKPF 309
           P+  PF  F
Sbjct: 302 PDMSPFPLF 310

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 233/309 (75%), Gaps = 1/309 (0%)

Query: 3   ALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG 62
            L  +T+ + LN G  +P +GLGTWQS EN+ Y A + ALKAGYRHIDTAAIY NEEE+G
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 63  RAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALK-TDLI 121
           RAI+DS + R+E+FVTTKLWGTQHR+P +AL+QSL+RLGLDYVDLYLMHWPV +      
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSK 181
           KD N LQIP  EDG+RD+DL  W+F+KTWELMQ LPK K ++IGVSNFSINN+K+LL S 
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSKVKSIGVSNFSINNIKDLLASP 181

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
           GNK VP  NQ+E+HPLLPQ EL+ FCK K IV+EAYSPLGST APIL+   I E++KK  
Sbjct: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKLA 241

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSP 301
           +    +V SW  QR  VVLPKSV   RI  N +T +L  E+F+ L+N + + GE+R V P
Sbjct: 242 IPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVKP 301

Query: 302 NWGPFKPFV 310
           NW PF PFV
Sbjct: 302 NWTPFIPFV 310

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/307 (63%), Positives = 233/307 (75%), Gaps = 3/307 (0%)

Query: 6   KNTST-LKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRA 64
           KN  T +KLNTGA +P +GLGTWQS EN+ Y A L ALK GYRHID AAIY NE E+G+A
Sbjct: 4   KNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVGKA 63

Query: 65  IRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD- 123
           IRDS +PRNE+FVTTKLWGTQ R P  AL+QSL+RLGLDYVDLYL+HWP+ L     ++ 
Sbjct: 64  IRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCEES 123

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182
           GN L  P   +G RDVDL+ WNFVKTWELMQELP   K +A+GVSNFSINN+KELL+S G
Sbjct: 124 GNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSSPG 183

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
           NK+VPA NQIE+HPLLPQ EL+NFCKEKGIV+EAYSPLG T A ILKE  + E+AKK  +
Sbjct: 184 NKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKYNI 243

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPN 302
            A  LV+SW  QRG VVLPKSV   RI  N +T  L+ ED   ++N +K+ GE+R  +P+
Sbjct: 244 PAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCAPD 303

Query: 303 WGPFKPF 309
           + PF  F
Sbjct: 304 FSPFNTF 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  396 bits (1018), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 232/310 (74%), Gaps = 1/310 (0%)

Query: 1   MAALHKNTS-TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEE 59
           M+   KN   T  +     IP + LGTW+++ NE Y A LEALKAGYRHID AAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTD 119
           E+G+AIRDS IPR ++FVTTKLWGT+ RNP  ALD SLKRLGLDYVDLYLMHWPVALK D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLN 179
            I D +LL IP+   G  D+D+E+WNF+KTWELMQELP  KA+AIGVSNFSINNL ELL 
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELPTSKAKAIGVSNFSINNLNELLA 180

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           +   K +PAANQ EIHPLLPQ+ELI +C++K I++EAY PLG ++ P++    ITEIA K
Sbjct: 181 APTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATK 240

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
            GVNAGQL+ISW  QRGYVVLPKSV+ ERI  N +T  +  E+F  ++N  K+ G +R V
Sbjct: 241 LGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSV 300

Query: 300 SPNWGPFKPF 309
           + ++ PF  +
Sbjct: 301 NIDFSPFPTY 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  389 bits (1000), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 186/307 (60%), Positives = 229/307 (74%), Gaps = 2/307 (0%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M AL  NT   KLNTGA IP++G GTW+S+E EGYNA L A+K GYRHID+AA+Y NE  
Sbjct: 1   MPALKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAA 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +GRAIRDS +PR ELFVTTKLW TQ R P +ALDQSL+RLGLDYVDLYL+HWP+ +KTD 
Sbjct: 61  VGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDR 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           I DGNL  IP +EDG  DVD E W+++KTW+LMQELP   K RA+GVSN S++ L++LL 
Sbjct: 121 ITDGNLFSIPTKEDGKPDVDTE-WDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLA 179

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
            KGNKVVPA  Q+E HPLLPQ++L++FC +  I+LEAYSPLGS  +P++ E  I EIAKK
Sbjct: 180 DKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKK 239

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
              +  Q++ISW  +RGYVVLPKSV P RI  N +T  L DEDF  ++    + GE+RV 
Sbjct: 240 YNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVN 299

Query: 300 SPNWGPF 306
            P W  F
Sbjct: 300 DPEWFTF 306

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  388 bits (996), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/300 (59%), Positives = 234/300 (78%), Gaps = 1/300 (0%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD 67
           T  L++NTG  IPV+GLGTW++++ + Y A L AL++GYRHIDTAAIY+NE  +GRAIRD
Sbjct: 3   TLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRD 62

Query: 68  SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLL 127
           S +PR ++FVTTKLW TQ R+P  AL+ SL+RLGLDYVDLYLMH+PVALKTDLIKDGN+L
Sbjct: 63  SGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVL 122

Query: 128 QIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNKVV 186
            IP R DG+RDVD++ W+FVKTW+LMQ+LPK  K +AIGVSNFSI N++E+L  +    V
Sbjct: 123 SIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSV 182

Query: 187 PAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNAGQ 246
           PAANQIEIHP LPQDELI +CK KGI++EAYSPLGS+++ +L + ++ ++A+K+ V   Q
Sbjct: 183 PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQ 242

Query: 247 LVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWGPF 306
           ++ISW   RGY +LPKSV  +R+  N +  KLS  D   +S   +K G +R VSP+W PF
Sbjct: 243 ILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  388 bits (996), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 179/300 (59%), Positives = 234/300 (78%), Gaps = 1/300 (0%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD 67
           T  L++NTG  IPV+GLGTW++++ + Y A L AL++GYRHIDTAAIY+NE  +GRAIRD
Sbjct: 3   TLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRD 62

Query: 68  SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLL 127
           S +PR ++FVTTKLW TQ R+P  AL+ SL+RLGLDYVDLYLMH+PVALKTDLIKDGN+L
Sbjct: 63  SGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVL 122

Query: 128 QIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNKVV 186
            IP R DG+RDVD++ W+FVKTW+LMQ+LPK  K +AIGVSNFSI N++E+L  +    V
Sbjct: 123 SIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSV 182

Query: 187 PAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNAGQ 246
           PAANQIEIHP LPQDELI +CK KGI++EAYSPLGS+++ +L + ++ ++A+K+ V   Q
Sbjct: 183 PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQ 242

Query: 247 LVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWGPF 306
           ++ISW   RGY +LPKSV  +R+  N +  KLS  D   +S   +K G +R VSP+W PF
Sbjct: 243 ILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPF 302

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 178/307 (57%), Positives = 231/307 (75%), Gaps = 2/307 (0%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M+    +++  KL TGA IP++G GTW+S+E +GYNA L ALK GYRHIDTAA+Y NE  
Sbjct: 1   MSGPTNSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAA 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +GRAIRDS +PR++LFVTTKLW TQHR+P  ALDQSL+RLGLDYVDLYL+HWP+ L+T  
Sbjct: 61  VGRAIRDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQR 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELP-KEKARAIGVSNFSINNLKELLN 179
           I DGNL  +P +EDG  DVD E W++VKTWE+MQ+LP   K RA+GVSNFS+  L+ LL 
Sbjct: 121 ITDGNLFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLA 179

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           + G KV+PA NQ+E HPLLPQD+L  FC E  I+LEAYSPLGS  +P+++E  + EIA K
Sbjct: 180 ASGTKVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASK 239

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
           +  +  Q++ISW  +RGYV+LPKSV P RI  N +   L+D+DFA ++N  K+ GE+R+ 
Sbjct: 240 HNADPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRIN 299

Query: 300 SPNWGPF 306
            P+W  F
Sbjct: 300 DPDWFHF 306

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  381 bits (978), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 182/311 (58%), Positives = 232/311 (74%), Gaps = 2/311 (0%)

Query: 1   MAALHKNTST-LKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEE 59
           M A  KN+ T + LN G  IP +GLGTW+S EN+GYN+ + ALKAGYRHIDTAAIY+NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTD 119
           E+GRAI+DS +PR+++F+TTKLW T+ +NP  AL+ SLKRLGLDYVDLYLMHWPV L   
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELL 178
            IKD + L +P   DG+RDVD+E W+++KTWEL+QELP     R++GVSNFSINNL+++L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
           +S GNK+ PA NQ+E+HPLLPQ EL  +C  K I LEAYSP GS +AP LK++ I +IA 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 239 KNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRV 298
           KNGV+  Q++ SW  QR  VVLPKSV  ER+  N + F LS ED A +   AK +GE+R+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 299 VSPNWGPFKPF 309
             P+W PF  F
Sbjct: 301 NKPDWDPFPVF 311

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 231/310 (74%), Gaps = 3/310 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSS-ENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           A L  +T TLKLN G+ IP++GLGTWQ++ E + YNA   AL AGYRHIDTAAIYKNE +
Sbjct: 3   ANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQ 62

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +G AIRDS +PR E+FVTTKLW  QH  P  ALD+SL+RLGLDYVDLYLMHWPV+L    
Sbjct: 63  VGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSY 122

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNS 180
           +K+  L ++ +R DG+R V+  DW F+ TWELMQ+LPK K R+IGVSNFS+NNLK+LL +
Sbjct: 123 MKESPL-ELMKRPDGTRPVE-TDWTFINTWELMQKLPKNKVRSIGVSNFSVNNLKDLLKA 180

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
               VVP  NQ+E+HPLLPQ EL+++C++  I +EAYSPLGST AP+L E  + ++AKKN
Sbjct: 181 PTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKN 240

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV    +V+SW  QR  +VLPKSV  ER+  N +TF L +EDF  +   +++ GERR+ +
Sbjct: 241 GVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINN 300

Query: 301 PNWGPFKPFV 310
           PN+ PFK FV
Sbjct: 301 PNFEPFKTFV 310

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  376 bits (966), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 193/310 (62%), Positives = 235/310 (75%), Gaps = 2/310 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
             L  +T+TLKLNTGA+IP I LGTW+S    +GY++ + ALKAGYRHIDTAAIY NE++
Sbjct: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +G+AIRDS IPR E+FVT+KLW TQ  NP  AL  +L RLGLDY+DLYLMHWPV   T  
Sbjct: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           +K  + + IP+ E+G  D++++ WNFVKTWELMQELP     +A+GVSNFSINNLKELL 
Sbjct: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           S GNK+ PAANQIEIHPLLP+ +LI FC+EKGI++EAYSPLGS +APILKE +I EI+KK
Sbjct: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
             V   QL+ISWH QRGYVVL KS   ERI  N++ F LS EDF  + N AK+ G  RVV
Sbjct: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVV 302

Query: 300 SPNWGPFKPF 309
            P+W PF  F
Sbjct: 303 DPDWSPFPLF 312

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/303 (58%), Positives = 220/303 (72%), Gaps = 1/303 (0%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD 67
           + +LKLNTGA IPV+GLGTW+S E + YNA + AL+ GYRHIDTAAIY NEE +G+ IRD
Sbjct: 7   SPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGIRD 66

Query: 68  SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLL 127
           S +PR E+FVTTKLWGTQ R+P  ALD SL+RLGLDYVDLYL+HWPV L    I DGN L
Sbjct: 67  SGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGNYL 126

Query: 128 QIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNKVV 186
             P   DG  D+D+E+WNF+KTWE MQ LPK  K +AIGVSNFSI N++ LL +  + +V
Sbjct: 127 TFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDFIV 186

Query: 187 PAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNAGQ 246
           PAANQIEIHP LPQ ELI++CK KGI++EAYSPLGS+ + IL +  I  IA K       
Sbjct: 187 PAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEPAN 246

Query: 247 LVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWGPF 306
           ++ISW A RGYVVLPKSV P+RI  N +   LS ED   ++   +  G +R V+P++ PF
Sbjct: 247 ILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFSPF 306

Query: 307 KPF 309
             F
Sbjct: 307 AIF 309

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 233/317 (73%), Gaps = 8/317 (2%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYRHIDTAAIYKNEE 59
           M +   + + LKL+TGA IP IGLGTW+S   N+ Y++ + ALK GYRHIDTAAIY NE 
Sbjct: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTD 119
           ++G+AIRDS +PRNE+FVT+KLW  Q  +P  AL+Q+LKRLGLDY+DLYLMHWPV     
Sbjct: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120

Query: 120 LIKDGN-----LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINN 173
            IKD +      + IP   +G+ DV+++ WNF+KTWELMQ LP+  K +A+GVSNFSINN
Sbjct: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180

Query: 174 LKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEI 233
           L +LL +   KVVPAANQIE+HPLL Q+EL+ +CKEK I++EAYSP GS +APILK+E I
Sbjct: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240

Query: 234 TEIAKKNGVNAGQLVISWHAQR-GYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKK 292
             IAKK  +  GQ+V+SWH QR GYVVLPKSV  ERI  N++   L DEDF  ++N  K+
Sbjct: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300

Query: 293 HGERRVVSPNWGPFKPF 309
            GE RVV P+W PF  F
Sbjct: 301 KGELRVVDPDWSPFPLF 317

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 231/305 (75%), Gaps = 2/305 (0%)

Query: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63
           L K T+T KLNTGA IP++GLGTW+S++  GYNATL A+KAGYRHID AA+  NE+ +GR
Sbjct: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64

Query: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
           AIRDS +PR ELFVTTKLW TQHR+P  AL QSLKRLGLDYVDLY+MHWPVA +++ +K 
Sbjct: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182
            N + IP+R+DG  DVD E W++VKTWELMQELP   K  A+GV+NFS++ LK+L++S G
Sbjct: 125 TNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPG 183

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
           NK+VPAA+Q+E HP LPQ+++++FCK+  I++EAYSPLGS  AP+L E  + EI+KK  V
Sbjct: 184 NKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHV 243

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPN 302
              QL++SW  QRG+ VL KS  P RI  N  TF + + D   ++  A++ G +R+ +P 
Sbjct: 244 EPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRIHNPT 303

Query: 303 WGPFK 307
           W  F+
Sbjct: 304 WFSFE 308

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/311 (57%), Positives = 221/311 (71%), Gaps = 2/311 (0%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M      T + KLNTGA +P IGLGTW+SSE + Y A L ALKAGY+HIDTAAIY+NE  
Sbjct: 1   MTVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERA 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +G+AIRDS IPR+ELF+TTKLW TQHR+P  ALD SL+RLGLDYVDLYL+H+PVA KTD 
Sbjct: 61  VGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDR 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           I+DGN    P   +G RDVD+ DW+FVKTW L+Q LP+  K +A+GVSNFSINNLK LL 
Sbjct: 121 IEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLE 180

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
           S     VPA NQ+EIHP LPQ ELI+FCK K IV+EAYSPLGST + +L ++ + +IA+K
Sbjct: 181 SDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEK 240

Query: 240 -NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRV 298
                  Q++I+W   RGY VLPKSV P+RI  N     +  ED   ++N     G +R 
Sbjct: 241 XXDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRY 300

Query: 299 VSPNWGPFKPF 309
           + P+W PF  F
Sbjct: 301 LEPDWSPFPIF 311

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  368 bits (945), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 226/308 (73%), Gaps = 3/308 (0%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M+A   +TS  KLNTGA IP++GLGT+ S +  GY A L A+K GYRHID AA+YKNE+ 
Sbjct: 1   MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDF 60

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +GRAIRDS +PR ELFVTTK+W TQHR P +AL++SL RLGLDYVDL+LMHWP AL+T+ 
Sbjct: 61  VGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTER 120

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
           I DGN++ +P+RED   DVD E WN++KTW LMQ+LP   K +A+GVSNFS+  L++LL 
Sbjct: 121 ITDGNMITVPKREDEKPDVDTE-WNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLA 179

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
             G+KVVPA NQ+E+HPLLPQ  L +FCK+K I+L AYSPLGS  AP+L +  I EIA K
Sbjct: 180 DPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAK 239

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299
           +  +  Q++I W  +RGYV LPKSV P RI  N +   L+D +   ++   KK GE+RVV
Sbjct: 240 HKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHKK-GEKRVV 298

Query: 300 SPNWGPFK 307
            P W  F+
Sbjct: 299 DPEWFDFE 306

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 181/311 (58%), Positives = 232/311 (74%), Gaps = 3/311 (0%)

Query: 1   MAALHKN-TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEE 59
           MA   KN T T+ LN G  IPVIGLGT+ S +NE Y A + A KAGYRH+DTAA YKNEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTD 119
           ++G+A++D  +PR+E++VTTK+W T+ R+P  ALD+SLKRLGL+Y+DLYLMHWPV LKTD
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178
            IKDG L+ IP   DG+ DVD +DW FV+ WE MQ+L K  K ++IGVSNFSINN+KELL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
            +    VVP  NQ+E+ PLLP DELI FC+ K I+ +AY P G ++AP++K+  + EIAK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 239 KNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRV 298
            NGV+AGQ++ SWH QRGYVVLPKSVK  RI  N +TF LSD D   ++N +K  GE+R+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 299 VSPNWGPFKPF 309
            + N+ PF  F
Sbjct: 300 NNVNFSPFPIF 310

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  364 bits (935), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 220/304 (72%), Gaps = 1/304 (0%)

Query: 4   LHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGR 63
           L K T+T  LNTGA IP++GLGTW+ ++  GY A L ALKAGYRHID+AA+  NE+ IG+
Sbjct: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64

Query: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
           AIRDS + R+ELFVTTKLW TQHR+P+ ALDQSLKRLGL+YVDLY+MHWP+A + D IK 
Sbjct: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSKGN 183
            N + IP   +G   VD  DW++VKTWELMQ+LP EK RAIGV+NFS+  L  LL S  N
Sbjct: 125 KNFMLIPRNSEGKPYVD-TDWDYVKTWELMQKLPTEKTRAIGVANFSVPQLTSLLKSPNN 183

Query: 184 KVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVN 243
           K++PAA+Q+E HP LP DE++ FC+EKGI++EAYSPLG    P++ E  I EI+KK  V 
Sbjct: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243

Query: 244 AGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNW 303
             QL+ISW  +RG  VLPKS    RI  N E F LSDED+  +   A++ G +R  +P W
Sbjct: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRTHNPPW 303

Query: 304 GPFK 307
             F+
Sbjct: 304 FSFE 307

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  336 bits (861), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 209/301 (69%), Gaps = 3/301 (0%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSN 69
           +LKLNTGA IP +G GTW SS  + Y A + ALK GYRHID AA+Y NE  +G+ IRDS 
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 70  IPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQI 129
           IPR E+FVTTKLW TQ R+P  ALD+SL+RLGLDYVDL+L+HWPV LK  +    NLL+ 
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLK-PVGGPENLLKY 128

Query: 130 PEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNKVVPA 188
           P      + +D EDW+F+KTWELMQ LPK  K RA+GVSNFSI NL++LLNS  + +VPA
Sbjct: 129 PTPGIKPQ-IDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 189 ANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGVNAGQLV 248
            NQ EIHP LPQ ELIN+CK KGIV+EAY PLGS+ + +L +  I EIA K  V    ++
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 249 ISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVSPNWGPFKP 308
           I+W   RGY VLPKS  P RI  N+    LS ED   ++  ++  G +R V P++ P+  
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 309 F 309
           F
Sbjct: 308 F 308

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/309 (53%), Positives = 221/309 (71%), Gaps = 2/309 (0%)

Query: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61
           A L  +T T+ LNTGA IP+ GLGTWQS++++  +A   ALK GY+HIDTA+ YKNEE +
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           G+A+++S IPR ELF+TTK+W  Q R+P  ALD SLK+LG +YVDL LMHWPV  K    
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL-PKEKARAIGVSNFSINNLKELLNS 180
              +  ++P   DG    D E+W+FVKTW LMQ+L    K +AIGVSNFSINNL+ELLN+
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
           +G  VVPA NQ+E+H  LPQ EL+ +C++KGIV+EAYSPLGS+ AP+LK+  + ++A+K 
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300
           GV    +++++ A RG VVLPKSVK  RI  N E FK+ +ED   L++  KK G +R V 
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 301 PNWGPFKPF 309
           P++ PF  F
Sbjct: 304 PDFSPFPLF 312

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  231 bits (590), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 179/287 (62%), Gaps = 15/287 (5%)

Query: 11  LKLNTGAHIPVIGLGTWQSSENEGYNATLEALKA----GYRHIDTAAIYKNEEEIGRAIR 66
             LN G  IP IGLGT  +S  + Y  T EA+KA    GYRHIDTA  YK E  IG+A++
Sbjct: 11  FNLNNGTRIPAIGLGT--ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALK 68

Query: 67  D----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIK 122
           +    + I R ELF+TTK+W T   NP++++DQSLK LG+DYVDL L HWPV  +     
Sbjct: 69  ELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENS 128

Query: 123 DGNLLQIPEREDGSRDVDLE-DWNFV-KTWELMQELPKE-KARAIGVSNFSINNLKELLN 179
            GN++ +P  +DG+   + + DW F  K  E +   PK+ + RAIGVSN+ I  L+ L  
Sbjct: 129 QGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLF- 187

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
            K  KV PA NQ+E+HP LPQ EL  FC +  I+L AYSPLGS  AP LK + + ++AKK
Sbjct: 188 -KECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKK 246

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATL 286
             V    ++ S+H  +G VVLP+S+ P+RI  N    KL+D+D + L
Sbjct: 247 YKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKL 293

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  210 bits (535), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/298 (39%), Positives = 178/298 (59%), Gaps = 13/298 (4%)

Query: 11  LKLNTGAHIPVIGLGTW--QSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI--- 65
             LN G  IP IGLGT   +    E   A   A++AGYR IDTA  YK E  IG A+   
Sbjct: 11  FNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKEL 70

Query: 66  -RDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDG 124
            RD  I R +LF+TTK+W     +P+ ++++SLK LG+DYVD+ L HWP+  K    ++G
Sbjct: 71  FRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKKTYDENG 130

Query: 125 NLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVSNFSINNLKELLNS 180
            ++  P  +DG + +  E  +++ T++LM+++   PK+ + RAIGVSN+ I  L+ ++  
Sbjct: 131 TIIGKPLDKDG-KVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVI-- 187

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
           K  KV P  NQ+E+HP LPQ EL +FC + GI+L AYSPLGS  AP  K   + E AKK+
Sbjct: 188 KECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAKKH 247

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRV 298
            V    ++ S+H ++G VV+P+S+ PER+  N     L+  +  +L ++      R +
Sbjct: 248 EVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFGVNTPHRYI 305

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  206 bits (524), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 122/308 (39%), Positives = 184/308 (59%), Gaps = 15/308 (4%)

Query: 6   KNTST-LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEEEIG 62
           KNT     LN G  +P IGLGT    E   +   A   A+K+GYRHIDTA  Y+ E+ +G
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 63  RAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKT 118
            A+++      + R ++FVTTK+W T      E++ +SL+ LGLD+VDL L HWP+    
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 119 DLIKDG--NLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKEKARAIGVSNFSINN 173
               DG   + + P  EDGS   + E  ++++T++ +++L      + RAIGVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYN-EKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 174 LKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEI 233
           L+ LL  K  +VVPA NQ+E HP LPQ EL +FC +  I LEAYSPLG+T+AP++  E +
Sbjct: 184 LERLL--KECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 234 TEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKH 293
            +IA K   +   ++I++H ++G V +P+SV P+ I  N +   LS ED  TL+ +  ++
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFGVEN 301

Query: 294 GERRVVSP 301
            +R V  P
Sbjct: 302 TKRIVDEP 309

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  201 bits (512), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 124/314 (39%), Positives = 185/314 (58%), Gaps = 21/314 (6%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  T+ +   LN G  IP +GLGT    E   E   A   A+KAGYRHIDTA  Y+ E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 60  EIGRAIR----DSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI+    D +I R +LF+TTK+W         +L++SLK LGL+YVDL L HWP+ 
Sbjct: 76  FVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLC 135

Query: 116 LKTDLIKD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVS 167
            +   IKD      L++ P  +D  + +   D ++++T++ ++++   P + + RAIGVS
Sbjct: 136 FEK--IKDPKGISGLVKTP-VDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 168 NFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPI 227
           NFSI  L+ L+  K  +V P  NQ+E HP LPQ EL  FC    I+L AYSPLGS  AP 
Sbjct: 193 NFSIEYLERLI--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPN 250

Query: 228 LKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLS 287
           LK   + ++A+K  V    L+IS+H ++G +V+P+S+ P RI  + E   L+ ++   L+
Sbjct: 251 LKIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELN 310

Query: 288 NYAKKHGERRVVSP 301
           ++ +K+  R +  P
Sbjct: 311 DFGEKYPVRFIDEP 324

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  201 bits (510), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 184/308 (59%), Gaps = 16/308 (5%)

Query: 4   LH-KNTST-LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH KNT     LN G  +P +GLGT    E   +   A   A+K+GYRHIDTA  Y+ E+
Sbjct: 2   LHPKNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCED 61

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            IG A+++      I R ++F+TTK+W T      E++ +SL+ LG+DYVDL L HWP+ 
Sbjct: 62  RIGEALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLC 121

Query: 116 LKTDLIKDG--NLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK---ARAIGVSNFS 170
                  +G   + + P  EDGS   + E  ++++T++ ++++   K    R+IGVSN+ 
Sbjct: 122 FNRLQDPEGIDGICRNPTHEDGSPHYN-EKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYP 180

Query: 171 INNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKE 230
           +  L+ LL  K  KVVPA NQ+E+HP LPQ EL +FC +  I LEA+SP G+T +P++K 
Sbjct: 181 VEYLERLL--KECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKN 238

Query: 231 EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYA 290
           E + ++A+K       ++I++H ++G V +P+SV P+ I  N +   LS ED   L+ + 
Sbjct: 239 ELVQKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG 298

Query: 291 KKHGERRV 298
            ++ +R V
Sbjct: 299 VENPKRLV 306

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  201 bits (510), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 185/310 (59%), Gaps = 18/310 (5%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  ++ +  KLN G  IP +G GT+   E   E   A   A+KAGYRHIDTA +Y++E 
Sbjct: 2   LHPKSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEP 61

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI++      + R++LFVTTK+W     N  ++L++SL+ LGLDYVDL L HWP+ 
Sbjct: 62  YVGEAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLC 121

Query: 116 L-KTDLIKDG--NLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVSN 168
             + +  K+G   L+  PE ++G   ++ E  +F++T+  ++++   P + + RAIGVSN
Sbjct: 122 FPRVEDEKNGVNGLVAYPEDDEGKPLLN-EKGDFLETYRQIEKIYLNPDDHRVRAIGVSN 180

Query: 169 FSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPIL 228
           ++I  L+ L   K  KV P  NQ+EIHP LPQ EL  FC   GI+L AYSPLGS  AP L
Sbjct: 181 YAIEYLEALF--KECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNL 238

Query: 229 KEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSN 288
           K   + ++A+K  ++   ++IS+H ++G  V+P+S+ P RI    E    + E+   L N
Sbjct: 239 KIPLVHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDN 298

Query: 289 YAKKHGERRV 298
              +   R V
Sbjct: 299 VGIEEPARFV 308

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  200 bits (508), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 181/314 (57%), Gaps = 21/314 (6%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  T+ +   LN G  IP +GLGT    E   E   A   A+KAGYRHIDTA  Y+ E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEP 75

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI++      I R +LF+TTK+W         +L++SLK LGLDYVDL L HWP+ 
Sbjct: 76  FVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLC 135

Query: 116 LKTDLIKD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE----KARAIGVS 167
            +   +KD      L++ P  +D  + V   + ++++T++ ++++  +    + RAIGVS
Sbjct: 136 FEK--VKDPKGISGLVKTP-VDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVS 192

Query: 168 NFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPI 227
           NFSI  L+ L+  K  KV P  NQ+E HP LPQ EL  FC    I+L AYSPLGS  AP 
Sbjct: 193 NFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPN 250

Query: 228 LKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLS 287
           LK   + ++ +K  V    L+IS+H ++G +V+P+S+ P RI  N E   L+ ++   L+
Sbjct: 251 LKIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN 310

Query: 288 NYAKKHGERRVVSP 301
            + +K+  R +  P
Sbjct: 311 EFGEKYPVRFIDEP 324

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  198 bits (504), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 172/291 (59%), Gaps = 11/291 (3%)

Query: 11  LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD- 67
             LNTGA IP +GLGT    E   +  +A   A+K GYR IDTA +Y +E  IG A+++ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 68  ---SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDG 124
                + R +LF+TTK+W   +    ++L +SLK+L LDYVDL L HWP+       + G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 125 NLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE---KARAIGVSNFSINNLKELLNSK 181
            L   P        V  E  +++ TW+ ++++ K+   + R IGVSN+ +  L+ LL  K
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLL--K 188

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             +VVP  NQ+E+HPLLPQ+EL  +C   GI++E++SPLGS+  P L+   + E++KK  
Sbjct: 189 ETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKK 292
              G +++++H ++G VV+P+S+   RI  N +   LS+ED   LS   ++
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGRE 299

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  198 bits (504), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 181/301 (60%), Gaps = 16/301 (5%)

Query: 11  LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD- 67
            KLN G ++P +GLGT    E+  E   A   A+KAGYRHIDTA  Y  E  IG A+++ 
Sbjct: 11  FKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKEL 70

Query: 68  ---SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVAL-KTDLIKD 123
               ++ R++LF+T+K+W     +   +L++SLK LGLDYVDLYL HWP+   K +  KD
Sbjct: 71  LENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQKIEDSKD 130

Query: 124 G--NLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVSNFSINNLKEL 177
           G   L   P  +DG+  + +E  +++ T++ M+++   PK+ + RAIGVSN+ +  L  L
Sbjct: 131 GVNGLKGKPIDKDGNALI-VEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLDRL 189

Query: 178 LNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIA 237
           L  K   V PA NQ+E+HP LPQ EL  FC+   I L AYSPLGS+ AP+LK   + E++
Sbjct: 190 L--KVCTVKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPLVKELS 247

Query: 238 KKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERR 297
           +K  V    ++IS+H ++G  V+P+S+ P R+ G      L++ +   L +  +K   R 
Sbjct: 248 EKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGRKDSIRY 307

Query: 298 V 298
           +
Sbjct: 308 I 308

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  198 bits (503), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 171/301 (56%), Gaps = 17/301 (5%)

Query: 11  LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD- 67
             LN G  IP +GLGT    +   +   A   A+KAG+R IDTA  Y  EE IG A+++ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 68  ---SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVAL--KTDLIK 122
                + R +LF+TTK+W        ++L++SLKRL LDYVDL L HWP     K D   
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPEG 130

Query: 123 DGNLLQIPEREDGSRDVDLE-DWNFVKTWELMQEL----PKEKARAIGVSNFSINNLKEL 177
            G L+  P+ EDGS   D   DW  ++T++ ++ +       + RAIGVSN+ I  L+ L
Sbjct: 131 SGQLVNHPQHEDGSPFYDTAGDW--LETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERL 188

Query: 178 LNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIA 237
              K  K VPA NQ+E+HP LPQ EL ++C + GI++ +YSPLGS  AP L+   + E+A
Sbjct: 189 F--KECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELA 246

Query: 238 KKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERR 297
            K   N   +++S+H ++G +V+P+S+  ERI        L+ E+   L+ Y  +H  R 
Sbjct: 247 SKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVEHEYRY 306

Query: 298 V 298
           +
Sbjct: 307 I 307

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  198 bits (503), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 181/315 (57%), Gaps = 21/315 (6%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  T+ +   LN G  IP +GLGT    E   E   A   A+KAGYRHIDTA  Y+ E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI++      I R +LF+TTK+W         +L++SLK LGLDYVDL L HWP+ 
Sbjct: 76  FVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPIC 135

Query: 116 LKTDLIKD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE----KARAIGVS 167
                +KD       +++P  +D  + V   + ++++T++ ++++  +    + RAIGVS
Sbjct: 136 FGK--VKDPEGISGYMKLP-VDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVS 192

Query: 168 NFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPI 227
           NFSI  L+ L+  K  KV P  NQ+E HP LPQ EL  FC    I+L AYSPLGS  AP 
Sbjct: 193 NFSIEYLERLI--KECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPN 250

Query: 228 LKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLS 287
           LK   + ++ +K  V    L+IS+H ++G +V+P+S+ P RI  N E   L+ ++   L+
Sbjct: 251 LKIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN 310

Query: 288 NYAKKHGERRVVSPN 302
            + +K+  R +  P+
Sbjct: 311 EFGEKYPVRFMDVPS 325

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  194 bits (493), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 118/314 (37%), Positives = 184/314 (58%), Gaps = 21/314 (6%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  T+ +   LN G  IP +GLGT    E   E   A   A+KAGYRHIDTA  Y+ E 
Sbjct: 16  LHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 60  EIGRAIR----DSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI+    D +I R +LF+TTK+W         +L++SLK LGLDYVDL+L HWP+ 
Sbjct: 76  FVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLC 135

Query: 116 LKTDLIKD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVS 167
            +   +KD      L++ P  +D  + +   + ++++T++ ++++   P + + RAIGVS
Sbjct: 136 FEK--VKDPKGLSGLVKTP-VDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVS 192

Query: 168 NFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPI 227
           NFSI  L+ L+  K  +V P  NQ+E HP LPQ  +  FC    I+L AYSPLGS  AP 
Sbjct: 193 NFSIEYLERLI--KECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 228 LKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLS 287
           LK   + ++ +K  +    ++IS+H ++G +V+P+S+ P RI  + E   L+ ++   L+
Sbjct: 251 LKIPLVKKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELN 310

Query: 288 NYAKKHGERRVVSP 301
           ++ +K+  R +  P
Sbjct: 311 DFGEKYPVRFIDEP 324

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  193 bits (490), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 182/315 (57%), Gaps = 23/315 (7%)

Query: 4   LHKNTSTL--KLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  T+ +   LN G  +P +GLGT    E   E   A   A+KAGYRHIDTA  Y+ E 
Sbjct: 16  LHPKTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI++     +I R +LF+TTK+W         +L +SLK +GLDYVDL+L HWP+ 
Sbjct: 76  FVGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLC 135

Query: 116 LKTDLIKD----GNLLQIPEREDGSRDVDLE-DWNFVKTWELMQEL---PKE-KARAIGV 166
            +   +KD      L++ P  + G   +    DW  ++T++ ++++   P + + RAIGV
Sbjct: 136 FEK--VKDPKGISGLVKTPVHKSGEAMLASNGDW--METYKQLEKIYLDPNDHRVRAIGV 191

Query: 167 SNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAP 226
           SNFSI  L+ L+  K  +V P  NQ+E HP LPQ EL  FC    I+L AYSPLGS  AP
Sbjct: 192 SNFSIEYLERLV--KECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAP 249

Query: 227 ILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATL 286
            LK   + ++ +K  V    ++IS+H ++G +V+P+S+ P RI  + E   L+ ++   L
Sbjct: 250 NLKIPLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQEL 309

Query: 287 SNYAKKHGERRVVSP 301
           +++ +K+  R +  P
Sbjct: 310 NDFGEKYPVRFIDEP 324

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  187 bits (474), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 112/302 (37%), Positives = 175/302 (57%), Gaps = 19/302 (6%)

Query: 11  LKLNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD- 67
              N G  +P  GLGT    E   E   A   A+KAGYRHIDTA  Y  EE +G A+++ 
Sbjct: 11  FTFNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQEL 70

Query: 68  ---SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDG 124
                + R +L +T+K+W T   +  ++L++SL RL +DYVDL+L HWP  L T  + D 
Sbjct: 71  FEERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDP 128

Query: 125 N----LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK----ARAIGVSNFSINNLKE 176
           +    + + P  + G+   D E  ++++T++ ++++  +K     RAIGVSNF I  LK 
Sbjct: 129 HGVDKIAKEPVDDQGNPLYD-EKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKR 187

Query: 177 LLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEI 236
           +L  K  + VPA NQ+E+HP LPQ EL  FC E  I++ AYSPLG   AP+L+   +  +
Sbjct: 188 VL--KECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGL 245

Query: 237 AKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGER 296
            +K   +   ++ S+H ++G +V+P+S+   RI  N E   LS+ED   L+ + +K+ +R
Sbjct: 246 CEKYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKR 305

Query: 297 RV 298
            +
Sbjct: 306 YI 307

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  186 bits (473), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 169/290 (58%), Gaps = 17/290 (5%)

Query: 4   LHKNTSTLK--LNTGAHIPVIGLGTWQSSEN--EGYNATLEALKAGYRHIDTAAIYKNEE 59
           LH  ++ +   LN G  +P IGLGT    E   E   A   A+KAGYR+IDTA  Y +E 
Sbjct: 2   LHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEP 61

Query: 60  EIGRAIRD----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            +G AI++      I R +LF+T+K+W     +   +L +SLK LG+DY+DL+L HWP+ 
Sbjct: 62  FVGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLC 121

Query: 116 L--KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL---PKE-KARAIGVSNF 169
              + D      L + PE+ DGS D + E  +++ T++ M+ +   PK+ + RAIGVSNF
Sbjct: 122 YNRREDPHGINGLARNPEKADGSPDFN-EKADWLDTYKQMERIYSNPKDNRVRAIGVSNF 180

Query: 170 SINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILK 229
            +  LK +L  K   V P  NQ+E+HP LPQ EL  FC +  I L AYSPLGS  AP++K
Sbjct: 181 PVEYLKRVL--KECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVK 238

Query: 230 EEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLS 279
              I E+++K   +   ++ S+H ++G  V+P+S+   RI  N E   LS
Sbjct: 239 HPLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  175 bits (444), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 170/311 (54%), Gaps = 28/311 (9%)

Query: 3   ALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG 62
           A+  N  T+KLN GA +P++GLG W+           EA+K GYR +D A  Y NE E+G
Sbjct: 25  AMVMNVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVG 84

Query: 63  ----RAIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVAL 116
               RAI +  + R ELFV +KLW   HR  +  +AL ++L  LGLDY+DL+ +H+P+A 
Sbjct: 85  QGIRRAIDEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAF 144

Query: 117 KTDLIKD---GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSIN 172
           K   +++     L      E   R +  E    ++T+  +++L  E + RAIG+SNF   
Sbjct: 145 KFVPLEERYPAGLYTGAADEQAGR-LAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGC 203

Query: 173 NLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTD-------- 224
            +++LL  +G ++ PAA QIE HP L Q+ L+ + K +G+ +  YS LG           
Sbjct: 204 LVQDLL--RGCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTA 261

Query: 225 ----APILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFK 277
               AP+L+ E +  IA+++     ++++ W  QR   V+PKS + ER+  N    E   
Sbjct: 262 AQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALT 321

Query: 278 LSDEDFATLSN 288
           L+D++   LS+
Sbjct: 322 LADDELRELSS 332

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  173 bits (439), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 170/310 (54%), Gaps = 14/310 (4%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYN--ATLEALKAGYRHIDTAAIYKNEEEIGRAIRD 67
           +  LN G  +P +GLGT       G    A   A+KAGYRHIDTA  Y +E  +G AI++
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 68  ----SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVAL--KTDLI 121
                 I R ++F+T+K+W     +   +L++SL+ LG+DY+DL+L HWP+    + D  
Sbjct: 73  LMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVKQEDTH 132

Query: 122 KDGNLLQIPEREDGSRDVDLE-DW--NFVKTWELMQELPKEKARAIGVSNFSINNLKELL 178
               L + PE  +G    +++ DW   +V+  ++  +    + R+IGVSNF +  L+  L
Sbjct: 133 GINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLERTL 192

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
                K  PA NQ+E+HP LPQ EL  FC+   I+LEAYSPLGS +AP +  + + ++A+
Sbjct: 193 FECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQDLAE 250

Query: 239 KNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRV 298
           K  ++   ++ S+H ++G  V+ +SV   RI  N E   L++E+   L         +R 
Sbjct: 251 KYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITK-PKRF 309

Query: 299 VSPNWGPFKP 308
           V+  W    P
Sbjct: 310 VNEKWNAVVP 319

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  170 bits (430), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/279 (36%), Positives = 155/279 (55%), Gaps = 38/279 (13%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD-- 67
           + KL++G  IP +GLGT++   N+      +AL+ GYRH DTA +Y NE E+G+ I+   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 68  ----SNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDL 120
               +   R ++F TTKLW +QH      +A+D  L+ +  L Y+DL L+H P+      
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL------ 121

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLN 179
                         G + + LE      T+E MQE +   K R+IGVSN+   +++ELLN
Sbjct: 122 --------------GGKKLRLE------TYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
            +  K  P  NQIEI P   + EL +FCK+KGI++EAY+PL  T    LK+ ++ ++A +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKL 278
            G + GQ +I W  Q+GY+ LPK+    R+  N + F  
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  169 bits (428), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 170/311 (54%), Gaps = 32/311 (10%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           + T+KLN G  +P++GLG W+       +   EA+K GYR  D A  Y NE+E+G+ IR 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 67  ---DSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R +LFV +KLW + H  +N  +AL ++L+ LGL+Y+DL+ +H+P+A K    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 122 KDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLK 175
           ++      P    G+ D     + LE    + T+  +++   E   +AIGVSNF    L 
Sbjct: 125 EER---YPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLH 181

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STD 224
           +LL   G K+ PA  QIE HP L Q++L+ +CK++GI + AYS  G           +  
Sbjct: 182 DLL--AGAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKS 239

Query: 225 APILKEEEIT-EIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSD 280
            P L E ++  ++A  +GV+  ++++ W  QR   ++PKS K ER+  N    E   LSD
Sbjct: 240 TPTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSD 299

Query: 281 EDFATLSNYAK 291
           E+   +S+  K
Sbjct: 300 EELQEISSLNK 310

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  167 bits (423), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 162/287 (56%), Gaps = 40/287 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           KL++G  +P IGLGT+     E      +ALK+GYRH+DTA +Y NE E+G+ I+     
Sbjct: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDLIK 122
              +  R ++F TTKLW +Q  + N   A+ + ++++  L Y+DL L+H P++       
Sbjct: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLS------- 130

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSK 181
                       G+R         ++T++ MQE   E   R+IGVSN+  +++ ELL  K
Sbjct: 131 ------------GTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWK 171

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P + + +L ++CK KG+V+EA+SPL  T    LK  ++  +AK+ G
Sbjct: 172 ELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETG 229

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATL 286
            +AG+++I W  Q GYV LPKS   ER+ GN +   F+LS E  + L
Sbjct: 230 TDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFL 276

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  168 bits (425), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 167/309 (54%), Gaps = 26/309 (8%)

Query: 7   NTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG---- 62
           +T T  LN G  +PV+GLG W+ S +       EA+K GYR  D A  Y NE+EIG    
Sbjct: 3   DTRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIK 62

Query: 63  RAIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +AI +  + R +LF+ +KLW   H   +   AL ++L  LGLDYVDLY +H+P+ +K   
Sbjct: 63  QAINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVP 122

Query: 121 IKDGNLLQIPEREDGSRD--VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKEL 177
           +++    ++   E+  R+  V  +    + T+  M++L  E   +++G+SNF    +++L
Sbjct: 123 LEEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDL 182

Query: 178 LNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTD------------A 225
           L  +G ++ P A Q+E+HP L Q+ L+ + + K I + AYS  G                
Sbjct: 183 L--RGARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVT 240

Query: 226 PILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSDED 282
           P+L+ E +  IAKK+ V   Q+++ W  QRG  V+PKS K ER+  N    +   LSD +
Sbjct: 241 PLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSE 300

Query: 283 FATLSNYAK 291
            + + +  K
Sbjct: 301 MSDIFSLNK 309

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  166 bits (420), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 153/277 (55%), Gaps = 38/277 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI------ 65
           KL++G  +P IGLGT+    N       EALK GYRH+DTA +Y NE E+G  I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 66  RDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
             S+  R ++F  TKLW +Q  + N   A+ +  +++ GL Y+DL L+H P++       
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLS------- 123

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLNSK 181
                       GSR         ++T++ MQE + K   R+IGVSN+ ++++ ELLN  
Sbjct: 124 ------------GSR-------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P L + EL ++CK +G+++EAY+PL  T    +    +  +AK+ G
Sbjct: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKL 278
            N+GQ++I W  Q GYV LPK+   +R+  N + + +
Sbjct: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 152/289 (52%), Gaps = 40/289 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           KL+ G  IP +GLGT+    N   N   EALKAGYRH DTA +Y NEEE+G+ I      
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
              N  R  +F TTKLW +Q  +   T+A+   L ++  L+Y+DL L+H P+        
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL-------- 121

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLNSK 181
                       G   + LE      TW+ MQE +     ++IGVSN+ ++++ ELL  +
Sbjct: 122 ------------GGTKLRLE------TWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQ 163

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P L + EL ++CK   I +E YSPL  T    L ++++ ++A + G
Sbjct: 164 YLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETG 221

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
            N GQ++I W  Q GY+ LPK+    R+  N +   F L+ +    L +
Sbjct: 222 KNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFNLTSDQMTILDH 270

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 169/314 (53%), Gaps = 35/314 (11%)

Query: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60
           M+AL K   T+ LN G  +P+IGLG W+   +   +   EA+K GYR  D A  Y NE+E
Sbjct: 1   MSALSK---TVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKE 57

Query: 61  IG----RAIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPV 114
           +G    +AI +  + R +LFV +KLW + H   N   AL ++L  +GLDY+DL+ +H+P+
Sbjct: 58  VGQGIKKAIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPL 117

Query: 115 ALKTDLIKDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSN 168
           A K    ++      P    G+ D     +  ED   + T+  +++   E   ++IG+SN
Sbjct: 118 AFKFVPFEEK---YPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISN 174

Query: 169 FSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG------- 221
           F+ + +++LL  +G ++ P A QIE HP L Q+ L+ +CK  GI + AYS  G       
Sbjct: 175 FNGSLVQDLL--RGARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIEL 232

Query: 222 -----STDAPILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---Q 273
                 T   + + + +  IA  + V+  Q+++ W  QRG  V+PKS K ER+  N    
Sbjct: 233 DSELAKTTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTIN 292

Query: 274 ETFKLSDEDFATLS 287
           ++  LSD++   +S
Sbjct: 293 DSLTLSDKELKAIS 306

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  161 bits (408), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 157/287 (54%), Gaps = 40/287 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           KL++G  +P +GLGT+     E      +ALKAGYRH+DTA +Y NE E+G  +      
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDLIK 122
              N  R+++F TTKLW +Q  + N   A+ + L ++  L Y+D+ L+H P++       
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLS------- 123

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLNSK 181
                       G+R         ++T++ MQE +     R+IGVSN+  +++ ELL  +
Sbjct: 124 ------------GTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWE 164

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P + + +L ++CK KG+V+EA+SPL  T    +K   +  +A++ G
Sbjct: 165 ELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEVG 222

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATL 286
            N GQ++I W  Q GYV LPKS   ER+ GN E   F+LS E    L
Sbjct: 223 RNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQITFL 269

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  161 bits (408), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 162/294 (55%), Gaps = 41/294 (13%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI-- 65
           ++T  L  G  IPV+ LG +++ + E  +    ALK+GYRH+D A +Y NE E+G  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 66  ---RDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119
                 N+ R+E+F TTK+ G  H      +++ +SL+ +  ++Y+DL L+H P+A    
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIA---- 121

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178
                      ER              + TW+ +QE   E K RAIGVSN+SI +L+EL 
Sbjct: 122 --------ATEER--------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
           N +G KV P  NQ E++P L + EL  +C++KG+VLEA+SPL  T      + ++ E+ K
Sbjct: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPL--TRGQKFSDPQLQELIK 217

Query: 239 KNGVNA--GQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
            +  N    Q++I W  Q G++ LPKS   +R   N +   F++SD+D   L++
Sbjct: 218 TSYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  160 bits (406), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 153/292 (52%), Gaps = 41/292 (14%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRA----- 64
           T KL++  +IP + LGT+    +E       AL  GYRH DTA +Y NEEE+ +      
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 65  IRDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLI 121
           IR     R+E+F TTKLW +Q  ++N   A+ + + ++  L Y+DL LMH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPIGGP---- 123

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNS 180
                 QI E                +TW  MQE   E   ++IGVSNF I +LKEL   
Sbjct: 124 ------QIRE----------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK- 239
            G K  P  NQIEI P L + EL +FCK +G+V+EAY+PL  T    +   ++ +I+ + 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPL--THGYKINHPDLIKISNEL 219

Query: 240 -NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
            N  N GQ++I W  Q GYV LPK+    R+  N +   F+L+++    L +
Sbjct: 220 NNTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  162 bits (409), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 168/309 (54%), Gaps = 34/309 (11%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           +  + LN G  +P++GLG W+       +   EA+K GYR  D A  Y NE+E+G+ IR 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 67  ---DSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R ELFV +KLW + H  +N   AL ++L  + LDY+DL+ +H+P+ALK    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 122 KDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLK 175
           K+      P    GS+D     +  E+   + T+  +++L  E   ++IG+SNFS + + 
Sbjct: 122 KEK---YPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIM 178

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG------------ST 223
           +LL  +G ++ P A QIE HP L Q+ L+++ K +G+ + AYS  G             T
Sbjct: 179 DLL--RGCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKT 236

Query: 224 DAPILKEEEITEIAKKNG--VNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKL 278
             P+ +  +I EIAK +G  ++  Q+++ W  Q    V+PKS K ER+H N    +   L
Sbjct: 237 TPPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTL 296

Query: 279 SDEDFATLS 287
           +D++   +S
Sbjct: 297 TDQELKEIS 305

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 154/289 (53%), Gaps = 40/289 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           KL+ G  IP I LGT++   ++      E +K GYRH DTA +Y NE+E+G  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
              N  R ++F TTKLW +Q  +R    A+ Q L  + GL+Y+DL L+H P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLNSK 181
           +G+ L++                  +TW  MQE +     ++IGVSN+   ++ ELLN  
Sbjct: 119 EGSKLRL------------------ETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             +  P  NQIEI P + + EL ++CK KG+++EA++PL       +   ++  + K+  
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEVD 218

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGN--QETFKLSDEDFATLSN 288
            N GQ++I W  Q GY+ LPK+   +R+ GN    +F+LSDE   TL +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  158 bits (399), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 158/288 (54%), Gaps = 40/288 (13%)

Query: 13  LNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD----- 67
           L+ G  IP + LGT+   ++   N   EALK GYRH DTA +Y NE ++G  I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 68  -SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIKD 123
             N  R ++F TTKLW +Q  ++   +A+ + L+++  L Y+DL L+H P++        
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLS-------- 120

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSKG 182
                      GSR         ++T++ MQE   E   ++IGVSN+  ++L+ELL+ +G
Sbjct: 121 -----------GSR-------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
            K  P  NQIEI P   + EL  +C+ +GIV+E Y+PL  T    LK+ ++ ++A++ G 
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVGK 220

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
           N GQ++I W  Q GY+ LPK+   +R+ GN +   FKL++       +
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEH 268

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  158 bits (400), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 165/309 (53%), Gaps = 34/309 (11%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           +  + LN G  +P++GLG W+   +       EA+K GYR  D A  Y NE+E+G    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           AI +  + R ELFV +KLW + H  ++   AL ++L  + LDY+DLY +H+P+A K    
Sbjct: 62  AISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPF 121

Query: 122 KDGNLLQIPE-----REDGSRDVDLED-WNFVKTWELMQELPKEK-ARAIGVSNFSINNL 174
           ++    + P      +ED  + +  E+    + T+  M++L  +   ++IG+SNF+   +
Sbjct: 122 EE----KYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALI 177

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------ST 223
           ++LL S   K+ P   QIE HP L Q  LI +CK   I + AYS  G           + 
Sbjct: 178 QDLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKAL 235

Query: 224 DAPILKEEE-ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLS 279
           DA +L E E I  IA  + V   Q+++ W  QRG  ++PKS K ER+  N    E   LS
Sbjct: 236 DAKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLS 295

Query: 280 DEDFATLSN 288
           +++ +T+S+
Sbjct: 296 EQELSTISD 304

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  158 bits (399), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 156/286 (54%), Gaps = 23/286 (8%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
            S + LN G  +P++GLG W+           +A+  GYR  D A  Y NE+E+G    R
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           AI+D  + R ELFV +KLW + H  +N   AL ++L  +GLDY+DL+ +H+P+ALK    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 122 KDGNL--LQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELL 178
           ++     L   E +  +  +  E    + T+  ++E  +E   ++IGVSNFS + + +LL
Sbjct: 122 EEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL 181

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG------------STDAP 226
             +G ++ PAA QIE+HP L Q+  + + + KGI + AYS  G                P
Sbjct: 182 --RGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPP 239

Query: 227 ILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN 272
           + + + + +IA K+ V+  Q+++ W  Q+   V+PKS K ER+  N
Sbjct: 240 LFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQN 285

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  158 bits (399), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 160/305 (52%), Gaps = 27/305 (8%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           +S + LN G  +P++GLG W+  +    N   EA+K GYR  D A  Y NE+E+G  IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 67  ---DSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R ++FV +KLW   H   +   AL ++L  +GLDY+DLY +H+P+A K    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 122 KDGNLLQIPEREDGSRDVDLEDWN--FVKTWELMQELPKEK-ARAIGVSNFSINNLKELL 178
           ++          D  +   + + +   + T+  ++E   E   ++IGVSNF  + +++LL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDAPI 227
             +G ++ P A QIE HP L Q+ L+ FCK   I + AYS  G           +   P 
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 228 LKEEEITEIAKKN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET---FKLSDED 282
           L E ++ +   +N  G    Q+++ W  QRG  V+PKS K ER+ GN E    F L++++
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 283 FATLS 287
              +S
Sbjct: 300 LKDIS 304

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 166/311 (53%), Gaps = 45/311 (14%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI-- 65
           ++T  L  G  IPV+G GT+++ + +  +    A K GYRH+DTA +Y+NE E   A+  
Sbjct: 6   STTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAVAK 65

Query: 66  ---RDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119
                  + R+++F TTK+ G  H      +++ +SL+    L+YVDL+L+H P A    
Sbjct: 66  FLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCA---- 121

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178
                                 E    + T++ +QE  K  K +AIGVS++SI +L+EL 
Sbjct: 122 ----------------------ETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELY 159

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
           + +G +V P  NQ E++P L + +L+ +CKE+ +V+EA+SP+  T +    +  + ++ K
Sbjct: 160 SWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKLLK 217

Query: 239 KN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSNYAKKHG 294
           ++  G    QL+I W  Q G+V LPKSV  +R   N     F++S ED  TL++     G
Sbjct: 218 ESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH----DG 273

Query: 295 ERRVVSPNWGP 305
           E  +  P + P
Sbjct: 274 EHFLAQPGFDP 284

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  156 bits (395), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 151/289 (52%), Gaps = 40/289 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI------ 65
           KL+ G  IP I LGT+    ++      E +K GYRH DTA +Y NE+E+G  I      
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 66  RDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
              N  R E+F TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSK 181
           +G+ L++                  +TW  MQE   E   ++IGVSN+   ++ ELLN  
Sbjct: 119 EGSKLRL------------------ETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWP 160

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P + + EL ++CK KG+V+EA++PL       +   ++ ++ K+  
Sbjct: 161 ELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGN--QETFKLSDEDFATLSN 288
            N GQ++I W  Q GY+ LPK+   +R+ GN     F+LSDE    L +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 163/309 (52%), Gaps = 34/309 (11%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           +S   LN G  +P++GLG W+           +A+K GYR  D A  Y NE+E+G    R
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           AI +  + R++LF+ +KLW T H   +   A+ ++L  LGLDY+DLY +H+P+A K   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 122 KDGNLLQIPE-----REDGSR-DVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNL 174
           ++    + P      +ED ++  + L+   ++ T+  M+ L +E   ++IGVSN     L
Sbjct: 122 EE----KYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLL 177

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGST----------- 223
           +++L   G K+ P   QIE HP L Q  L+++CK + I++ AYS  G             
Sbjct: 178 QDVL--MGCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKE 235

Query: 224 DAP-ILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLS 279
           D P +     I  IA K  V   ++++ W  Q G  V+PKS K ER+  N   + T  LS
Sbjct: 236 DTPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLS 295

Query: 280 DEDFATLSN 288
           +E+   +SN
Sbjct: 296 NEELVEISN 304

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  155 bits (391), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 154/290 (53%), Gaps = 39/290 (13%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI---- 65
           + KL +G +IP IGLGT+    +        AL+ GYRH+DTA +Y NE E+ +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 66  -RDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDLI 121
            R  ++ R ++F TTKLW +Q  +     A+ + ++ +G L Y+DL LMH P+  K   +
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQ--V 123

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNS 180
           + G                        TW+ MQE   +   R+IGVS++   +L++L   
Sbjct: 124 RRG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240
              K  PA NQIEI P + + +L ++CK KGIV+EAYSPL  T    L + ++ ++A++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEET 217

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETF--KLSDEDFATLSN 288
           G N GQ+++ W  Q GYV LPK+    R+  N + F  +LS E    L +
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVFDWELSPEHMKLLDH 267

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 159/306 (51%), Gaps = 27/306 (8%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           +S + LN G  +P++GLG W+       N   EA+K GYR  D A  Y NE+E+G  IR 
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 67  ---DSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R ++FVT+KLW   H   +   AL ++L  +GLDY+DLY +H+P+A K    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 122 KDGNL--LQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELL 178
           ++           +D    +       + T+  ++    E   ++IG+SNF  + +++LL
Sbjct: 122 EEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLL 181

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDAPI 227
             +G ++ P A QIE HP L Q+ L+++CK   I + AYS  G           +   P 
Sbjct: 182 --RGCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPT 239

Query: 228 LKEEEITEIAKKN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFK---LSDED 282
           L E ++ +   +N  G    Q+++ W  QRG  V+PKS K ER+ GN E  K   L+D++
Sbjct: 240 LFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQE 299

Query: 283 FATLSN 288
              +S+
Sbjct: 300 LKEISS 305

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (393), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 162/302 (53%), Gaps = 26/302 (8%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----RAI 65
           T+ LN G  +P++GLG W+   +   +   EA+K GYR  D A  Y NE+E+G    RAI
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 66  RDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
           ++  + R +L V +KLW + H   N   AL+++L  L LDYVD++ +H+P+A K     +
Sbjct: 67  KEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPFDE 126

Query: 124 GNL--LQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180
                    + ++    ++ E    + TW  +++L  + K +++G+SNFS   +++LL  
Sbjct: 127 KYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL-- 184

Query: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDAPILK 229
           +G ++ P A QIE HP L Q+ LI + K  GI + AYS  G           + + P L 
Sbjct: 185 RGARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPTLF 244

Query: 230 EEE-ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSDEDFAT 285
           E + I  IA K+ V   Q+++ W  Q G  ++PKS K ER+  N    +   L+D++   
Sbjct: 245 EHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDELKQ 304

Query: 286 LS 287
           +S
Sbjct: 305 IS 306

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 163/316 (51%), Gaps = 42/316 (13%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           + T+ LN G  +P++GLG W+ S +       EA+K GYR  D A  Y NE+++G    R
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           AI +  + R +LFV +KLW T H  ++   AL ++L  + L+Y+DLY +H+P+A K    
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFK---- 117

Query: 122 KDGNLLQIPER---------EDGSRDVDLED-WNFVKTWELMQELPKEK-ARAIGVSNFS 170
                +   ER         ED  + +  E+    + T+  M+EL  E   ++IG+SN++
Sbjct: 118 ----FVPFEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYA 173

Query: 171 INNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTD------ 224
              +++ L  +G ++ P   QIE HP L Q++L+ +CK  GI + AYS  G         
Sbjct: 174 GALVQDTL--RGCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQ 231

Query: 225 ------APILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QET 275
                  P+     I +IA+++ V   Q+++ W  QRG  V+PKS    R+ GN    + 
Sbjct: 232 KLAKHTPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQA 291

Query: 276 FKLSDEDFATLSNYAK 291
             L+ +D   +S+  K
Sbjct: 292 VTLTPKDLEEISSLNK 307

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  154 bits (390), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 147/277 (53%), Gaps = 48/277 (17%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE----IGRAIRD 67
           KLN G  +PVIG G +     E       AL+ GYRHIDTA +Y+N+++    + R + +
Sbjct: 14  KLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRFLEE 73

Query: 68  SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLD------YVDLYLMHWPVALKTDLI 121
           +  PR E++ TTKLW TQ     +A  ++L+ +  D      YVDL L+H P+       
Sbjct: 74  TGTPREEVWFTTKLWNTQQGR--DATPRALEEIAADVKEFIGYVDLLLLHSPLT------ 125

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKA------RAIGVSNFSINNLK 175
                       D  R ++        TW +++   +E A      RAIGVSNF + +L+
Sbjct: 126 ------------DAQRRLE--------TWAVLERAVQEPASSALEIRAIGVSNFGVRHLQ 165

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITE 235
           ELL     K  P  +Q+E+HP LP+ EL  F +E GI+ EAYSPL  T    L++ E+  
Sbjct: 166 ELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPELLA 221

Query: 236 IAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN 272
           +  K+G++ G++++ W   +G+ VL KS  P+RI  N
Sbjct: 222 LEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDN 258

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 157/290 (54%), Gaps = 29/290 (10%)

Query: 7   NTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG---- 62
            + T+KLN G  +P++GLG W+       +   EA+K GYR  D A  Y NE+E+G    
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 63  RAIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           +AI +  + R +LFV +KLW + H  +N  +AL ++L+ + L+Y+DL+ +H+P+A K   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 121 IKDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNL 174
            ++      P    G+ D     + LE    + T+  ++E  KE   ++IG+SNF    +
Sbjct: 124 FEEK---YPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILI 180

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------ST 223
            +LL   G  + P   QIE HP L Q++LI +C ++ I + AYS  G           + 
Sbjct: 181 HDLL--AGATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAK 238

Query: 224 DAPILKEEE-ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN 272
             P L E E I +IA  +GV++ Q+++ W  QR   ++PKS K ER+  N
Sbjct: 239 STPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDN 288

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 161/307 (52%), Gaps = 31/307 (10%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           +S + LN G  +P++GLG W+  +    N   EA+K GYR  D A  Y NE+E+G    R
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           AI +  + R ++FV +KLW   H   +   AL ++L  +GLDY+DLY +H+P+A K    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 122 KD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKE 176
           ++    G    + + + G   +       + T+  ++E   E   ++IG+SNF  + +++
Sbjct: 122 EEKYPPGFYTGVDDEKKGH--ITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 177 LLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDA 225
           LL  +G ++ P A QIE HP L Q+ L+ FC+   I + AYS  G           +   
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTT 237

Query: 226 PILKEEEITEIAKKN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET---FKLSD 280
           P L E ++ +    N  G    Q+++ W  QRG  V+PKS K ER+ GN E    F L++
Sbjct: 238 PTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 281 EDFATLS 287
           ++   +S
Sbjct: 298 QELKEIS 304

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (391), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/307 (32%), Positives = 160/307 (52%), Gaps = 31/307 (10%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           +S + LN G  +P++GLG W+  +N   N   EA+K GYR  D A  Y NE+E+G  IR 
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 67  ---DSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R ++FV +KLW   H   +   AL ++L  +GLDY+DLY +H+P+A K    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 122 KD----GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKE 176
           ++    G      + E G   +       + T+  +++   E   ++IG+SNF  + +++
Sbjct: 122 EEKYPPGFYTGTEDEEKGH--ITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQD 179

Query: 177 LLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDA 225
           LL  +G ++ P A QIE HP L Q+ L+ FCK   I + AYS  G           +   
Sbjct: 180 LL--RGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKAT 237

Query: 226 PILKEEEITEIAKKN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET---FKLSD 280
             L E ++ +   +N  G    Q+++ W  QRG  V+PKS K ER+ GN E    F L++
Sbjct: 238 QTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTE 297

Query: 281 EDFATLS 287
           ++   +S
Sbjct: 298 QELKKIS 304

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  154 bits (388), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 148/271 (54%), Gaps = 36/271 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR----D 67
           KLN G  IPVIG G ++  + +  +    ALK GYRHIDTA +YKN++E  + +R    +
Sbjct: 14  KLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKYLDE 73

Query: 68  SNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLD------YVDLYLMHWPVALKTDLI 121
           +   R  ++ TTKLW +Q     E  +++L+ +  D      YVDL L+H P       +
Sbjct: 74  TGEARENIWFTTKLWDSQFGR--EETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKRRL 131

Query: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKELLNSK 181
           +   +L+   +E GS+ +++                    ++IGVSNF +++L+ELL  K
Sbjct: 132 ETWAILEQAVQEPGSKALEI--------------------KSIGVSNFGVDHLEELL--K 169

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             KV P  +Q+E+HP LP+ EL  + KEK I  EAYSPL  T    L++ E+  +  K G
Sbjct: 170 VAKVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLALEAKTG 227

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGN 272
           +N   +++ W   +G+VVL KS  PERI  N
Sbjct: 228 INKAVILLRWSFLQGFVVLVKSSNPERIRQN 258

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  154 bits (389), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 159/288 (55%), Gaps = 31/288 (10%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           T+ + LN G  +P++GLG W+   +   +   EA+K GYR  D AA Y NE+E+G    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
           A+ +  + R++LF+ +KLW T H   +   AL ++L  LGLDY+DLY +H+P+A K    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 122 KDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLK 175
           ++      P    G+ D     + L++  ++ T+  M++L  E   ++IGVSN   + L+
Sbjct: 122 EEK---YPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQ 178

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STD 224
           ++L   G ++ PAA QIE HP L Q+ L+ FCK + I + +YS  G           + D
Sbjct: 179 DVL--MGCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAED 236

Query: 225 APILKEEE-ITEIAKKNG--VNAGQLVISWHAQRGYVVLPKSVKPERI 269
            P L +   I +IA  +G  V   ++++ W  QR   ++PKS + ER+
Sbjct: 237 TPALFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERL 284

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  151 bits (382), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 153/288 (53%), Gaps = 46/288 (15%)

Query: 16  GAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD------SN 69
           G  IP + LG +    ++  N   EALK GYRH DTA +Y NE+E+G  I        +N
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 70  IPRNELFVTTKLWGTQH------RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
             R ++F TTKLW +Q+      R  +E +++ +K LG  Y+DL L+H P          
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNK-VKELG--YIDLLLIHSP---------- 118

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSKG 182
              L  P R              ++T++ MQE   +   ++IGVSN+   +++EL     
Sbjct: 119 ---LSGPRRR-------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDK 162

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
            K  P ANQIEI P   +++L ++C+ KG+++EA+SPL  T    LKE  +  +AKK G 
Sbjct: 163 LKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKKLGR 220

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
           + GQ++I W  QRG + LPK+  P R+  N E   F+L+ ED   L +
Sbjct: 221 DTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELDH 268

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  152 bits (383), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/305 (32%), Positives = 160/305 (52%), Gaps = 34/305 (11%)

Query: 11  LKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----RAIR 66
           L LN G  +P +GLG W+   +   +   EA+KAGYR  D A  Y NE E+G    RA+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 67  DSNIPRNELFVTTKLWGTQHRNPTEA---LDQSLKRLGLDYVDLYLMHWPVALKTDLIKD 123
           D  + R +LFV +KLW   H +P      L ++LK LGLDY+DLY +H+P+A K   +++
Sbjct: 65  DGIVKRQDLFVVSKLWNNFH-HPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEE 123

Query: 124 GNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKEL 177
                 P+   G  D     +  E+   + T+  ++E  +E   ++IG+SNF+   + ++
Sbjct: 124 R---YPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADI 180

Query: 178 LNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG------------STDA 225
           L  +G  + P A QIE HP L Q++L+ +CK   + +  YS  G                
Sbjct: 181 L--RGCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTP 238

Query: 226 PILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSDED 282
           P+     I +IA+K+ V+  ++++ W  QRG  ++PKS   +R+  N    +   L++ED
Sbjct: 239 PLFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEED 298

Query: 283 FATLS 287
             ++S
Sbjct: 299 LKSIS 303

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  152 bits (383), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 163/308 (52%), Gaps = 26/308 (8%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR- 66
           +S + LN G  +P++GLG W+   +       +A+K GYR  D A  Y NE+E+G+ IR 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 67  ---DSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121
              +  + R ++FV +KLW + H   +   AL ++L  +GLDY+DL+ +H+P+A K    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 122 KDGNLLQIPEREDGSRDVDLEDWN--FVKTWELMQELPKEK-ARAIGVSNFSINNLKELL 178
           ++         ++  ++  + + +   + T+  +++  +E   ++IG+SNFS + +++LL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYS------------PLGSTDAP 226
             +  K+ P A Q+E HP L Q+ L+ +CK+ GI + AYS            PL      
Sbjct: 182 --RQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 227 ILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSDEDF 283
           +   + I +IA  + V   Q+++ W  QRG  ++PKS K ER+  N    E   L+ ++ 
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 284 ATLSNYAK 291
             +S   K
Sbjct: 300 EAISKLNK 307

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  151 bits (382), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 164/308 (53%), Gaps = 27/308 (8%)

Query: 9   STLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----RA 64
           S + LN G  +P++GLG W+ S +       +A+K GYR  D A  Y NE E+G    +A
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 65  IRDSNIPRNELFVTTKLWGTQHR--NPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIK 122
           I +  + R++LFV +KLW + H   +   AL ++L+ LGLDY+DLY +H+P+A K    +
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFE 122

Query: 123 DGNLLQIPEREDGSRDVDLEDWN--FVKTWELMQELPKEK-ARAIGVSNFSINNLKELLN 179
           +          D +R+  L +     + T+  ++E       ++IG+SNF+   +++LLN
Sbjct: 123 EKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN 182

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG-----------STDAPIL 228
             G ++ P A QIE HP L Q++L+ +CK KGI + AYS  G           +   P L
Sbjct: 183 --GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSL 240

Query: 229 KEEEITE--IAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKLSDEDF 283
            E  I +   A        ++++ W  QRG  V+PKS K ER+  N   +++  L++E+ 
Sbjct: 241 LEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEEL 300

Query: 284 ATLSNYAK 291
             +S+  K
Sbjct: 301 NEISSLNK 308

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  150 bits (379), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 150/289 (51%), Gaps = 40/289 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           K + G  +P I LGT+    ++      E +K GYRH DTA +Y NE+E+G  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
              N  R ++F TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSK 181
           +G+ L++                  +TW+ MQE   E   ++IGVSN+   ++ ELLN  
Sbjct: 119 EGSKLRL------------------ETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P + + EL ++CK K +V+EA++PL       + + ++ ++ K+  
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEVD 218

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGN--QETFKLSDEDFATLSN 288
            N GQ++I W  Q GY+ LPK+   +R+  N     F+LSD+    L +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 173/314 (55%), Gaps = 49/314 (15%)

Query: 9   STLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE----IGRA 64
           +T  L  G  +P +GLG +Q+ + E  N    ALK GYR +D+A +Y NE E    I + 
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 65  IRDS-NIPRNELFVTTKLWGTQ---HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119
           + +S  + R+++F TTK+  TQ   + +  +++++SL R+  LDY+DL+L+H P+  K  
Sbjct: 67  LEESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK-- 123

Query: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178
                      E+  G             TW+  QE  +  K +AIGVSN+ I +L+E+ 
Sbjct: 124 -----------EKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159

Query: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238
              G K+ P  NQ E++P L + EL N+C +KG+V++AYSPL  T A  L++ E+ ++ +
Sbjct: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE 217

Query: 239 KN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSNYAKKHG 294
            +     + Q++++W  Q G+V L K+V  +R+  N ++  F+LS  D   L+     H 
Sbjct: 218 DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT-----HD 272

Query: 295 ERRVVS-PNWGPFK 307
           ++  +S P W P K
Sbjct: 273 DQYYLSQPKWDPIK 286

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  147 bits (372), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 141/280 (50%), Gaps = 38/280 (13%)

Query: 10  TLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD-- 67
           T  L  G  +P +GLG +   +N       +ALK GYRH DTA  Y NE E+G  I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 68  ----SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDL 120
               S+  R ++F  TKLW +Q  +     A+ Q L+++  L Y+DL L+H P       
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPAC----- 119

Query: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQE-LPKEKARAIGVSNFSINNLKELLN 179
                         GS          + T+E MQE +     ++IGVSN+  ++L+EL  
Sbjct: 120 --------------GSA-------KRLATYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239
               K  P  NQIE+ P LP+++L+++CK  G+ ++AYSPLG  D   + +  I  +A +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQ 216

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLS 279
                 Q++I+W   +GY  LPK+   +R+  N +++ +S
Sbjct: 217 KNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS 256

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 146/275 (53%), Gaps = 38/275 (13%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD---- 67
           +L  G  IP + LGT+    +       EALK GYRH DTA +Y NE E+G+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 68  --SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
             ++  R ++F TTKLW +Q  +     A+ + ++++ GL Y+D+ L+H P++       
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLS------- 124

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSK 181
                       G R         ++TW+ MQE   E   ++IGVSN+  ++++ELL   
Sbjct: 125 ------------GQR-------RRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
             K  P  NQIEI P + + EL ++CK   +V+EAY+P+       + +  + EI+K+ G
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAH--GYKMNDPGLREISKETG 223

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETF 276
           +N GQL+I W  Q GY+ LPK+    R+  N + +
Sbjct: 224 MNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  146 bits (369), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 150/289 (51%), Gaps = 42/289 (14%)

Query: 13  LNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAI------- 65
           L+ G  IP I LGT+    ++      E +K GYRH DTA +Y NE+E+G  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 66  RDSNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIK 122
            +SN  R ++F TTKLW +Q  ++    A+ Q L  + GL Y+DL L+H P+        
Sbjct: 68  PESN-KREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 123 DGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKA-RAIGVSNFSINNLKELLNSK 181
           +G+ L++                  +TW+ MQE   E   ++IGVSN+   ++ ELL   
Sbjct: 119 EGSKLRL------------------ETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWP 160

Query: 182 GNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNG 241
                P  NQIEI P + + EL ++CK KG+++EA++PL       +   ++ ++ K+  
Sbjct: 161 DLTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 242 VNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
            N GQ++I W  Q GY+ LPK+   +R+ GN     F+L D+    L +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYDFELLDKQMKILDH 267

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  146 bits (369), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 157/309 (50%), Gaps = 35/309 (11%)

Query: 8   TSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIG----R 63
           ++ + LN G  +P++GLG W+   +       +A+K GYR  D A  Y NE+E+G    R
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 64  AIRDSNIPRNELFVTTKLWGTQHRNPTEA---LDQSLKRLGLDYVDLYLMHWPVALKTDL 120
           AI +  + R +LF+ +KLW   H +P      L ++LK LGLDYVDLY +H+P+A K   
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFH-HPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFK--- 117

Query: 121 IKDGNLLQIPEREDGSRD-----VDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNL 174
               +    P    G  D     +  E+   + T+  M++L  E   ++IG+SN++   +
Sbjct: 118 FVSPDERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLV 177

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLG------------S 222
            + L  +G ++ P A QIE HP L Q++L+ +CK   + + AYS  G             
Sbjct: 178 ADTL--RGCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAK 235

Query: 223 TDAPILKEEEITEIAKK-NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGN---QETFKL 278
              P+     I +IA K   V   Q+++ W  QRG  ++PKS K ER+  N    +   L
Sbjct: 236 NTPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTL 295

Query: 279 SDEDFATLS 287
           ++ED   +S
Sbjct: 296 AEEDLREIS 304

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  145 bits (365), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 152/295 (51%), Gaps = 52/295 (17%)

Query: 11  LKLNTGAHIP---VIGLGT-WQSSENEGYNAT---LEALKA-----GYRHIDTAAIYKNE 58
             LN G  IP   VIG GT W  +E      +   ++ LK      G  HID A IY+  
Sbjct: 8   FTLNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTY 67

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            E+  A+R+SN PR+E+F+T K + TQ +   +P   L+ SLK LGLDYVDLYL+H P  
Sbjct: 68  PEVAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSP-- 124

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNL 174
                IK+G+ L+                   + W+ M++L K  KA+ IGVSNF + +L
Sbjct: 125 ----FIKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDL 161

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGS----TDAPIL 228
           +++L  K   + P  NQIE +  L      ++ FCKE  I LEAY+PLG      D P  
Sbjct: 162 EKIL--KIATIKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEA 219

Query: 229 KE--EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDE 281
           K   + I E++KK      Q+++ W  +RG + +  S KP+R+H  Q  F    E
Sbjct: 220 KPFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLE 274

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  144 bits (363), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 154/291 (52%), Gaps = 45/291 (15%)

Query: 12  KLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD--SN 69
           +L+ G  IP +GLG +Q SE    +   EAL+ GYR  D+A  Y NE+ + R I     +
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 70  IP---RNELFVTTKLWGTQH--RNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTDLIKD 123
            P   R +++ TTK+    H      ++L++SL   G L Y+DL L+H P++ +T     
Sbjct: 74  APGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRT----- 128

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKG 182
                   R  G             TW+ ++E   E + R+IGVSN+   +L ELL  +G
Sbjct: 129 --------RRLG-------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEG 167

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPL---GSTDAPILKEEEITEIAKK 239
            K+ P  NQ+EI+P L + EL+ +C+E  I ++A+SPL      D PIL+     ++A +
Sbjct: 168 LKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMRGKRLDDPILQ-----KVAHQ 222

Query: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
                 Q+++ W  Q G++VLPK+ K ER+  N +   F+LS E  + L++
Sbjct: 223 YDKGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDFELSAETMSELTH 273

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  143 bits (361), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 147/288 (51%), Gaps = 40/288 (13%)

Query: 13  LNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRD----- 67
            N G  IP I LGT+   ++       EALKAGYRH DTA +Y NE ++G  I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 68  -SNIPRNELFVTTKLWGTQ--HRNPTEALDQSLKRL-GLDYVDLYLMHWPVALKTDLIKD 123
                R+++F TTKLW +Q  +     A+ + L ++ GL Y+D+ L+H P+  +T  +  
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL-- 127

Query: 124 GNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLKELLNSKG 182
                                   +TW  MQE  +    + IGVSN+   +++ELL  + 
Sbjct: 128 ------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 183 NKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKNGV 242
             + P  NQIEI P + + EL ++CK  G+V+EA++PL  T    L + ++  ++K+ G 
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221

Query: 243 NAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSN 288
           +  Q++I W  Q GY+ LPK+   +R+  N E   F+L+ E    + +
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  144 bits (362), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 163/317 (51%), Gaps = 62/317 (19%)

Query: 13  LNTGAHIP---VIGLGT-WQSSEN----------EGYNATLEALKAGYRHIDTAAIYKNE 58
           L+ G  IP   ++G GT W  SE           +    TL+ +  G  HID A IY+  
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTV-PGVVHIDAAEIYRTY 67

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVAL 116
            E+G A++D+  PR+E+F+T K    +    NP  AL+ SLK+LG+DYVDLYL+H P+  
Sbjct: 68  PELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPIIK 127

Query: 117 KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLK 175
           ++ L  + N                        W+ ++EL K  KA+ IGVSNF++ +L+
Sbjct: 128 ESKLDVEAN------------------------WKYLEELYKSGKAKNIGVSNFAVKDLE 163

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKEEE- 232
           +LL     +V P  NQIE  P L      ++ F ++ GI+LEAYSPLG    P+ +  E 
Sbjct: 164 KLLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLG----PLQRRPED 217

Query: 233 ---------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDE 281
                    I E++KK   +  Q+++SW  +RG + +  S K ERI   Q+  +F L++E
Sbjct: 218 ADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANE 277

Query: 282 DFATLSNYAKKHGERRV 298
           +   ++    +H   R+
Sbjct: 278 EVQKITQLGLQHPALRL 294

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  140 bits (353), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 104/318 (32%), Positives = 158/318 (49%), Gaps = 51/318 (16%)

Query: 7   NTSTLKLNTGAHIP---VIGLGT-WQSSE-------NEGYNATLEALK-AGYRHIDTAAI 54
           N   + LN G  IP   +IG GT W   E       N      + ALK  G  HID A I
Sbjct: 4   NQQFITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEI 63

Query: 55  YKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMH 111
           Y+   E+G+A+  +  PRNE+F+T K + TQ +   +P   LD +LK++G DYVDLYL+H
Sbjct: 64  YRTYPEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLH 122

Query: 112 WPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFS 170
            P   K                      +   +   + W+ M++L +  KA+ IGVSNF+
Sbjct: 123 SPFVSK----------------------ETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFA 160

Query: 171 INNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPIL 228
           + +L+ +L  K  ++ P  NQIE  P L      +  FC+E  I+LEAYSPLG       
Sbjct: 161 MKDLERIL--KVAEIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTT 218

Query: 229 KEEE------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSD 280
           K+E       + E+++K   +  Q+ + W  +RG + +  S KP+RI   Q   +F L+D
Sbjct: 219 KDESLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTD 278

Query: 281 EDFATLSNYAKKHGERRV 298
           E+   ++    +H   R+
Sbjct: 279 EEVNQITELGLEHEPLRL 296

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  140 bits (352), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 165/323 (51%), Gaps = 58/323 (17%)

Query: 11  LKLNTGAHIP---VIGLGT-W---QSSENEGYNATLEALK-----AGYRHIDTAAIYKNE 58
             LN G  IP   +IG GT W     SE+   +  +E +K      G  HID A  Y   
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            E+ +A+++S+ PR+E+F+T K + TQ +   +P E L+  LK LGLDYVDLYL+H P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPFF 126

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNL 174
                         PE + GS  ++       K W+ M+ L KE KA++IGVSNFS+ N+
Sbjct: 127 -------------DPEFK-GSLTLE-------KVWKDMETLYKEGKAKSIGVSNFSVKNI 165

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKEEE 232
           +E+L   G K  P  NQIE +  L      ++N+C++  I LEAYSPLG    P+ K  E
Sbjct: 166 EEILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPE 219

Query: 233 ----------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSD 280
                     I E+A K G    Q++++W   RG + +  S K +RI   Q   +F L+ 
Sbjct: 220 NSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTK 279

Query: 281 EDFATLSNYAKKHGERRVVSPNW 303
           ++  TL+    +    R+   N+
Sbjct: 280 DEVDTLTKLGLEQPALRIYWTNF 302

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  139 bits (350), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 157/309 (50%), Gaps = 58/309 (18%)

Query: 15  TGAHIPVIGLGT---WQSSENEG----------YNATLEALKAGYRHIDTAAIYKNEEEI 61
           T  HIPV+G GT   W+ ++ EG           +  + A+  G+ HIDTA  Y   EE+
Sbjct: 14  THTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEEV 73

Query: 62  GRAIRDSNIPRNELFVTTKL----W-GTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVAL 116
           G A+R S +PR++LF+T K     W G     P +A  + L+ LG+ Y DLY++H P   
Sbjct: 74  GEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP--- 130

Query: 117 KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLK 175
             D+ K+            +  +DL++      W  ++EL +   A+AIGVSNF +  LK
Sbjct: 131 --DITKE------------NAGIDLQE-----AWRQVEELYEAGIAKAIGVSNFPLETLK 171

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILK---- 229
           ++      + +P  +Q+E HP L      ++ +C+ K IV+EAYSPL    AP+ +    
Sbjct: 172 QM--ESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARPG 225

Query: 230 --EEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFAT 285
             ++ +  + KK G +  Q+V+ W   RG V L  S K ERIH    T  F+L   D   
Sbjct: 226 PLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVEL 285

Query: 286 LSNY-AKKH 293
           ++   +KKH
Sbjct: 286 INEVGSKKH 294

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  138 bits (348), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 156/317 (49%), Gaps = 57/317 (17%)

Query: 11  LKLNTGAHIP---VIGLGT-WQ--SSENEGYNATL-EALK-----AGYRHIDTAAIYKNE 58
            KLN G  +P   ++G GT W   +  +E ++ TL + LK      G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPVAL 116
            E+GRA+ +++ PR+E+F+T K W       NP   L+  LKRLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 117 KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLK 175
              + K+ N   + E                  W +M+EL    KA+ IGVSNF+  +L+
Sbjct: 125 ---ISKETNGFSLEE-----------------AWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKE--- 230
            +L  K  KV P  NQIE +  L      + NFCK+  I L AYSPLG    P+ K+   
Sbjct: 165 RVL--KVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPAD 218

Query: 231 -------EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFK--LSDE 281
                    I ++A+      GQ+++ W  +RG V +  S K ERI   QE F+  L D+
Sbjct: 219 GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDD 278

Query: 282 DFATLSNYAKKHGERRV 298
           +   ++     H   R+
Sbjct: 279 EVTEITKLGLDHEPLRL 295

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 155/316 (49%), Gaps = 55/316 (17%)

Query: 11  LKLNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRHIDTAAIYKNE 58
             LN G  IP   VIG GT W  +E      + E +          G  HID A IY+  
Sbjct: 8   FTLNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTY 67

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            E+G+A+R++  PRNE+++T K + T  +   NP    +  LK LG+DY+DLYL+H P  
Sbjct: 68  PELGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF- 125

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNL 174
                        I E  +G        +   + W+ ++EL K  KA+ IGVSNF+  +L
Sbjct: 126 -------------ITEGRNG--------FTLEQAWKYLEELYKSGKAKNIGVSNFAKEDL 164

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLG--------STD 224
           + +L  K  ++ P  NQIE    L      + NF KE  I+LEAYSPLG        +  
Sbjct: 165 ERIL--KIAEIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADS 222

Query: 225 APILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDED 282
            P  K   I E+A+K G +  Q+++ W ++RG + +  S KP R+H  Q   TF L+  +
Sbjct: 223 LPFYK--YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTE 280

Query: 283 FATLSNYAKKHGERRV 298
              ++    KH   R+
Sbjct: 281 VEKITELGLKHEALRL 296

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  135 bits (341), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 166/325 (51%), Gaps = 57/325 (17%)

Query: 1   MAALHKNTSTLKLNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRH 48
           + A H+   TL  N G  IP   V+G GT W  +E    N + E ++         G  H
Sbjct: 19  IMAFHQEFFTL--NNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVH 76

Query: 49  IDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGT--QHRNPTEALDQSLKRLGLDYVD 106
           +D A  Y   +E+G+A+R+S  PR+E+F+T K   T   H    E  +  +K++G+DYVD
Sbjct: 77  LDAAECYNTYQELGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVD 136

Query: 107 LYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIG 165
           LYL+H P+              I + ++G   V LE+      W+ +++L +  KA+ IG
Sbjct: 137 LYLIHSPL--------------IEKEKNG---VTLEE-----VWKDLEKLYEAGKAKNIG 174

Query: 166 VSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGST 223
           VSNF + +L+ +L  K  KV P  NQIE H  L      ++ F ++  I LEAY+PLG  
Sbjct: 175 VSNFRVEDLQRIL--KVAKVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG-- 230

Query: 224 DAPILKEEE--------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE- 274
             P+ +++         + E+AKK G    Q+++ W  +R  + +  S KP+RI   Q+ 
Sbjct: 231 --PLQRKQSDAGDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDL 288

Query: 275 -TFKLSDEDFATLSNYAKKHGERRV 298
            +F L+DE+   ++    KH   R+
Sbjct: 289 FSFDLTDEEVKKITELGLKHKPLRL 313

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  135 bits (339), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 165/316 (52%), Gaps = 59/316 (18%)

Query: 13  LNTGAHIP---VIGLGT--WQSSENEGY--NATLEALK-----AGYRHIDTAAIYKNEEE 60
           LN G  IP   +IG GT  +++ E +    N+ +E +       G  HID A IY+   E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 61  IGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVALK 117
           +G+A+  +  PR+E+F+T K + TQ +   +P   L+ SLK++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPF--- 125

Query: 118 TDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKE 176
             + K+ N   + E                  W+ M++L K  KA+ IGVSNF++ +L++
Sbjct: 126 --VSKEANGFTLEE-----------------AWKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 177 LLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKE---- 230
           +L  K  +V P  NQIE  P L      +  FC++  I+LEAYSPL    AP+ K+    
Sbjct: 167 IL--KIAEVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPL----APLQKKTAQD 220

Query: 231 ------EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDED 282
                 E + E+++K   +  Q+++ W ++RG + +  S KP+RI   Q   +F L+DE+
Sbjct: 221 DSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEE 280

Query: 283 FATLSNYAKKHGERRV 298
              ++     H   R+
Sbjct: 281 VDEITELGLAHEPLRL 296

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 161/316 (50%), Gaps = 55/316 (17%)

Query: 11  LKLNTGAHIP---VIGLGT-WQSSENEGYNATLE---------ALK-AGYRHIDTAAIYK 56
             LN G  IP   +IG GT W   +NE  +AT           ALK  G  HID A IY+
Sbjct: 8   FTLNNGNKIPAIAIIGTGTRWY--KNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYR 65

Query: 57  NEEEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWP 113
              E+G+A+  +  PRN +F+T K +  Q +   +P + LD +LK++G DYVDLYL+H P
Sbjct: 66  TYPEVGKALSLTEKPRNAIFLTDK-YSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSP 124

Query: 114 VALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSIN 172
                 + K+ N L + E                  W+ M++L K  KA+ IGVSNF++ 
Sbjct: 125 F-----VSKEVNGLSLEE-----------------AWKDMEQLYKSGKAKNIGVSNFAVE 162

Query: 173 NLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKE 230
           +L+ +L  K  +V P  NQIE  P L      +  FC+E  I++EAYSPLG       ++
Sbjct: 163 DLQRIL--KVAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQD 220

Query: 231 ------EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDED 282
                 E + E+++K   +  Q+++ W  +RG + +  S KP+RI   Q   +F L+ E+
Sbjct: 221 DSQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEE 280

Query: 283 FATLSNYAKKHGERRV 298
              ++    +H   R+
Sbjct: 281 VDKITELGLEHEPLRL 296

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 160/314 (50%), Gaps = 53/314 (16%)

Query: 13  LNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRHIDTAAIYKNEEE 60
           LN G  +P   +IG GT W  +E      + E +          G  HID A +Y+   E
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 61  IGRAIRDS-NI-PRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVA 115
           +G+A+R+S N+ PR+E+F+T K + TQ +   NP   L   LK+LGLDYVDLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPFI 129

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNL 174
            K    K+G  ++                   + W+ M++L K  K + IGVSNFS+ +L
Sbjct: 130 SKE---KNGFTME-------------------EAWKYMEDLYKAGKVKNIGVSNFSMADL 167

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKEEE 232
           + +L  K  +V P  NQIE +  L      ++NFC+E  I + AY+PLG         E+
Sbjct: 168 QRIL--KSCEVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQ 225

Query: 233 ------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDEDFA 284
                 + ++A+K   +  Q+++ W ++RG + +  S K +RI   Q   TF L+D +  
Sbjct: 226 ENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVE 285

Query: 285 TLSNYAKKHGERRV 298
            ++    KH  +R+
Sbjct: 286 KITQLGLKHEPQRM 299

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  131 bits (329), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 156/312 (50%), Gaps = 58/312 (18%)

Query: 10  TLKLNTGAHIPVIGLGT---WQSSENEG----------YNATLEALKAGYRHIDTAAIYK 56
           TLK  +G  +P IG G+   W+ +++ G           +    A++ G+ HIDTA  YK
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 57  NEEEIGRAIRDSNIPRNELFVTTKL--WGTQHR---NPTEALDQSLKRLGLDYVDLYLMH 111
             +E+G  I ++ +PR  L++T K   W  + R    P E+L  SLK + LDYVDLY++H
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 112 WPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFS 170
                            +P     +  +DL++      W  M+E+   K AR IGVSNF 
Sbjct: 129 -----------------VPNITTKTAGIDLKE-----AWLQMEEIYTRKMARNIGVSNFD 166

Query: 171 INNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPIL 228
           + +L E + S   K  P  NQIE    + Q    ++ +C+E  IV+E YSPL     P+ 
Sbjct: 167 VESL-EYIKSFA-KYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLT 220

Query: 229 K------EEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHG--NQETFKLSD 280
           K      +E +  IA K G +  Q+++ W  Q G VV+  + K ER++   N   F+LS 
Sbjct: 221 KGKPGPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSK 280

Query: 281 EDFATLSNYAKK 292
           EDF  ++N  ++
Sbjct: 281 EDFDQITNVGRE 292

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  130 bits (327), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/322 (30%), Positives = 162/322 (50%), Gaps = 57/322 (17%)

Query: 14  NTGAHIPVIGLGT---WQSSENEG----------YNATLEALKAGYRHIDTAAIYKNEEE 60
            +G  +PVIG G+   W+ ++ EG           +    A+KAG+ HID A  YK   E
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 61  IGRAIRDSNIPRNELFVTTKL--WG---TQHRNPTEALDQSLKRLGLDYVDLYLMHWPVA 115
           +G  I +S +PR +L+VT K   W     + + P E+L+ SL ++ + YVDLYL+H P  
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPFI 131

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL-PKEKARAIGVSNFSINNL 174
                         PE    +  +DL++      W  M+E+  +  A+ IGVSNF + +L
Sbjct: 132 N-------------PE----TAGIDLKE-----AWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILK--- 229
            E + + G K  P  NQIE    + Q    +I++CK+ GI +E YSPL     P+ K   
Sbjct: 170 -EYIRTIG-KYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 230 ---EEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFA 284
              ++ +  +AKK G +  Q+++ W  Q G + +  S + +RI  + +   F+LS EDF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 285 TLSNYAKKHGERRVVSPNWGPF 306
           +++   K    R  ++  +G +
Sbjct: 284 SITEVGKTKIFRNFMTDLYGKY 305

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  130 bits (327), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/318 (31%), Positives = 155/318 (48%), Gaps = 58/318 (18%)

Query: 11  LKLNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRHIDTAAIYKNE 58
             LN G  IP   +IG GT W   + E    + E +          G  HID A +Y   
Sbjct: 8   FTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEMYNTY 67

Query: 59  EEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVA 115
            E+ +A++ ++  R+E+F+T K +    +   NP   L +SLK L LDYVDLYL+H P  
Sbjct: 68  PEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLHSPFI 127

Query: 116 LKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNL 174
            K                          +   + W+ M++L K+ KA+ IGVSNFS+++L
Sbjct: 128 TKESC----------------------GYTMEEAWKQMEKLYKDGKAKNIGVSNFSVDDL 165

Query: 175 KELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKE-- 230
           K +L  K  ++ P  NQIE +  L      ++ FC++  I++EAYSPLG    P+ K+  
Sbjct: 166 KRIL--KICEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG----PLRKKPT 219

Query: 231 --------EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSD 280
                   + I E+AKK G + GQ+++ W  +R  + +  S K ERI   Q+  +F L+ 
Sbjct: 220 DRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTS 279

Query: 281 EDFATLSNYAKKHGERRV 298
           E+   ++     H   R+
Sbjct: 280 EEVEKITKLGLAHEPSRL 297

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/317 (30%), Positives = 153/317 (48%), Gaps = 49/317 (15%)

Query: 7   NTSTLKLNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRHIDTAAI 54
           N + + LN G  +P   +IG GT W   + + +  + E ++         G  HID A +
Sbjct: 4   NQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEM 63

Query: 55  YKNEEEIGRAIRDSNIPRNELFVTTK--LWGTQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
           Y    E+  A+R +  PR+E+F+T K  L     ++P   L+ SLK   LDYVDLYL+H 
Sbjct: 64  YGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYLLHS 123

Query: 113 PVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSI 171
           P   K    K G  L+                     W  M++L K+ KA+ IGVSNFS+
Sbjct: 124 PFVAKE---KPGLTLE-------------------GAWRQMEQLYKDGKAKNIGVSNFSV 161

Query: 172 NNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILK 229
            +LK +L+    ++ P  NQIE HP L      ++ FC+++ I LEA++PLG       +
Sbjct: 162 EDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQE 219

Query: 230 EEE------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFK--LSDE 281
           +E       I+ ++ K      Q+++ W  +RG + +  S + +RI   Q  F+  L DE
Sbjct: 220 DENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDE 279

Query: 282 DFATLSNYAKKHGERRV 298
           +   ++    +H   R 
Sbjct: 280 EVTKITRLGLQHPPVRC 296

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  128 bits (322), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 160/315 (50%), Gaps = 53/315 (16%)

Query: 8   TSTLKLNTGAHIP---VIGLGT--WQSSENEGYNATL-----EALK-AGYRHIDTAAIYK 56
           TS + LN G  IP   +IG GT  ++ +  + Y+  L      AL+  G  HID A +Y+
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 57  NEEEIGRAIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWPV 114
              E+G A+R+S  PR+E+F+T K    +    NP E L  +L+++GL+YVDLYL+H+P+
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFPI 124

Query: 115 ALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINN 173
                                  D  L D+   + W++M++L  E  A+ IGVSNF + +
Sbjct: 125 I----------------------DPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVED 162

Query: 174 LKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTDAPILKEE 231
           L++L  SK   + P  NQIE +  L      + ++C +  I LEA+ PL     P+ +  
Sbjct: 163 LEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPL----VPLREVN 216

Query: 232 E-------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSDED 282
           E       + ++A+K      Q+++ W +QR  + +  S +PER+    +  +F+L+ ++
Sbjct: 217 EKDLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDE 276

Query: 283 FATLSNYAKKHGERR 297
              ++    +H   R
Sbjct: 277 VEFITKLGSQHDTIR 291

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  128 bits (321), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 148/302 (49%), Gaps = 59/302 (19%)

Query: 3   ALHKNTSTLKLNTGAHIP---VIGLGT-WQSSENEGYNATLEALKA--------GYRHID 50
           A H+   TL  N G  IP   VIG GT W   E    N +   +K         G  H+D
Sbjct: 2   AFHQEFFTL--NNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVD 59

Query: 51  TAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDL 107
            A +Y+   E   A++++  PRNE+FVT K +  Q +   +P E LD  LKR GL+YVDL
Sbjct: 60  HAEVYRTYPEFSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDL 118

Query: 108 YLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGV 166
           YL+H P A K    K+G  ++                   + W  ++EL  E KA+ IGV
Sbjct: 119 YLLHSPFASKE---KNGFTIE-------------------EAWAQLEELYHEGKAKNIGV 156

Query: 167 SNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGSTD 224
           SNF + +L+++L  K  KV P  NQIE    L      ++ F ++  I LEAY+PLG   
Sbjct: 157 SNFRVEDLEKIL--KVAKVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLG--- 211

Query: 225 APILKEEE----------ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE 274
            P+ K +E          I ++ +K      Q+++ W ++RG + +  S +P+RI   Q 
Sbjct: 212 -PLSKRDESEQAKPFYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQN 270

Query: 275 TF 276
            F
Sbjct: 271 LF 272

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  127 bits (320), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 163/320 (50%), Gaps = 60/320 (18%)

Query: 4   LHKNTSTLKL-NTGAHIPVIGLGT---WQSSENEG----------YNATLEALKAGYRHI 49
           ++    TL+L  +G  IP+IG G+   W+ ++  G           +    A+ AG+ HI
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 50  DTAAIYKNEEEIGRAIRDSNIPRNELFVTTKL--WGTQHR---NPTEALDQSLKRLGLDY 104
           D A  YK   E+GR +++S +PR++L++T K   W    R    P E+L  SL+++ + Y
Sbjct: 61  DAAEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSY 120

Query: 105 VDLYLMHWP-VALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQEL-PKEKAR 162
           VDLYL+H P + ++T                    +DL++      W  M+E+  +  A+
Sbjct: 121 VDLYLLHVPFITVQT------------------AGIDLKE-----AWRQMEEIYDRGLAK 157

Query: 163 AIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPL 220
            IGVSNF + +L+ +  +K  K +P  NQIE +  L Q    +I +CK+  IV+E YSPL
Sbjct: 158 NIGVSNFDVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL 215

Query: 221 GSTDAPILK------EEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHG--N 272
                P+ K      ++ +  +A+K   +  Q+++ W  Q G VV+  S +  R+    N
Sbjct: 216 ----VPLTKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVN 271

Query: 273 QETFKLSDEDFATLSNYAKK 292
              F+L+ EDF +++   ++
Sbjct: 272 IFDFELTAEDFDSITKIGRE 291

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  125 bits (315), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 147/302 (48%), Gaps = 54/302 (17%)

Query: 7   NTSTLKLNTGAHI---PVIGLGT-WQSS------ENEGYNATLEALK-AGYRHIDTAAIY 55
           N     LN G  I    +IG GT W++        NE  +    AL   G  H+D A  Y
Sbjct: 4   NQQFFTLNNGNKIRAVAIIGTGTKWKTEAQAHLLSNELVDQAKFALSLPGIVHVDAAEYY 63

Query: 56  KNEEEIGRAIRDSNIPRNELFVTTKLWGTQH--RNPTEALDQSLKRLGLDYVDLYLMHWP 113
           +   E+ +A+++S+ PRNE+F+T K         NP EAL+ +L  LGLDYVDLY++H+P
Sbjct: 64  RTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGLDYVDLYVLHFP 123

Query: 114 VALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSIN 172
                                   D + +D +    W  M+ L KE KA+ IGVSNFSI 
Sbjct: 124 ----------------------EFDPEYKDLSIETAW--MELLYKEGKAKNIGVSNFSIE 159

Query: 173 NLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPLGS-------- 222
           +L+ ++  K   V P  NQIE +  L      ++ +C++ G  LEAYSPL          
Sbjct: 160 HLERVM--KIADVKPQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPLAPLQRKPKNF 217

Query: 223 TDAPILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQE--TFKLSD 280
            + P  K   I E++ K G    ++++ W  +RG V +  S + ERI   Q   +F L+D
Sbjct: 218 NELPFYK--YIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTD 275

Query: 281 ED 282
           E+
Sbjct: 276 EE 277

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  100 bits (249), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 94/314 (29%), Positives = 141/314 (44%), Gaps = 55/314 (17%)

Query: 11  LKLNTGAHIPVI---GLGT-WQS--SENEGYNATLEALK-----AGYRHIDTAAIYKNEE 59
             LN G  IP I   G+G  W       +G    +E LK      G+ HI TA  Y N  
Sbjct: 9   FTLNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNG 68

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHR---NPTEALDQSLKRLGLDYVDLYLMHWPVAL 116
            +  A++ S  PR+E+++T K + +Q +   +P EAL++SL RLG DYVDLYL+H P   
Sbjct: 69  LLSAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNPCL- 126

Query: 117 KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLK 175
                           +     + LE     K W+ M+ L K  K + IGVSNF I +L+
Sbjct: 127 ----------------DSSPNGISLE-----KAWKQMELLYKTGKVKNIGVSNFRIEDLE 165

Query: 176 ELLNSKGNKVVPAANQIEIHPLLPQD--ELINFCKEKGIVLEAYSPL--------GSTDA 225
            L   K  ++ P  N+IE H  L      +  + K   ++L  YSPL           D 
Sbjct: 166 RL---KDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDF 222

Query: 226 PILKEEEITEIAKKNGVNAGQLVISWHAQRGY--VVLPKSVKPERIHGNQETFKLSDEDF 283
           P  +   I  +A+K      Q+++ W    G   V+    VK  +   +  +F+L+ E+ 
Sbjct: 223 PFYR--YIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEEL 280

Query: 284 ATLSNYAKKHGERR 297
             ++   KKH   R
Sbjct: 281 DMITELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 4/81 (4%)

Query: 9  STLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIR-- 66
          +  KLN G  IPVIG G ++  + +  +    ALK GYRHIDTA +Y+N++E  + +R  
Sbjct: 11 TRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKY 70

Query: 67 --DSNIPRNELFVTTKLWGTQ 85
            ++   R  ++ TTKLW +Q
Sbjct: 71 LDETGEARENIWFTTKLWDSQ 91

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 82/179 (45%), Gaps = 31/179 (17%)

Query: 49  IDTAA--IYKNE-EEIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEAL--DQSLKRLGLD 103
           ID AA  IYK    E+G A+  +  P+ E+F+T K       + T A+  D +LK++ ++
Sbjct: 7   IDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVE 66

Query: 104 YVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARA 163
           YVD++ +H P      + K  N+L +   +D      L   N              KA  
Sbjct: 67  YVDMHFLHSPF-----VFKQANVLNL---KDAMHTDHLRRSN--------------KANN 104

Query: 164 IGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSPL 220
            G S+ ++  L+ +L ++  +  P  NQI++   L      +   C+E  I++  YS L
Sbjct: 105 RGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTL 161

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 104/244 (42%), Gaps = 43/244 (17%)

Query: 21  VIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTK 80
           + G  T+    N+  N  +  LKAG + IDTA IY + E   +AI +  +P +   + TK
Sbjct: 4   IYGGYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTK 59

Query: 81  LWGTQ-----HRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDG 135
             G         N  +++++SL  LG+  V+ +L+H P              +IP  E  
Sbjct: 60  ASGFSGGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP------------EIPLEE-- 105

Query: 136 SRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNSKGNK--VVPAANQI 192
                        T + +  L ++ K    G+SNFS  ++K + +   +K  V+P   Q 
Sbjct: 106 -------------TLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQG 152

Query: 193 EIHPLLPQ--DELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK--NGVNAGQLV 248
             + L     ++L    KE  I L AYSP+         EE + E + +  N    GQ+ 
Sbjct: 153 NYNALSRAIVNDLFPLLKELHISLYAYSPIARGFLAETPEEILGEKSGRFDNSTMIGQMY 212

Query: 249 ISWH 252
           +  +
Sbjct: 213 LKLY 216

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 77/181 (42%), Gaps = 52/181 (28%)

Query: 41  ALKAGYRHIDTAAIYKNEEEI-GRAIRD--SNIPRNELFVTTKL-------WGTQHRNPT 90
           A+  G   IDT+  Y   E I G+A+++     PR E F+ TK+       +     N  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 91  EALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTW 150
            ++ +S +RL  DY+DL  +H                            D+E   + K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKIW 141

Query: 151 ELMQELPKEK----ARAIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINF 206
           E ++EL K K     R IG+S + ++ L  L  SK    VP     EI PL   D ++++
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLSY 191

Query: 207 C 207
           C
Sbjct: 192 C 192

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 73/183 (39%), Gaps = 54/183 (29%)

Query: 41  ALKAGYRHIDTAAIYKNEEEIG----RAIRDSNIPRNELFVTTKL-------WGTQHRNP 89
           AL+AG   IDT+  Y   EEI      A+RD + PR   F+ TK+       +     + 
Sbjct: 63  ALEAGICAIDTSPYYGKSEEIYGEALAAVRDEH-PRETYFICTKVGREGPSDFDYSAAHV 121

Query: 90  TEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKT 149
             ++ +S  RL  +Y+DL  +H                            D+E       
Sbjct: 122 RASVHRSCARLHTEYLDLVYLH----------------------------DIEFVEAAGI 153

Query: 150 WELMQELPKEK----ARAIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELIN 205
           WE +QEL + K     R  G+S + +  L+E+          A  + ++ PL   D ++ 
Sbjct: 154 WEALQELRRLKDEGVIRFFGISGYPVELLQEVSEQ-------ACERPDVGPL---DAVLT 203

Query: 206 FCK 208
           +C+
Sbjct: 204 YCQ 206

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 56/140 (40%), Gaps = 43/140 (30%)

Query: 14  NTGAHIP--VIGLGTWQSSE---------NEGYNATLEALKAGYRHIDTAAIYKNEEE-- 60
           NTG  I   ++G  ++ S +         NE +     A  +G R  DTA  Y N +   
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 61  -IGRAIRDSNIPRNELFVTTKLW--------GTQHRNPT--------------------E 91
            +G  +++  IPR  + + TK+W        G Q   P                     E
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE 130

Query: 92  ALDQSLKRLGLDYVDLYLMH 111
           A   S++RLG  Y+D+Y +H
Sbjct: 131 ACKNSVRRLG-TYIDVYQIH 149

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 91/211 (43%), Gaps = 42/211 (19%)

Query: 21  VIGLGTWQSSENEGYNATLEAL-KAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTT 79
           + G  T+ S   E  +  ++ L K     +DTA IY   EE   AI    +P++   + T
Sbjct: 8   IYGAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPGSEE---AIGKFELPKS-FIIDT 63

Query: 80  KLWGTQHRNPT-----EALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPERED 134
           K  G      T     E++++S   LG++ V+++ +H P                    D
Sbjct: 64  KARGFGEGTLTKESINESIEESFGLLGVESVEIFYLHCP--------------------D 103

Query: 135 GSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKEL--LNSKGNKVVPAANQ 191
            +  ++       +T + +  L KE K +  GVSNFS  +++++   N +   V+P   Q
Sbjct: 104 PATPLE-------ETLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQ 156

Query: 192 IEIHPLLPQDE--LINFCKEKGIVLEAYSPL 220
              + +  + E  L    +E G+   AYSP+
Sbjct: 157 GNYNAVGRKIETSLFPVLRELGLSFYAYSPI 187

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 11/95 (11%)

Query: 24  LGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWG 83
           L   Q S+ +  +A LE  KAG + IDTA IY + E+I   I +  +P N   + TK  G
Sbjct: 14  LNLLQRSDIDEISAILE--KAGVKDIDTARIYPDSEKI---IGELQLP-NRFTIHTKASG 67

Query: 84  TQ-----HRNPTEALDQSLKRLGLDYVDLYLMHWP 113
                    N  +++++SL  LG+  V+ + +H P
Sbjct: 68  FSGGCLTKDNINKSIEESLSLLGVPSVETFFLHSP 102

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 93/233 (39%), Gaps = 31/233 (13%)

Query: 14  NTGAHIPVIGLGT----------WQSSENE-GYNATLEALKAGYRHIDTAAIYKN---EE 59
           NTG  I     GT          W   E E  Y     A   G R  DTA  Y N   E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 60  EIGRAIRDSNIPRNELFVTTKLW----GTQHRNPTEALDQSLKRLGLDYVD---LYLMHW 112
            +G  ++  NIPR  + + TK++     T   NPT+ L  + + L L  V+   L   H 
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 113 PVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSI 171
             A K  + + G  + + +      +   E+     T   + ++ ++  AR IG S+   
Sbjct: 131 LEAAKNSVRRLGTYIDVYQIHRCDHETPFEE-----TMRALNDVVEQGYARYIGASSMLG 185

Query: 172 NNLKEL-LNSKGNKVVPAANQIEIHPLLPQD---ELINFCKEKGIVLEAYSPL 220
               E    ++ +      N    + LL ++   E++ FCK+  + +  +SPL
Sbjct: 186 TEFAEYQFIAEKHGWHKFVNMQTCYNLLYREDEREMLPFCKKNNVAITPWSPL 238

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 86/229 (37%), Gaps = 27/229 (11%)

Query: 14  NTGAHI-PVI------GLGTW----QSSENEGYNATLEALKAGYRHIDTAAIYKNEEE-- 60
           NTG  + P+I      G  TW    Q  + E +     A   G R  DTA +Y N +   
Sbjct: 11  NTGLKVSPLIIGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEI 70

Query: 61  -IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVAL--- 116
            +G  +R  NIPR  + + TKL      N           + L+ V++  +         
Sbjct: 71  ILGEFLRKYNIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSS 130

Query: 117 KTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK-ARAIGVSNFSINNLK 175
           +  + + G  + I +   G  D   E+     T   + ++  E   R +G S        
Sbjct: 131 RASVKRLGTYIDILQIHRGDPDTPFEE-----TMGALNDVVIEGLTRYVGASLMLATEFA 185

Query: 176 EL--LNSKGNKVVPAANQIEIHPLLPQD--ELINFCKEKGIVLEAYSPL 220
           E+  +  K        +Q   H +  +D  ELI F K   I L  +SPL
Sbjct: 186 EMQFVAEKHGWFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPL 234

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 31/101 (30%)

Query: 41  ALKAGYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTKLWG--------TQHRNP 89
           A   G R  DTA +Y N   E  +G  +R  NIPR  + + TK++         + +R  
Sbjct: 49  AYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRTK 108

Query: 90  TE-------------------ALDQSLKRLGLDYVDLYLMH 111
           TE                   A+  S+KRLG  Y+D+Y +H
Sbjct: 109 TEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH 148

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 41  ALKAGYRHIDTAAIYKNEE-EIGRAIRD--SNIPRNELFVTTKL-------WGTQHRNPT 90
           A + G   IDT+  Y N E  IG+A+ +     PR+   + TK+       +     N  
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 91  EALDQSLKRLGLDYVDLYLMH 111
            ++ +S KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>TPHA0C02560 Chr3 (568135..569157) [1023 bp, 340 aa] {ON} Anc_2.604
           YMR041C
          Length = 340

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 41  ALKAGYRHIDTAAIYKNEEEI-GRAIRDSNI--PRNELFVTTKL-------WGTQHRNPT 90
           A + G   IDT+  Y + E I G+A++   I  PR+  F+ TK+       +     N  
Sbjct: 50  AFRNGITAIDTSPYYGDSEIIYGKALKSIKIEFPRDTYFICTKVGRIGSNEFDYSANNVR 109

Query: 91  EALDQSLKRLGLDYVDLYLMH 111
           +++ +S KRL  +Y+D+  +H
Sbjct: 110 KSILRSCKRLNTNYLDVVYLH 130

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 32/195 (16%)

Query: 45  GYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALD-QSLKRL 100
           G R  DTA +Y N   E  +G  ++  NI R  + + +K++        E+LD     ++
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFP----VDESLDLHQGSKV 108

Query: 101 GLDYVDLYLM--------HWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWEL 152
             +Y+DL L         H    +   + + G  + I +     ++  +E        E+
Sbjct: 109 DQEYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDILQIHRLDKEASME--------EI 160

Query: 153 MQEL----PKEKARAIGVSNFSINNLKEL-LNSKGNKVVPAANQIEIHPLL---PQDELI 204
           M+ L       + R IG S+       EL   +K N      N    + +L    ++ELI
Sbjct: 161 MRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELI 220

Query: 205 NFCKEKGIVLEAYSP 219
            FCK+ G+ L  +SP
Sbjct: 221 PFCKKHGVGLTVWSP 235

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 75/329 (22%), Positives = 111/329 (33%), Gaps = 101/329 (30%)

Query: 14  NTGAHIPVIGLGT----------WQSSENEGYNATLE-ALKAGYRHIDTAAIYKNEEE-- 60
           NTG  +  I +G           W   + E     L+ A   G R  DTA +Y N E   
Sbjct: 11  NTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEI 70

Query: 61  -IGRAIRDSNIPRNELFVTTKLW--------------------------GTQHRNPTEAL 93
            +G  +++  IPR  + + TKL+                          G   +N   + 
Sbjct: 71  ILGEFLKNYKIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSA 130

Query: 94  DQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELM 153
             S++RLG  Y D+  +H                    R D        D  F +T   +
Sbjct: 131 RDSVRRLGT-YADIIQIH--------------------RAD-------PDTPFEETMRAL 162

Query: 154 QELPKEK-ARAIGVSNFSINNLKEL-LNSKGNKVVPAANQIEIHPLLPQD---ELINFCK 208
            ++  +   R IG S+       E+   ++ N      N    + LL ++   ELI F K
Sbjct: 163 NDIVVDGLTRYIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAK 222

Query: 209 EKGIVLEAYSPL---------GSTDAPILK----------------EEEIT---EIAKKN 240
              I L  +SPL         G T     K                EE IT   EIAKK 
Sbjct: 223 RHNIALTPWSPLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKR 282

Query: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERI 269
                 + + W  Q+G   +    K +RI
Sbjct: 283 NTKMATVALYWVIQKGCFPIVGMSKIDRI 311

>NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3.441
           YGR098C
          Length = 1648

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 108 YLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEKARAIGVS 167
           YL H+ V     LIK   +L I  +   + ++ L   +F+  W L  EL + K R   +S
Sbjct: 581 YLYHYEV-----LIKSAYILNIDMKRHSTNNLLLLTRSFIDKWILRLELSQYKERKDDIS 635

Query: 168 NFSINNLKELL 178
           +F +N +K L 
Sbjct: 636 SFEVNFVKTLF 646

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 78/196 (39%), Gaps = 35/196 (17%)

Query: 45  GYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTKLW-------GTQHRNPTEALD 94
           G R  DTA +Y N   E  IG  ++  NI R  + + TK++          H N T    
Sbjct: 53  GLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDLHHGNSTN--- 109

Query: 95  QSLKRLGLDYVD---LYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWE 151
              +R  LD V+   L   H    +K  + + G  + + +      D   E        E
Sbjct: 110 ---ERNALDLVNQNGLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPKE--------E 158

Query: 152 LMQEL----PKEKARAIGVSNFSINNLKEL-LNSKGNKVVPAANQIEIHPLLPQD---EL 203
           +M+ L     +   R IG S+       EL   ++ N      +    + LL ++   EL
Sbjct: 159 IMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDEREL 218

Query: 204 INFCKEKGIVLEAYSP 219
           I FCK+ G+ L  +SP
Sbjct: 219 IPFCKKHGVGLIPWSP 234

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 95/236 (40%), Gaps = 44/236 (18%)

Query: 46  YRHIDTAAIYKNEEE-IGRAIRDSNIPRNELFVTTKL-------WGTQHRNPTEALDQSL 97
           +  +DT+  Y + E  +G+A+R+  IPR E++V TK+       +     N   ++ +S+
Sbjct: 41  FNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVMRSV 100

Query: 98  KRLGLD--YVD-LYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQ 154
           +RL  +  Y+D +YL       +   +   + LQ  +R    R+V +  +   K + L+ 
Sbjct: 101 ERLVGEGGYLDVVYLHDVEFQPQEACLAALDELQKLKRAGIVRNVGVSGYPLSKLYSLVS 160

Query: 155 ELPKEKARAIGVSNFSINNLKELL--------NSKGNKVVPAAN-----------QIEIH 195
                      V ++   NL+ ++         SKG + V  A+            +E H
Sbjct: 161 LCYDAGTPLDCVLSYCHMNLQNVMLEEYYAKFKSKGVQHVVNASVLSMSLLRSQKTLEFH 220

Query: 196 PLLPQ-----DELINFCKEKGI---------VLEAYSPLGSTDAPILKEEEITEIA 237
           P  P+      +    C  +G+          LE +S  G T       EE+T  A
Sbjct: 221 PGSPELKRRAQQAATLCSSQGVELADLATQFALEQWSDRGPTVIGFSTPEEVTRAA 276

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 16/88 (18%)

Query: 39  LEALKAGYRH----IDTAAIYKNEEEI-GRA---IRDSNIPRNELFVTTKLWGTQ----- 85
           ++ LK G+ H    IDT+  Y   E + G+A   IRD   PRN  ++ TK+   Q     
Sbjct: 43  VDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDE-FPRNSYYICTKVGRIQLDEFD 101

Query: 86  --HRNPTEALDQSLKRLGLDYVDLYLMH 111
               +   ++ +S +RL  DY+DL  +H
Sbjct: 102 YSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 66/306 (21%), Positives = 115/306 (37%), Gaps = 54/306 (17%)

Query: 27  WQSSENEGYNATLE-ALKAGYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTKLW 82
           W   + E    TL+     G R  DTA  Y N   E  +G  ++   I R  + + TK++
Sbjct: 11  WVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETVVILTKIF 70

Query: 83  GTQHRNPTEALDQSLKR--LGLDYVD------LYLMHWPVALKTDLIKDGNLLQIPERED 134
                   E LD  L    +G+D +D      L   H    +K  + + G  + + +   
Sbjct: 71  FP----VDETLDLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVERLGTYIDVLQIHR 126

Query: 135 GSRDVDLEDWNFVKTWELMQELPKEKARAIGVSNFSINNLKEL-LNSKGNKVVPAANQIE 193
             +D  +++    +   L   + K   R IG S+       E+   ++  +     N   
Sbjct: 127 FDQDTPIKE----RMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWFQFVNSQS 182

Query: 194 IHPLLPQD---ELINFCKEKGIVLEAYS---------PLGST-----DAPILKE------ 230
           ++ L+ ++   ELI FCK   I L  +S         P+GST     + P +K       
Sbjct: 183 LYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKL 242

Query: 231 --------EEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETF--KLSD 280
                     + E+AKK   +   +  +W   +G V +    K  R+    +    K +D
Sbjct: 243 EKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIKALKVKFTD 302

Query: 281 EDFATL 286
           E+   L
Sbjct: 303 EELKYL 308

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 21/90 (23%)

Query: 43  KAGYRHIDTAAIYKNEEE---IGRAIRDSNIPRNELFVTTKL-----------------W 82
           +AG   IDTA  Y+NEE    IG  +    + R+++ + TK                   
Sbjct: 64  EAGGNCIDTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSANYC 122

Query: 83  GTQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
           G   R+   ++  SL++L  D++D+  +HW
Sbjct: 123 GNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 21/90 (23%)

Query: 43  KAGYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTK-----------------LW 82
           +AG   IDTA  Y+N   EE IG  +    I R+++ + TK                   
Sbjct: 64  EAGGNFIDTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSANFS 122

Query: 83  GTQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
           G   R+   ++  SL++L  D++D+  +HW
Sbjct: 123 GNHRRSLQLSVRDSLRKLQTDWIDILYVHW 152

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 21/90 (23%)

Query: 43  KAGYRHIDTAAIYKNEEE---IGRAIRDSNIPRNELFVTTKLWGT--------------- 84
           +AG   IDTA  Y+NEE    IG  ++   + R+++ + TK  G                
Sbjct: 18  EAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEVGGGKSANYC 76

Query: 85  -QHRNPTE-ALDQSLKRLGLDYVDLYLMHW 112
             H++    ++  SL++L  D++D+  +HW
Sbjct: 77  GNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 76/204 (37%), Gaps = 31/204 (15%)

Query: 35  YNATLEALKAGYRHIDTAAIYKN---EEEIGRAIRDSNIPRNELFVTTKLWGT------- 84
           +N        G R  DTA +Y N   E  IG  ++  NI R  + + TK++         
Sbjct: 43  FNILKHCYDNGLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIFYAVDETLDL 102

Query: 85  -QHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLED 143
            +   P E  D  L   G     L   H    +K  + + G  + + +      D   E 
Sbjct: 103 PRSNVPNERNDLDLANQG----GLSRKHIITGVKNSVERLGTYIDVLQIHRLDHDTPKE- 157

Query: 144 WNFVKTWELMQEL----PKEKARAIGVSNFSINNLKEL-LNSKGNKVVPAANQIEIHPLL 198
                  E+M+ L     +   R IG S+       EL   ++ N      +    + LL
Sbjct: 158 -------EIMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLL 210

Query: 199 PQD---ELINFCKEKGIVLEAYSP 219
            ++   ELI FCK  G+ L  +SP
Sbjct: 211 NREDERELIPFCKRHGVGLIPWSP 234

>KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa] {ON}
            similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3721

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 30   SENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNP 89
            +++EG+   L  L+ G+R  D +A  +  E+  +++ D   PR ++F T      Q+   
Sbjct: 2722 AKHEGFTDLL--LECGWRVADWSADREALEQSVKSVMDVPTPRRQIFET--FLALQNFAE 2777

Query: 90   TEALDQSLKRLGLDYVDLYLMHW 112
            T+  DQ +KRL  + + L L  W
Sbjct: 2778 TKKGDQEVKRLCDEGIQLSLHAW 2800

>Ecym_5417 Chr5 (862054..862083,862150..863304) [1185 bp, 394 aa]
           {ON} similar to Ashbya gossypii AFL226W
          Length = 394

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 163 AIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINF 206
           A+G+S    NN ++ ++  G  +   A  ++ + LL QD+ INF
Sbjct: 174 ALGMSLLGFNNCRQAIDGDGTIIRSGACSLDKYELLNQDDDINF 217

>Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C
           (REAL)
          Length = 723

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 92  ALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWE 151
            LDQ  K   +DY+  +       + T+L ++GNL    + +  ++ + LEDW   + W+
Sbjct: 399 TLDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQEQVIAKKMRLEDW---RIWK 455

Query: 152 LMQEL 156
           ++ EL
Sbjct: 456 IIVEL 460

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 19/89 (21%)

Query: 43  KAGYRHIDTAAIYKNEEE--------IGRAIRDSNIPRNELFVTTKLW-----------G 83
           +AG   IDTA  Y+NE+         + R +RD  +   +     K +           G
Sbjct: 64  EAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKKYDVGGGKSANYCG 123

Query: 84  TQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
              R+   ++  SL++L  D++D+  +HW
Sbjct: 124 NHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 21/90 (23%)

Query: 43  KAGYRHIDTAAIYKNEEE---IGRAIRDSNIPRNELFVTTKL-----------------W 82
           +AG   +DTA  Y+NE+    IG  ++   + R+++ + TK                   
Sbjct: 64  EAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSANYC 122

Query: 83  GTQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
           G   R+   ++  SL++L  D++D+  +HW
Sbjct: 123 GNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 21/90 (23%)

Query: 43  KAGYRHIDTAAIYKNEEE---IGRAIRDSNIPRNELFVTTKL-----WGTQHRNPTE--- 91
           +AG   IDTA  Y+NE+    IG  +    + R+++ + TK      W    +N +    
Sbjct: 64  EAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDVGKNRSANFC 122

Query: 92  ---------ALDQSLKRLGLDYVDLYLMHW 112
                    ++  SL++L  D++D+  +HW
Sbjct: 123 GNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {ON}
           similar to uniprot|P32944 Saccharomyces cerevisiae
           YJL187c
          Length = 876

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 90  TEALDQSLKRLGLDYVDLYLMHWPVA----LKTDLIKDGNLLQIPEREDGSRDVDLEDWN 145
           TE    +L   G +Y+  Y+  W       + TD  ++G+L +  + +  S+   LEDW 
Sbjct: 554 TEFQSTNLDEEGKEYIIDYITSWKYGDSYYIMTDFYENGSLDKFLQEQVVSKKTKLEDW- 612

Query: 146 FVKTWELMQEL 156
             + W++M E+
Sbjct: 613 --RIWKIMVEI 621

>TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON}
           Anc_1.149 YJL187C
          Length = 1206

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 6/86 (6%)

Query: 71  PRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIP 130
           P   +    KL    H N    LDQ  K   +DYV  +       L T   ++GNL    
Sbjct: 839 PLKRILQEIKLLNKIHEN---DLDQEGKEYVIDYVSSWKFEGSYYLMTTYYENGNLDDFL 895

Query: 131 EREDGSRDVDLEDWNFVKTWELMQEL 156
           +++   + + LEDW   + W+++ E+
Sbjct: 896 QQQIIPKKIRLEDW---RIWKIIVEI 918

>Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa] {ON}
            YHR099W (TRA1) - ATM/Mec1/TOR1+2-related [contig 157]
            FULL
          Length = 3725

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 30   SENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNP 89
            +++EG+   L  L+ G+R  D  A  +  E+  +++ D   PR ++F T      Q+   
Sbjct: 2726 AKHEGFTDLL--LECGWRVADWNADREALEQSVKSVMDVPTPRRQIFET--FLALQNFAE 2781

Query: 90   TEALDQSLKRLGLDYVDLYLMHW 112
            T+  DQ +KRL  + + L L  W
Sbjct: 2782 TKKGDQEVKRLCDEGIQLSLHKW 2804

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 110/305 (36%), Gaps = 78/305 (25%)

Query: 14  NTGAHIPVIGLGT----------WQSSENEGYNATLE-ALKAGYRHIDTAAIYKN---EE 59
           N+G  I  I +G           W   E E     L+    +G R  DTA +Y N   E 
Sbjct: 13  NSGLKISPILVGCMSYGSKDWAEWVIDEKEKIFEILKHCYDSGMRTFDTADVYSNGLSER 72

Query: 60  EIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLK-----------RLGL-DYVDL 107
            +G  ++   I R  + + TK++          +D+SLK            LGL +   L
Sbjct: 73  ILGEFLKHYKIKRETVVILTKVY--------YPVDESLKLTHSAKISESDMLGLVNQTGL 124

Query: 108 YLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE----KARA 163
              H   A K  + + G  + + +      D  +E        E+M+ L         R 
Sbjct: 125 SRKHILEAAKNSVERLGTYIDVLQIHRLDHDTPME--------EIMKALNDVVGLGYTRY 176

Query: 164 IGVSNFSINNLKEL--LNSKGNKVVPAANQIEIHPLLPQDE--LINFCKEKGIVLEAYSP 219
           IG S+       EL  +  K +      +Q     L  +DE  LI F K+ GI L  +SP
Sbjct: 177 IGASSMLATEFAELQFIAEKHDWTKFICSQSCYSLLYREDERELIPFAKKHGIGLIPWSP 236

Query: 220 --LGSTDAPILKEEE--------------------------ITEIAKKNGVNAGQLVISW 251
              G    P+ +E +                          + E+AKK G++   + I+W
Sbjct: 237 NARGVLTRPLNQETDRKISDPTLKRLKFDCLESHEKRIVNRVEEVAKKKGISMAMVSIAW 296

Query: 252 HAQRG 256
              +G
Sbjct: 297 VLSKG 301

>TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {ON}
           Anc_8.560 YPL084W
          Length = 901

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 49/116 (42%), Gaps = 26/116 (22%)

Query: 125 NLLQIPEREDGSRDVDLEDWNFVKTWELMQELPK-EKARAIGVSNFSINNLK-------- 175
           NL  + +  D S+  DLE  +F+    L   LPK E       SN    N K        
Sbjct: 396 NLTLLRKELDNSQVADLEYTSFMDFTSLHTLLPKLESMYKNSNSNSQFENPKWEILKNKV 455

Query: 176 ----ELLNSKGNKVVPAANQI-----------EIHPLLPQDELINFCKEKGIVLEA 216
               +  N+K  K +P  NQI           E+ PL+P+D++ N  K K  +LEA
Sbjct: 456 SLILDTFNNKNFKDIP--NQINMVINKRKEIQELLPLIPKDQMANIVKLKSSLLEA 509

>SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3725

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 30   SENEGYNATLEALKAGYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNP 89
            +++EG+   L  L+ G+R  D  A  +  E+  +++ D   PR ++F T      Q+   
Sbjct: 2726 AKHEGFTDLL--LECGWRVADWNADREALEQSVKSVMDVPTPRRQMFET--FLALQNFAE 2781

Query: 90   TEALDQSLKRLGLDYVDLYLMHW 112
            T+  DQ ++RL  + + L L  W
Sbjct: 2782 TKKGDQDIRRLCDEGIQLSLHKW 2804

>Skud_10.383 Chr10 (684416..685546) [1131 bp, 376 aa] {ON} YNL331C
           (REAL)
          Length = 376

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 19/90 (21%)

Query: 42  LKAGYRHIDTAAIYKNEEE--------IGRAIRDSNIPRNELFVTTK-----------LW 82
            +AG   IDTA  Y+NE+         + R +RD  +   +     K             
Sbjct: 63  FEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKKYEVGKGRSANFC 122

Query: 83  GTQHRNPTEALDQSLKRLGLDYVDLYLMHW 112
           G    +   ++  SL++L  D++D+  +HW
Sbjct: 123 GNHKHSLHVSVRDSLRKLQTDWIDILYVHW 152

>Kpol_526.12 s526 (25596..32774) [7179 bp, 2392 aa] {ON}
            (25596..32774) [7179 nt, 2393 aa]
          Length = 2392

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 56/143 (39%), Gaps = 28/143 (19%)

Query: 87   RNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNF 146
            RN T+ LD  +KR+G D+V                 +  LL I +  D  ++    + + 
Sbjct: 1667 RNSTDILDFRMKRIGADFV----------------PNHYLLSIRKSYDSLKNKSYSNEDL 1710

Query: 147  VKTWELMQELPKEKARAIGVSNFSINNLK-----------ELLNSKGNKVVPAANQIEIH 195
            V T+  + EL +  +R    S   +N LK           E+L  +G          EIH
Sbjct: 1711 VNTFFKITELSRNNSRLDLASESLMNCLKHDQNQAELEFAEILWKQGENDRALKLVKEIH 1770

Query: 196  PLLPQDELINFCKEKGIVLEAYS 218
                 D  I  C+ KG +L  Y+
Sbjct: 1771 EKCKNDPNIK-CRTKGAILLKYT 1792

>KNAG0B05830 Chr2 (1146636..1149737) [3102 bp, 1033 aa] {ON}
           Anc_4.196 YLR357W
          Length = 1033

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 233 ITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLS 287
           I   A   G N G +++      G  VLP  +  ER+ G+QE +++   DF +++
Sbjct: 828 IQYAAAYKGNNQGSVIVD---TPGAYVLPIDILGERVKGSQELYEIQTADFNSMA 879

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,532,271
Number of extensions: 1626397
Number of successful extensions: 4153
Number of sequences better than 10.0: 178
Number of HSP's gapped: 3882
Number of HSP's successfully gapped: 180
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)