Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0I01078g5.439ON1261266672e-91
NDAI0C015805.439ON1261266421e-87
Smik_15.2995.439ON1261266333e-86
YOR122C (PFY1)5.439ON1261266333e-86
Skud_15.2845.439ON1261266315e-86
TDEL0D026205.439ON1261266282e-85
Suva_8.1745.439ON1261266264e-85
SAKL0G02640g5.439ON1261266185e-84
KNAG0B042205.439ON1261266124e-83
KAFR0D050405.439ON1261266125e-83
Kpol_1062.275.439ON1261266012e-81
NCAS0H020705.439ON1261265995e-81
TPHA0E017405.439ON1261265943e-80
Ecym_45105.439ON1261265901e-79
KLLA0E02289g5.439ON1261265873e-79
KLTH0F15950g5.439ON1261265761e-77
ACL168C5.439ON1261265761e-77
TBLA0A065005.439ON1191265578e-75
ZYRO0F10142g5.439ON1261265423e-72
Kwal_55.214135.439ON58582751e-32
ZYRO0F02574g8.17ON63047661.4
NCAS0C027408.427ON491134642.6
NDAI0H039202.38ON115022643.0
KAFR0L012307.293ON10646604.3
KLLA0F05555g7.293ON10443597.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I01078g
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   261   2e-91
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   251   1e-87
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   248   3e-86
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   248   3e-86
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   247   5e-86
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   246   2e-85
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   245   4e-85
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   242   5e-84
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   240   4e-83
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   240   5e-83
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   236   2e-81
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   235   5e-81
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   233   3e-80
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   231   1e-79
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   230   3e-79
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   226   1e-77
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   226   1e-77
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   219   8e-75
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   213   3e-72
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   110   1e-32
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    30   1.4  
NCAS0C02740 Chr3 (515889..517364) [1476 bp, 491 aa] {ON} Anc_8.4...    29   2.6  
NDAI0H03920 Chr8 (961962..965414) [3453 bp, 1150 aa] {ON} Anc_2....    29   3.0  
KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321...    28   4.3  
KLLA0F05555g Chr6 (544997..545311) [315 bp, 104 aa] {ON} highly ...    27   7.0  

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  261 bits (667), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  251 bits (642), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 122/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGKVDKAVIYS+AGD+VWATSGG  LQANEISEI QGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVL+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  248 bits (633), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 118/126 (93%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVIYS+AGDAVWATSGGLSLQ NEI EIVQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTV+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  248 bits (633), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 118/126 (93%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVIYS+AGDAVWATSGGLSLQ NEI EIVQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTV+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  247 bits (631), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVIYS+AGDA+WATSGGLSLQ NEISE+VQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQTV+I+HYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  246 bits (628), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 122/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYS+AGD++WA+SGGL+LQANEI EI QGFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT+LIAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  245 bits (626), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNL+ TGKVDKAVI+S+AGDA+WATSGGLSLQ NEI EIVQGFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGV+CVRTKQTV+IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  242 bits (618), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKA+IYS+AGDA+WATSGGL+LQ  EISEI QGFDNPTGLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFML+RADDRSIYGRHDAEGVVCVRTKQT+LIAHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  240 bits (612), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGKVDKAVIYS+AGD+VWATSGGL+LQ NEIS IV GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFM LRADDRSIYGRHDAEGV+CVRTKQT+L+AHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  240 bits (612), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 112/126 (88%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLAT KVD+AVIYS+AGDA WATSGG++LQ NEI+EI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  236 bits (601), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGK+DKAV+YS+AGDAVWA+SGGL+L A EIS I QGFD+P+ LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRADDRSIYGRHDAEGVVCVRTKQT+L+AHYP TVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  235 bits (599), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQA TDNLLATGKVD+AV+YS+AGD+VWATSGGL LQ NEI+EI +GFDNP GLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFMLLRADD+SIYGRHDAEG+VCVRT QT+LIAHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  233 bits (594), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGKVDKA +YS+AGDA WA SGGLSL A E +EI +GFD+P+GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  231 bits (590), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNL+ATGKVDKA+IYS+AGD +WA+SGG+SL+ANEISEI QGFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRADDRSIYGRH+AEG++ VRTKQT+LIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  230 bits (587), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGK+DK+VIYS+AGDAVWA+SGGL LQ  EISEI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT+LI HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLL TGK+DKA IYS+AGD++WA SGGLSL  NEI EI QGF+NP+GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LH+QGQKFML+RADDRSIYGRHDAEGV+CVRTKQT+L+ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYTDNLLATGKVDKA IYS+AGD +WA+SGGL+L+ +EI EI QGFDN  GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT+LIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  219 bits (557), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 114/126 (90%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQA       TGKVDKAVIYS+AGD+VWA+SGGL L ANEI+EI +GFDNP+GLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRADDRSIYGRHDAEG+VCVRTKQT++IAHYPPTVQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  213 bits (542), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%)

Query: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60
           MSWQAYT+NLL TGK+DKA IYS+AGD++WA+SGGL+    EI +I  GFD P+GLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  110 bits (275), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 69  MLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADYLISVQY 126
           ML+RADDRSIYGRHDAEGVVCVRTKQT+L+ HYP  VQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 48  QGFDNPTGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQ 94
           +G+D P  +   GL    ++F L   D+R +Y  +D +    VR K 
Sbjct: 306 KGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMKN 352

>NCAS0C02740 Chr3 (515889..517364) [1476 bp, 491 aa] {ON} Anc_8.427
           YLR227C
          Length = 491

 Score = 29.3 bits (64), Expect = 2.6,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 51/134 (38%), Gaps = 24/134 (17%)

Query: 3   WQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNGLH 62
           W+ + D    T K+D+  I +     +  T  G  +   EIS+I    DN T  Q    H
Sbjct: 363 WERFND----TTKLDRQSITTHLPRILLKTLRGSIIMVEEISDIESDSDNETSSQMISNH 418

Query: 63  ------IQGQKFMLLRADDR---SIYGRHDAE----------GVVCVRTKQTVLIAHYPP 103
                 I   KFM LR   +    I+ RH  +          GV  +R  Q     H   
Sbjct: 419 KYKYEIISKLKFMKLRVKQKWNDGIHSRHSHKSDKYKKRWDLGVEWIRLWQKGYSEHNDT 478

Query: 104 TVQAGEATKIVEQL 117
            V  G AT ++EQ 
Sbjct: 479 KVD-GMATFLLEQF 491

>NDAI0H03920 Chr8 (961962..965414) [3453 bp, 1150 aa] {ON} Anc_2.38
           YDL231C
          Length = 1150

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 40  ANEISEIVQGFDNPTGLQSNGL 61
           +NEISE    FD PT  ++NG+
Sbjct: 442 SNEISEDTSKFDTPTSFKANGI 463

>KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321
          bp, 106 aa] {ON} Anc_7.293 YDL130W
          Length = 106

 Score = 27.7 bits (60), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 7  TDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDN 52
           DNLLA  K   A +     D VWA     +L+  ++ EI+ GF N
Sbjct: 22 ADNLLAVTKAAGASV-----DNVWADVYAKALEGKDLKEILSGFHN 62

>KLLA0F05555g Chr6 (544997..545311) [315 bp, 104 aa] {ON} highly
          similar to uniprot|P10622 Saccharomyces cerevisiae
          YDL130W RPP1B Ribosomal protein P1 beta a component of
          the ribosomal stalk which is involved in the
          interaction between translational elongation factors
          and the ribosome accumulation of P1 in the cytoplasm is
          regulated by phosphorylation and interaction with the
          P2 stalk component
          Length = 104

 Score = 27.3 bits (59), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 8  DNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGF 50
          DNLL   K   A I     D VWA +   +L+  +I EI+ GF
Sbjct: 23 DNLLTLTKAAGASI-----DNVWAETFAKALEGKDIKEILSGF 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,246,049
Number of extensions: 406120
Number of successful extensions: 869
Number of sequences better than 10.0: 28
Number of HSP's gapped: 869
Number of HSP's successfully gapped: 28
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)