Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H10604g2.306ON41641615660.0
NDAI0B034402.306ON4991907833e-99
NCAS0B061402.306ON4431917776e-99
TDEL0G023602.306ON4021987651e-97
KNAG0A054402.306ON4421997629e-97
TBLA0B071702.306ON4702017552e-95
YNL016W (PUB1)2.306ON4532037472e-94
Suva_14.3302.306ON4572047473e-94
Skud_14.3122.306ON4592047464e-94
Smik_14.3132.306ON4512047464e-94
Kpol_1043.342.306ON4421837351e-92
ZYRO0A02398g2.306ON4101827285e-92
AGR390C2.306ON3781817193e-91
TPHA0C035202.306ON4421877237e-91
Ecym_33442.306ON4211867112e-89
SAKL0E07128g2.306ON4011877093e-89
KLTH0G10912g2.306ON4361867072e-88
Kwal_27.114472.306ON4392287062e-88
KAFR0J012602.306ON3651836951e-87
KLLA0E08779g2.306ON4751977013e-87
Kpol_1032.498.229ON5801922441e-21
TPHA0B034208.229ON5791952442e-21
Ecym_80105.382ON6021812442e-21
TBLA0F037808.229ON5771872432e-21
TDEL0E024505.382ON4721812394e-21
NDAI0C061008.229ON5851772343e-20
ZYRO0B11660g8.229ON5871892334e-20
ADR307W5.382ON5661792334e-20
TDEL0A013508.229ON5881862291e-19
KLLA0C17600g8.229ON5921672282e-19
KNAG0G018108.229ON5961742254e-19
CAGL0L11792g8.229ON5791672245e-19
SAKL0H17952g8.229ON5891862229e-19
NCAS0A036808.229ON5751612211e-18
KAFR0B025008.229ON5821892202e-18
Ecym_55628.229ON5801692193e-18
KLLA0F14861g5.382ON5891772183e-18
Kwal_56.234868.229ON5871802094e-17
CAGL0H02123g5.382ON5551922094e-17
SAKL0G08118g5.382ON5451732085e-17
KLTH0E03520g5.382ON5162052085e-17
Kwal_55.201545.382ON5221882061e-16
YER165W (PAB1)8.229ON5771672061e-16
Smik_5.3378.229ON5771672051e-16
Skud_5.3048.229ON5771672051e-16
KAFR0D048305.382ON4061662012e-16
Kpol_224.18.797ON2171891933e-16
AGR122C8.229ON5851672023e-16
ZYRO0A07018g5.382ON5581792006e-16
Suva_5.2998.229ON5771671998e-16
TBLA0H017905.382ON6742211962e-15
Smik_8.1645.382ON5241971952e-15
SAKL0A07370g6.104ON4902401952e-15
NCAS0H018105.382ON4431721942e-15
KLTH0G14344g8.229ON5871611952e-15
KNAG0D032204.61ON3991881932e-15
NDAI0D028404.61ON4261771899e-15
KAFR0F031204.61ON4121771891e-14
Skud_6.1071.357ON611721892e-14
YGR159C (NSR1)4.61ON4141781862e-14
NCAS0A058904.61ON4151771862e-14
TPHA0H015205.382ON4941881862e-14
Skud_2.3456.104ON6641461863e-14
Ecym_30826.104ON5862341854e-14
Skud_8.1475.382ON5131881844e-14
Suva_4.4706.104ON6631461855e-14
Smik_2.3556.104ON7361461855e-14
YHR086W (NAM8)5.382ON5231921845e-14
Smik_6.2644.61ON3951801818e-14
CAGL0M03795g3.49ON5131661821e-13
TBLA0C043604.61ON4031791801e-13
YBR212W (NGR1)6.104ON6721461812e-13
Suva_15.2805.382ON5411931802e-13
KNAG0B044405.382ON3971811772e-13
AAR151W6.104ON4812331782e-13
Ecym_62014.61ON4481781783e-13
NDAI0C018205.382ON4981801774e-13
Suva_7.4504.61ON3911811754e-13
TDEL0F029104.61ON4361801755e-13
NCAS0A100103.49ON5061661756e-13
KLTH0E14036g8.797ON2091921669e-13
Ecym_74208.797ON2041681651e-12
SAKL0H23562g4.61ON4211771721e-12
TDEL0G036706.104ON6171461722e-12
KNAG0A013703.49ON5451681722e-12
SAKL0B06270g8.797ON2091711642e-12
KAFR0G023206.104ON6202451722e-12
CAGL0K06655g6.104ON8022151722e-12
KLTH0D03916g4.61ON5051801712e-12
NCAS0B072401.357ON610721712e-12
ZYRO0C05060g6.104ON7161461712e-12
AFR107W4.61ON3962091683e-12
TBLA0A078103.49ON4721661694e-12
KLLA0C05522g6.104ON5402191684e-12
Skud_7.4834.61ON3931801675e-12
CAGL0E01947g3.49ON4521681685e-12
ZYRO0C02574g3.49ON5431661685e-12
CAGL0E03245g4.61ON4251781666e-12
ABL059W8.797ON2041741606e-12
Kwal_27.123378.797ON2091741598e-12
TDEL0E006003.49ON5471661669e-12
Suva_6.951.357ON613721661e-11
TPHA0K019104.61ON416761641e-11
NDAI0G039703.49ON6071681651e-11
SAKL0C12672g3.49ON5511661651e-11
TPHA0P013103.49ON5181691641e-11
KLLA0C14388g8.797ON2031691572e-11
Kpol_1026.214.61ON437801632e-11
Kwal_55.219603.49ON5971361642e-11
KAFR0C016803.49ON4791681632e-11
KLTH0F18766g3.49ON5881361632e-11
NCAS0C046003.49ON5811681632e-11
Ecym_20503.49ON5411361623e-11
CAGL0I09900g8.797ON2111801553e-11
KLLA0C11495g4.61ON4452051613e-11
NDAI0A061703.49ON5521421605e-11
Kpol_1076.113.49ON5261681596e-11
Kwal_14.18516.104ON5351461588e-11
TBLA0D049401.357ON665711581e-10
Kwal_0.3701.357ON560721571e-10
ZYRO0G00814g1.357ON654871571e-10
Skud_15.4878.797ON2131801501e-10
TBLA0B085903.49ON6231671562e-10
ZYRO0G07326g4.61ON4681781552e-10
Suva_8.3708.797ON2131811492e-10
Kpol_530.466.104ON5871461552e-10
TDEL0B010108.797ON2101721492e-10
AEL016C1.357ON678721552e-10
TBLA0A099206.104ON5941461552e-10
Ecym_27461.357ON681721552e-10
KLLA0C12925g3.49ON5701681533e-10
NCAS0C048301.408ON3771671523e-10
Smik_15.303.49ON5361661534e-10
Skud_15.303.49ON5391661524e-10
YOL123W (HRP1)3.49ON5341661525e-10
Suva_15.373.49ON5511661525e-10
NDAI0B045701.357ON464891515e-10
SAKL0D09680g1.357ON672721526e-10
KLTH0H06842g6.104ON5471171508e-10
Kpol_1008.231.357ON660721508e-10
TPHA0A022201.357ON713721491e-09
KAFR0B044205.76ON6251951481e-09
KNAG0G032608.797ON2011681412e-09
TDEL0H032407.159ON1671091392e-09
Kwal_26.7493singletonOFF2221361394e-09
TPHA0G010808.797ON2201841395e-09
KAFR0C044101.357ON589721445e-09
YFR023W (PES4)1.357ON611721436e-09
YOR319W (HSH49)8.797ON2131861378e-09
KAFR0H031101.408ON4411961392e-08
Kpol_1018.1221.357ON6341551392e-08
ADL160W3.49ON5261361392e-08
Smik_15.5008.797ON2131801332e-08
TDEL0D022501.357ON6221071392e-08
NDAI0G059701.357ON611861374e-08
CAGL0I08943g1.357ON602721365e-08
KNAG0I015901.357ON590791356e-08
KNAG0C020301.357ON365781329e-08
CAGL0B04807g1.408ON4191791339e-08
Skud_8.671.357ON6521191349e-08
KAFR0C054305.536ON274871301e-07
TPHA0F028206.104ON6081461331e-07
Smik_7.3341.357ON611721321e-07
SAKL0D08558g1.408ON4641761302e-07
TPHA0B043001.102ON3341191292e-07
KLTH0H12958g1.357ON6391601312e-07
Kpol_1075.1a8.229ON264781272e-07
NDAI0E004708.797ON2581951272e-07
ZYRO0F12716g8.797ON2101901253e-07
CAGL0H04675g5.536ON274871273e-07
NDAI0G001801.408ON4641921293e-07
KLLA0E19031g6.183ON6521701294e-07
CAGL0L12672g8.491ON6822001285e-07
ZYRO0G08140g6.183ON6321901276e-07
AAL018W1.408ON3371731256e-07
KLLA0D05016g1.408ON4431751257e-07
Suva_3.81.408ON4331821258e-07
KLLA0E11045g8.822ON4321811258e-07
YCL011C (GBP2)1.408ON4271821258e-07
KLLA0A08338g1.357ON766721268e-07
NCAS0B009508.797ON2191801219e-07
Smik_3.711.408ON4281821249e-07
Kwal_55.209727.159ON1351091171e-06
KAFR0H014508.491ON690811251e-06
ADR189W5.536ON269831221e-06
Kpol_487.61.408ON3761811231e-06
Smik_8.801.357ON6701341241e-06
KLTH0F13442g7.159ON1341091161e-06
ADR017W7.159ON1731091171e-06
TPHA0F023102.80ON4001311222e-06
Kpol_1041.42.80ON384751222e-06
ZYRO0G04862g2.80ON3761331212e-06
Skud_3.481.408ON4291701212e-06
SAKL0H02332g5.76ON8172361213e-06
TBLA0B008102.80ON389751203e-06
Suva_14.1662.80ON4032051203e-06
NDAI0D048104.33ON626911213e-06
CAGL0J01914g7.159ON1691071144e-06
Ecym_40715.536ON270831174e-06
Kpol_1023.955.536ON274871174e-06
SAKL0A05280g6.183ON5821951195e-06
NCAS0C023808.491ON702811195e-06
TDEL0A039905.536ON278831175e-06
KNAG0B036505.536ON279831176e-06
Suva_16.2718.491ON686811196e-06
Ecym_11211.102ON324751176e-06
ZYRO0D12782g5.536ON273851167e-06
NDAI0G041901.408ON3591741177e-06
Kpol_150.17.159ON1381071117e-06
KLLA0D13420g7.159ON1661091127e-06
ZYRO0G07216g4.66ON271891167e-06
YGR250C5.76ON7812221187e-06
Suva_7.5465.76ON7792221188e-06
TDEL0B060601.408ON3451801168e-06
YPL043W (NOP4)8.491ON685891179e-06
TBLA0B080105.76ON9391041189e-06
Skud_7.5835.76ON7792251179e-06
NDAI0F01720singletonON4741481161e-05
CAGL0J11154g2.80ON380751161e-05
NCAS0H010406.183ON6291771171e-05
Kwal_33.134961.102ON330751151e-05
SAKL0C03234g1.102ON340751151e-05
ZYRO0F16214g1.102ON330751151e-05
CAGL0H03861g1.408ON4431831161e-05
Kwal_27.111586.183ON5671701161e-05
ZYRO0G04004g7.159ON1671111101e-05
KAFR0B036808.822ON4411691151e-05
KLTH0C04268g8.822ON4501891151e-05
Kwal_27.118328.491ON686811161e-05
YHR015W (MIP6)1.357ON659751161e-05
AFL061C6.183ON5231701151e-05
NDAI0F033202.80ON399751142e-05
ZYRO0E04928g1.408ON4091951152e-05
Suva_9.2107.145ON250761122e-05
NCAS0H025905.536ON270831122e-05
NDAI0E030708.491ON701811152e-05
KAFR0B066906.183ON5331721142e-05
AGL250W8.491ON729811142e-05
Smik_14.1552.80ON4032231132e-05
KAFR0A074902.80ON3812071132e-05
Ecym_55745.76ON8712151142e-05
KAFR0A009801.357ON642721142e-05
KLTH0F02838g1.102ON330751122e-05
NCAS0E038805.76ON7172041143e-05
TBLA0J018307.159ON140891063e-05
KLTH0B06886g2.80ON396751123e-05
KAFR0K010507.159ON154751073e-05
TDEL0B014608.491ON6922021133e-05
KAFR0B045402.167ON220941093e-05
Ecym_22336.183ON5761801133e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10604g
         (416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   607   0.0  
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   306   3e-99
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   303   6e-99
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   299   1e-97
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   298   9e-97
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   295   2e-95
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   292   2e-94
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   292   3e-94
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   291   4e-94
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   291   4e-94
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   287   1e-92
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   285   5e-92
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   281   3e-91
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   283   7e-91
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   278   2e-89
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   277   3e-89
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   276   2e-88
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   276   2e-88
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   272   1e-87
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   274   3e-87
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    99   1e-21
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    99   2e-21
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    99   2e-21
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    98   2e-21
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    97   4e-21
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             95   3e-20
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    94   4e-20
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    94   4e-20
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    93   1e-19
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    92   2e-19
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    91   4e-19
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    91   5e-19
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    90   9e-19
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    90   1e-18
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    89   2e-18
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    89   3e-18
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    89   3e-18
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    85   4e-17
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    85   4e-17
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    85   5e-17
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    85   5e-17
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    84   1e-16
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    84   1e-16
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    84   1e-16
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    84   1e-16
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    82   2e-16
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    79   3e-16
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    82   3e-16
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    82   6e-16
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    81   8e-16
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    80   2e-15
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    80   2e-15
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    80   2e-15
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     79   2e-15
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    80   2e-15
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    79   2e-15
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    77   9e-15
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    77   1e-14
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    77   2e-14
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    76   2e-14
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             76   2e-14
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    76   2e-14
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    76   3e-14
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    76   4e-14
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    75   4e-14
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    76   5e-14
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    76   5e-14
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    75   5e-14
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    74   8e-14
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    75   1e-13
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    74   1e-13
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    74   2e-13
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    74   2e-13
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    73   2e-13
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    73   2e-13
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    73   3e-13
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    73   4e-13
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    72   4e-13
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    72   5e-13
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    72   6e-13
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    69   9e-13
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    68   1e-12
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    71   1e-12
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    71   2e-12
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    71   2e-12
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    68   2e-12
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    71   2e-12
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    71   2e-12
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    70   2e-12
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    70   2e-12
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    70   2e-12
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    69   3e-12
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    70   4e-12
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    69   4e-12
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    69   5e-12
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    69   5e-12
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    69   5e-12
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    69   6e-12
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    66   6e-12
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    66   8e-12
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    69   9e-12
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    69   1e-11
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    68   1e-11
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    68   1e-11
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    68   1e-11
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    68   1e-11
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    65   2e-11
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    67   2e-11
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    68   2e-11
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    67   2e-11
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    67   2e-11
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      67   2e-11
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    67   3e-11
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    64   3e-11
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    67   3e-11
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    66   5e-11
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    66   6e-11
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    65   8e-11
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    65   1e-10
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    65   1e-10
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    65   1e-10
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    62   1e-10
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    65   2e-10
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    64   2e-10
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    62   2e-10
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    64   2e-10
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    62   2e-10
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    64   2e-10
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    64   2e-10
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    64   2e-10
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    64   3e-10
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     63   3e-10
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    64   4e-10
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    63   4e-10
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    63   5e-10
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    63   5e-10
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    63   5e-10
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    63   6e-10
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    62   8e-10
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    62   8e-10
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    62   1e-09
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    62   1e-09
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    59   2e-09
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    58   2e-09
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    58   4e-09
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    58   5e-09
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    60   5e-09
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    60   6e-09
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    57   8e-09
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    58   2e-08
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    58   2e-08
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    58   2e-08
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    56   2e-08
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    58   2e-08
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    57   4e-08
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    57   5e-08
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    57   6e-08
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    55   9e-08
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    56   9e-08
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    56   9e-08
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    55   1e-07
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    56   1e-07
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    55   1e-07
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    55   2e-07
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    54   2e-07
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    55   2e-07
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    54   2e-07
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    54   2e-07
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    53   3e-07
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    54   3e-07
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    54   3e-07
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    54   4e-07
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    54   5e-07
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    54   6e-07
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    53   6e-07
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    53   7e-07
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    53   8e-07
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    53   8e-07
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    53   8e-07
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    53   8e-07
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      51   9e-07
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    52   9e-07
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    50   1e-06
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    53   1e-06
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    52   1e-06
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    52   1e-06
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    52   1e-06
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    49   1e-06
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    50   1e-06
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    52   2e-06
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    52   2e-06
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    51   2e-06
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    51   2e-06
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    51   3e-06
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    51   3e-06
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    51   3e-06
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    51   3e-06
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    49   4e-06
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    50   4e-06
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    50   4e-06
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    50   5e-06
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    50   5e-06
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    50   5e-06
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    50   6e-06
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    50   6e-06
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    50   6e-06
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    49   7e-06
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    50   7e-06
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    47   7e-06
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    48   7e-06
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    49   7e-06
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    50   7e-06
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    50   8e-06
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    49   8e-06
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    50   9e-06
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    50   9e-06
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    50   9e-06
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    49   1e-05
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    49   1e-05
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    50   1e-05
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    49   1e-05
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    49   1e-05
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    49   1e-05
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    49   1e-05
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    49   1e-05
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    47   1e-05
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    49   1e-05
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    49   1e-05
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    49   1e-05
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    49   1e-05
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    49   1e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      49   2e-05
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    49   2e-05
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    48   2e-05
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    48   2e-05
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    49   2e-05
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    49   2e-05
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    49   2e-05
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    48   2e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    48   2e-05
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    49   2e-05
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    49   2e-05
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    48   2e-05
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    49   3e-05
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    45   3e-05
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    48   3e-05
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    46   3e-05
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    48   3e-05
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    47   3e-05
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    48   3e-05
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    48   3e-05
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    47   3e-05
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    48   3e-05
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    48   3e-05
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    47   3e-05
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    46   3e-05
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    47   3e-05
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    47   4e-05
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    47   4e-05
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    47   4e-05
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    47   4e-05
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    47   5e-05
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    47   5e-05
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    48   5e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    47   5e-05
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    47   5e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    47   5e-05
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    47   5e-05
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    47   5e-05
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    45   5e-05
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    47   5e-05
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    46   5e-05
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    47   6e-05
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    45   6e-05
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    47   6e-05
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    46   7e-05
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    47   7e-05
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    46   7e-05
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    47   7e-05
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    47   7e-05
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    47   7e-05
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    47   8e-05
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    45   9e-05
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    46   9e-05
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    44   1e-04
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    47   1e-04
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    46   1e-04
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    46   1e-04
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    45   1e-04
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     46   1e-04
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    46   1e-04
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    46   1e-04
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       45   1e-04
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    45   1e-04
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    46   2e-04
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    46   2e-04
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    46   2e-04
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    45   2e-04
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    45   2e-04
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    45   2e-04
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    45   2e-04
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    45   2e-04
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    45   2e-04
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    45   2e-04
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    45   2e-04
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    45   2e-04
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    45   3e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    45   3e-04
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    44   3e-04
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    45   3e-04
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    43   3e-04
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    45   3e-04
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    43   3e-04
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    45   3e-04
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    44   3e-04
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    45   3e-04
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    45   3e-04
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    44   4e-04
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    45   4e-04
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    42   4e-04
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    44   4e-04
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    45   4e-04
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    45   4e-04
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    44   5e-04
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    43   5e-04
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    44   5e-04
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    44   5e-04
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    44   5e-04
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    44   6e-04
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    44   6e-04
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    42   6e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    44   7e-04
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    43   7e-04
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    43   7e-04
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    43   7e-04
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    43   7e-04
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    43   7e-04
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    42   7e-04
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    44   8e-04
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    42   8e-04
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    41   8e-04
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    42   8e-04
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    44   8e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     44   8e-04
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    43   8e-04
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    42   8e-04
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    44   9e-04
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    42   0.001
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    43   0.001
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    43   0.001
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    43   0.001
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    42   0.001
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    43   0.001
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    43   0.001
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    43   0.001
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    42   0.001
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    42   0.002
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    42   0.002
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    42   0.002
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    42   0.002
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    42   0.002
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    42   0.002
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    42   0.002
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    42   0.002
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    42   0.002
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    42   0.002
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    42   0.002
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    42   0.002
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    42   0.002
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    42   0.002
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    41   0.002
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    42   0.002
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    41   0.003
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    42   0.003
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    41   0.003
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    42   0.003
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    42   0.003
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    41   0.003
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    41   0.003
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    42   0.003
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    41   0.003
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    41   0.003
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    42   0.003
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    42   0.003
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    41   0.003
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    40   0.003
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    41   0.003
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    41   0.003
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    40   0.003
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    41   0.003
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    41   0.003
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    41   0.003
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    42   0.004
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    41   0.004
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    40   0.004
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    41   0.004
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    41   0.004
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    41   0.004
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    41   0.004
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    41   0.005
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    41   0.005
TBLA0B03120 Chr2 complement(729579..730898) [1320 bp, 439 aa] {O...    41   0.005
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    40   0.005
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    41   0.006
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    40   0.006
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    40   0.006
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    40   0.006
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    40   0.006
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    40   0.007
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      40   0.007
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    40   0.007
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    40   0.007
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    40   0.008
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    40   0.008
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    40   0.008
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    40   0.008
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    40   0.008
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    40   0.009
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    39   0.009
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    40   0.009
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    38   0.009
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    40   0.009
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    39   0.009
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    39   0.009
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    39   0.009
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    39   0.010
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    40   0.010
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    40   0.010
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    38   0.011
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    39   0.011
Smik_4.705 Chr4 (1249525..1250769) [1245 bp, 414 aa] {ON} YDR432...    40   0.011
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    39   0.013
KAFR0E03240 Chr5 complement(645818..646963) [1146 bp, 381 aa] {O...    39   0.014
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    39   0.015
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    39   0.015
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    39   0.016
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    39   0.016
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    39   0.017
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    39   0.017
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    39   0.018
KLTH0E04730g Chr5 (423242..424117) [876 bp, 291 aa] {ON} weakly ...    39   0.018
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    39   0.018
Skud_4.706 Chr4 (1249139..1250398) [1260 bp, 419 aa] {ON} YDR432...    39   0.018
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    39   0.020
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    39   0.021
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    39   0.021
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    38   0.021
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.021
TBLA0A07650 Chr1 (1894958..1897168) [2211 bp, 736 aa] {ON} Anc_7...    39   0.023
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    39   0.024
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    39   0.024
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    39   0.028
ZYRO0B02860g Chr2 (229241..231307) [2067 bp, 688 aa] {ON} weakly...    39   0.031
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    38   0.031
NDAI0H01670 Chr8 (404385..405596) [1212 bp, 403 aa] {ON} Anc_5.5...    38   0.032
Suva_2.67 Chr2 complement(120476..122566) [2091 bp, 696 aa] {ON}...    39   0.032
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    38   0.032
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    39   0.034
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    38   0.035
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    38   0.037
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    38   0.037
ZYRO0D15686g Chr4 complement(1313019..1314032) [1014 bp, 337 aa]...    38   0.037
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    38   0.039
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...    38   0.041
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    37   0.044
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    37   0.044
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    38   0.046
SAKL0G05258g Chr7 (432822..433937) [1116 bp, 371 aa] {ON} weakly...    38   0.047
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    37   0.047
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    38   0.052
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    38   0.055
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    37   0.055
NDAI0A01780 Chr1 complement(395250..397340) [2091 bp, 696 aa] {O...    38   0.055
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    37   0.058
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    37   0.058
NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.5...    37   0.062
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    37   0.064
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    37   0.064
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    37   0.067
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    37   0.067
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    37   0.072
YDR432W Chr4 (1328783..1330027) [1245 bp, 414 aa] {ON}  NPL3RNA-...    37   0.074
Skud_2.52 Chr2 complement(106486..108513) [2028 bp, 675 aa] {ON}...    37   0.075
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    37   0.075
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    36   0.081
SAKL0B09702g Chr2 (819107..820528) [1422 bp, 473 aa] {ON} simila...    37   0.081
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    35   0.081
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    37   0.085
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    37   0.097
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    37   0.098
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    37   0.10 
Smik_2.64 Chr2 complement(116553..118580) [2028 bp, 675 aa] {ON}...    37   0.11 
ZYRO0D12892g Chr4 (1087239..1088474) [1236 bp, 411 aa] {ON} weak...    37   0.11 
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    37   0.11 
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    37   0.12 
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    35   0.12 
TDEL0C01770 Chr3 complement(309215..311113) [1899 bp, 632 aa] {O...    37   0.12 
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    37   0.12 
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    37   0.12 
TPHA0C04450 Chr3 complement(964539..965540) [1002 bp, 333 aa] {O...    36   0.13 
Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}...    37   0.13 
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    35   0.13 
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    37   0.14 
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    35   0.14 
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    37   0.14 
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    36   0.15 
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    35   0.16 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    36   0.16 
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    36   0.17 
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    36   0.17 
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    36   0.17 
YPL178W Chr16 (212158..212784) [627 bp, 208 aa] {ON}  CBC2Small ...    35   0.17 
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    35   0.18 
YBL051C Chr2 complement(122753..124759) [2007 bp, 668 aa] {ON}  ...    36   0.18 
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    36   0.18 
Kwal_33.15208 s33 (1012397..1012957) [561 bp, 186 aa] {ON} YIR00...    35   0.19 
KLTH0G04114g Chr7 (328845..330074) [1230 bp, 409 aa] {ON} weakly...    36   0.19 
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    36   0.20 
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    35   0.21 
ADL064W Chr4 (567687..569627) [1941 bp, 646 aa] {ON} Syntenic ho...    36   0.22 
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    36   0.22 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    35   0.22 
NCAS0A14270 Chr1 (2808773..2810638) [1866 bp, 621 aa] {ON} Anc_7...    35   0.25 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    35   0.25 
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    35   0.27 
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    35   0.28 
TDEL0A04050 Chr1 (722870..724075) [1206 bp, 401 aa] {ON} Anc_5.5...    35   0.30 
KLTH0D13706g Chr4 complement(1117480..1118310) [831 bp, 276 aa] ...    35   0.32 
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    35   0.32 
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844      35   0.33 
ACR235W Chr3 (771971..773707) [1737 bp, 578 aa] {ON} Syntenic ho...    35   0.39 
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    34   0.41 
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    35   0.42 
SAKL0F11924g Chr6 (925625..927466) [1842 bp, 613 aa] {ON} some s...    35   0.47 
NCAS0D03580 Chr4 complement(665299..666036) [738 bp, 245 aa] {ON...    34   0.49 
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    34   0.58 
Smik_6.375 Chr6 complement(611206..611835) [630 bp, 209 aa] {ON}...    33   0.65 
KLTH0B04950g Chr2 (405537..407279) [1743 bp, 580 aa] {ON} some s...    34   0.68 
KNAG0B02500 Chr2 complement(487615..489711) [2097 bp, 698 aa] {O...    34   0.88 
Suva_16.131 Chr16 (221470..222099) [630 bp, 209 aa] {ON} YPL178W...    33   0.89 
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    33   0.94 
Kpol_1063.18 s1063 (40779..41780) [1002 bp, 333 aa] {ON} (40779....    33   1.0  
KAFR0G02950 Chr7 complement(614874..615782) [909 bp, 302 aa] {ON...    33   1.0  
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    33   1.1  
CAGL0A04213g Chr1 (416929..418848) [1920 bp, 639 aa] {ON} simila...    33   1.2  
AAR022W Chr1 (381754..382098) [345 bp, 114 aa] {ON} Syntenic hom...    32   1.3  
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...    33   1.3  
Kwal_33.14810 s33 complement(824910..826634) [1725 bp, 574 aa] {...    33   1.5  
Kpol_311.2 s311 (3859..4536) [678 bp, 225 aa] {ON} (3859..4536) ...    32   1.6  
KNAG0C03150 Chr3 complement(623367..624425) [1059 bp, 352 aa] {O...    33   1.6  
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    31   1.6  
YJR091C Chr10 complement(595061..598336) [3276 bp, 1091 aa] {ON}...    33   1.8  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    33   1.8  
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    32   2.0  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    33   2.0  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    32   2.1  
Ecym_4077 Chr4 (162858..163817) [960 bp, 319 aa] {ON} similar to...    32   2.2  
KNAG0G01000 Chr7 (209645..210040) [396 bp, 131 aa] {ON} Anc_7.14...    31   2.2  
TDEL0G01840 Chr7 (368805..369605) [801 bp, 266 aa] {ON} Anc_4.7 ...    32   2.3  
TDEL0H02590 Chr8 (431721..432521) [801 bp, 266 aa] {ON} Anc_7.18...    32   2.5  
TPHA0F00350 Chr6 (75008..77479) [2472 bp, 823 aa] {ON} Anc_4.33 ...    32   2.5  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    32   2.5  
TBLA0B03510 Chr2 complement(817181..818680) [1500 bp, 499 aa] {O...    32   2.5  
Kpol_1023.90 s1023 complement(213517..214764) [1248 bp, 415 aa] ...    32   2.6  
KAFR0L01600 Chr12 (289758..291470) [1713 bp, 570 aa] {ON} Anc_7....    32   2.6  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   2.7  
KLLA0A07997g Chr1 (711231..712958) [1728 bp, 575 aa] {ON} simila...    32   2.7  
Ecym_4705 Chr4 complement(1380408..1382237) [1830 bp, 609 aa] {O...    32   2.9  
Kwal_26.7525 s26 (403321..404499) [1179 bp, 392 aa] {ON} YGR156W...    32   3.1  
SAKL0F07326g Chr6 complement(560379..561308) [930 bp, 309 aa] {O...    32   3.1  
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    32   3.3  
NDAI0F04010 Chr6 (952954..954828) [1875 bp, 624 aa] {ON} Anc_1.1...    32   3.4  
TBLA0D01550 Chr4 complement(387300..388562) [1263 bp, 420 aa] {O...    32   3.5  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...    32   3.7  
Smik_12.12 Chr12 complement(31593..32339) [747 bp, 248 aa] {ON} ...    31   3.8  
Ecym_1261 Chr1 complement(536914..537255) [342 bp, 113 aa] {ON} ...    30   4.1  
NDAI0H02090 Chr8 complement(511903..512289) [387 bp, 128 aa] {ON...    30   5.6  
ZYRO0B06996g Chr2 complement(550779..551573) [795 bp, 264 aa] {O...    30   6.9  
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    30   7.0  
NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.5...    31   7.7  
NCAS0D00290 Chr4 complement(39189..41069) [1881 bp, 626 aa] {ON}...    31   7.8  
Kwal_23.5204 s23 complement(1060190..1061074) [885 bp, 294 aa] {...    30   7.8  
KLLA0D16049g Chr4 complement(1352380..1353657) [1278 bp, 425 aa]...    30   8.3  
TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {O...    30   8.8  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    31   9.1  
Ecym_3620 Chr3 (1186129..1186623) [495 bp, 164 aa] {ON} similar ...    30   9.5  
YGR156W Chr7 (800546..801823) [1278 bp, 425 aa] {ON}  PTI1Essent...    30   9.6  
NCAS0I00240 Chr9 complement(28632..30914) [2283 bp, 760 aa] {ON}...    30   9.6  

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/416 (74%), Positives = 310/416 (74%)

Query: 1   MSEEIKNXXXXXXXXXXXXXXXXSQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVL 60
           MSEEIKN                SQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVL
Sbjct: 1   MSEEIKNEVIETPEEVIEKPEEVSQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVL 60

Query: 61  YVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNG 120
           YVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNG
Sbjct: 61  YVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNG 120

Query: 121 VQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD 180
           VQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD
Sbjct: 121 VQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD 180

Query: 181 MQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKXXXXXXXXXXXXXXXX 240
           MQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK                
Sbjct: 181 MQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATKRERNMGNNFGNNRGSR 240

Query: 241 XXXXXPYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                PY                                                     
Sbjct: 241 GGNFRPYGNQGHHNRNNRNMMPPAMGMPMDGLMPMQQGQQNGQQPNVQQQQPMVPPPVNP 300

Query: 301 XAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 360
            AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH
Sbjct: 301 QAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 360

Query: 361 EQAAVCIVALANFPFQGRNLRTGWGKERTNFXXXXXXXXXXXXXXXDPSQAPPAPQ 416
           EQAAVCIVALANFPFQGRNLRTGWGKERTNF               DPSQAPPAPQ
Sbjct: 361 EQAAVCIVALANFPFQGRNLRTGWGKERTNFMPPQGAPGQQMPVMMDPSQAPPAPQ 416

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  306 bits (783), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 140/190 (73%), Positives = 169/190 (88%)

Query: 35  ENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK 94
           E  +++P+VVPASAT GGRETSDRVLYVGNLDKSI EDLLKQYFQ GG I +VKI+ D K
Sbjct: 64  EEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK 123

Query: 95  NEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLN 154
           N+ VNYAFVEY++SHDANVALQTLNG+Q+ENK +KINWAF++QQ   ++DTFNLFVGDLN
Sbjct: 124 NQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDLN 183

Query: 155 VDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSG 214
           +DVDDETL+  F+ FP++IQAHVMWDMQT RSRGYGFVSF+++++AQ AMD MQGK+++G
Sbjct: 184 IDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEING 243

Query: 215 RQIRINWATK 224
           R IRINWATK
Sbjct: 244 RPIRINWATK 253

 Score =  195 bits (496), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (97%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++DMIRRAPPRVTTAYIGNIPH+ATEADLIPLLQ FGFILDF+HYPEKGCCFIKYDTHE
Sbjct: 353 AVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTHE 412

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKERT F
Sbjct: 413 QAAVCIVALANFPFQGRNLRTGWGKERTTF 442

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  303 bits (777), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 139/191 (72%), Positives = 168/191 (87%)

Query: 34  QENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM 93
           Q  ++ + SVVPASAT+GGRETSDRVLYVGNLDKSI EDLLKQYFQ GG I +VKI+ D 
Sbjct: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 118

Query: 94  KNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL 153
           KN  VNYAF+EY++SHDANVALQTLNG+Q+E KT++INWAF++QQ   +DDTFNLFVGDL
Sbjct: 119 KNNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDL 178

Query: 154 NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS 213
           NVDVDDETL+  F +FP+++QAHVMWDMQTGRSRGYGFVSF++QE+AQ+AM+ MQG  ++
Sbjct: 179 NVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPIN 238

Query: 214 GRQIRINWATK 224
           GR +RINWATK
Sbjct: 239 GRAVRINWATK 249

 Score =  196 bits (498), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (97%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           AI+DMIRRAPPRVTTAYIGNIPH+ATEADLIPLLQNFGFILDF+HYPEKGCCFIKYDTHE
Sbjct: 312 AIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHE 371

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKER  F
Sbjct: 372 QAAVCIVALANFPFQGRNLRTGWGKERNTF 401

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  299 bits (765), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 165/198 (83%)

Query: 27  VEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQN 86
           VE +  + E   ++PSVVPA+A KGGRETSD+VLYVGNLD SI E++LKQYFQ GGPI N
Sbjct: 13  VESEVPASETISEEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIAN 72

Query: 87  VKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTF 146
           VKI+ D  N   NYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ + ++ TF
Sbjct: 73  VKIMVDKNNSNANYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATF 132

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           NLFVGDLNVDVDDETL   F+EFPT++Q HVMWDMQTG SRGYGFVSF +QEEAQKAMDA
Sbjct: 133 NLFVGDLNVDVDDETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDA 192

Query: 207 MQGKDLSGRQIRINWATK 224
           MQG +L+GR +RINWA+K
Sbjct: 193 MQGHELNGRPLRINWASK 210

 Score =  189 bits (481), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (96%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++ MIRRAPPRVTTAYIGNIPH+A EADLIPLLQNFGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 280 AVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 339

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKERT+F
Sbjct: 340 QAAVCIVALANFPFQGRNLRTGWGKERTSF 369

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  298 bits (762), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 173/199 (86%), Gaps = 2/199 (1%)

Query: 28  EGDNASQENDD--DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ 85
           E D   +EN++   +P VVPA+AT GGRETSDRVLYVGNLDKSITED+LKQYFQ  G I 
Sbjct: 47  EADVVPEENEEANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIV 106

Query: 86  NVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDT 145
           +VK++ D K+ YVNYAFVEY ++HDA+VALQTLNG+Q+EN  +KIN AF++QQ+  +D T
Sbjct: 107 DVKVMIDKKSNYVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDST 166

Query: 146 FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMD 205
           FNLFVGDLN+D+DD+TL+ +F++FP++IQAHVMWDMQTGRSRGYGFVSF++QE+AQKAM+
Sbjct: 167 FNLFVGDLNIDIDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAME 226

Query: 206 AMQGKDLSGRQIRINWATK 224
            MQGK+L+GR IRINWATK
Sbjct: 227 EMQGKELNGRPIRINWATK 245

 Score =  190 bits (483), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 87/90 (96%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++DMIRRAPPRV+TAYIGNIPH+ATEADLIPLLQ+FGFILDFTHYPEKGCCFIKYDTHE
Sbjct: 326 AVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTHE 385

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANF FQGRNLRTGWGKER  F
Sbjct: 386 QAAVCIVALANFNFQGRNLRTGWGKERNTF 415

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  295 bits (755), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 168/201 (83%), Gaps = 5/201 (2%)

Query: 24  SQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGP 83
           S E  GDN ++E+ +    VVPA+A +GGRETSD++LYVGNLDKSI ED LKQYFQ GGP
Sbjct: 53  SSEQTGDNDTEESAN----VVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGP 108

Query: 84  IQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAEND 143
           I NVKII D  N+Y NYAFVEY++ HDANVALQTLNG  +E K +KINWAF++QQ++ ND
Sbjct: 109 IANVKIIVDKNNKYCNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSS-ND 167

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           DTFNLF+GDLN+DV+DE+L   F++FP+F+QAHVMWDMQTGRSRGYGF SFS Q +AQ A
Sbjct: 168 DTFNLFIGDLNIDVNDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLA 227

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           MD MQGK+L+GR IRINWA+K
Sbjct: 228 MDQMQGKELNGRPIRINWASK 248

 Score =  179 bits (455), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 77/90 (85%), Positives = 84/90 (93%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+EDMIRRAPPRVTTAYIGN+P +ATEADLIPLLQNFGFILDF HYP++G CFIKYDTHE
Sbjct: 326 AVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHE 385

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFP QGRNL+TGWGKE+  F
Sbjct: 386 QAAVCIVALANFPLQGRNLKTGWGKEKPTF 415

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  292 bits (747), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 138/203 (67%), Positives = 173/203 (85%), Gaps = 3/203 (1%)

Query: 24  SQEVEGDNASQEND--DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAG 81
           S  VEG++   E++  ++ PSVVPA+A  GGRETSDRVLYVGNLDK+ITED+LKQYFQ G
Sbjct: 39  SVAVEGNSEQAEDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVG 98

Query: 82  GPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAE 141
           GPI N+KI+ D  N+ VNYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ++ 
Sbjct: 99  GPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS- 157

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           +DDTFNLFVGDLNV+VDDETL   F++FP+++  HVMWDMQTG SRGYGFVSF++Q++AQ
Sbjct: 158 SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 217

Query: 202 KAMDAMQGKDLSGRQIRINWATK 224
            AMD+MQG+DL+GR +RINWA K
Sbjct: 218 NAMDSMQGQDLNGRPLRINWAAK 240

 Score =  187 bits (476), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (95%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++ +IR APPRVTTAYIGNIPH+ATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHE
Sbjct: 328 AVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHE 387

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKER+NF
Sbjct: 388 QAAVCIVALANFPFQGRNLRTGWGKERSNF 417

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  292 bits (747), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 138/204 (67%), Positives = 171/204 (83%), Gaps = 5/204 (2%)

Query: 25  QEVEGDNASQENDDDK----PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQA 80
           Q V  +  S++ DD++    PSVVPA+A  GGRETSDRVLYVGNLDK+ITED+LKQYFQ 
Sbjct: 39  QNVSSEGNSEQVDDEQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQV 98

Query: 81  GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA 140
           GGPI N+KI+ D  N+ VNYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ++
Sbjct: 99  GGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQSS 158

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
             DDTFNLFVGDLNV+VDDETL   F++FP+++  HVMWDMQTG SRGYGFVSF++Q++A
Sbjct: 159 S-DDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 217

Query: 201 QKAMDAMQGKDLSGRQIRINWATK 224
           Q AMD+MQG+DL+GR +RINWA K
Sbjct: 218 QTAMDSMQGQDLNGRPLRINWAAK 241

 Score =  187 bits (475), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (95%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++ +IR APPRVTTAYIGNIPH+ATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHE
Sbjct: 330 AVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHE 389

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKER+NF
Sbjct: 390 QAAVCIVALANFPFQGRNLRTGWGKERSNF 419

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  291 bits (746), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 171/204 (83%), Gaps = 5/204 (2%)

Query: 25  QEVEGDNASQENDDDK----PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQA 80
           Q V G+  S + +DD+    PSVVPA+A  GGRETSDRVLYVGNLDK+ITED+LKQYFQ 
Sbjct: 38  QNVSGEVNSTQVEDDQGESDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQV 97

Query: 81  GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA 140
           GGPI N+KI+ D  N+ VNYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ++
Sbjct: 98  GGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS 157

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
            +DDTFNLFVGDLNV+VDDETL   F++FP+++  HVMWDMQTG SRGYGFVSF++Q++A
Sbjct: 158 -SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 216

Query: 201 QKAMDAMQGKDLSGRQIRINWATK 224
           Q AMD MQG+DL+GR +RINWA K
Sbjct: 217 QTAMDTMQGQDLNGRPLRINWAAK 240

 Score =  187 bits (475), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (95%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++ +IR APPRVTTAYIGNIPH+ATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHE
Sbjct: 334 AVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHE 393

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKER+NF
Sbjct: 394 QAAVCIVALANFPFQGRNLRTGWGKERSNF 423

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  291 bits (746), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 174/204 (85%), Gaps = 5/204 (2%)

Query: 25  QEVEGDNASQENDDDK----PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQA 80
           Q V G++ S++ +D++    PSVVPA+A  GGRETSD+VLYVGNLDK+ITED+LKQYFQ 
Sbjct: 36  QAVSGESNSEQVEDNQGENDPSVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQV 95

Query: 81  GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA 140
           GGPI N+KI+ D  N+ VNYAFVEY +SHDAN+ALQTLNG Q+EN  +KINWAF++QQ++
Sbjct: 96  GGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS 155

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
            +DDTFNLFVGDLNV+VDDETL   F++FP+++  HVMWDMQTG SRGYGFVSF++Q++A
Sbjct: 156 -SDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDA 214

Query: 201 QKAMDAMQGKDLSGRQIRINWATK 224
           Q AMD+MQG+DL+GR +RINWA K
Sbjct: 215 QTAMDSMQGQDLNGRPLRINWAAK 238

 Score =  187 bits (476), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (95%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++ +IR APPRVTTAYIGNIPH+ATEADLIPL QNFGFILDF HYPEKGCCFIKYDTHE
Sbjct: 328 AVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHE 387

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANFPFQGRNLRTGWGKER+NF
Sbjct: 388 QAAVCIVALANFPFQGRNLRTGWGKERSNF 417

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  287 bits (735), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 133/183 (72%), Positives = 158/183 (86%), Gaps = 1/183 (0%)

Query: 42  SVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYA 101
           S+VPA+A  GGRETSD++LYVGNLDKSI ED+LKQYFQ GGPI NVK+I D  NE  NYA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNNE-ANYA 119

Query: 102 FVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDET 161
           FVEY + HDA++AL+TLNG Q+EN TLKINWAF++QQ   +D+TFNLF+GDLNVDVDDET
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 162 LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
           L   F++F +FIQAHVMWDMQTGRSRGYGFVSFSN ++AQ AMD MQG +L+GRQ+RINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 222 ATK 224
           A+K
Sbjct: 240 ASK 242

 Score =  179 bits (454), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 84/90 (93%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++DMIRRAP RVTT YIGNIPH+ATEADLIPLLQNFGFILDF HYPEKG CFIKYDTHE
Sbjct: 311 AVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHE 370

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIV LANFPFQGRNL+TGWGKE++ F
Sbjct: 371 QAAVCIVVLANFPFQGRNLKTGWGKEKSTF 400

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  285 bits (728), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 157/182 (86%)

Query: 43  VVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAF 102
           VVPA+ATKGGRETSDRVLYVGNLDKSITE++L+QYFQ GG I NVK++ D  N   NYAF
Sbjct: 41  VVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNARANYAF 100

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETL 162
           VEY +SHDAN+ALQTLNG Q+EN  ++INWAF++QQA  +++T+NLFVGDL+VDVDDETL
Sbjct: 101 VEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLFVGDLSVDVDDETL 160

Query: 163 AGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              FR FP+FIQ HVMWDMQTG SRGYGFVSF +QE+AQ AMD+MQ ++L+GR +RINWA
Sbjct: 161 CNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQSQELNGRPLRINWA 220

Query: 223 TK 224
           +K
Sbjct: 221 SK 222

 Score =  184 bits (466), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 86/90 (95%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+E MIRRAPPRVTT+YIGNIPH+AT++DLIPLLQNFGFILDF HYPEKGCCF+KYDTHE
Sbjct: 299 AVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHE 358

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVALANF FQGRNLRTGWGKERT F
Sbjct: 359 QAAVCIVALANFFFQGRNLRTGWGKERTTF 388

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  281 bits (719), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (83%), Gaps = 1/181 (0%)

Query: 44  VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFV 103
            P  ATKGGRETSDR+LYVGNLDK+I E  LKQYFQ GGPI NVK++ D  NE  NYAFV
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 104 EYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLA 163
           EY +  DANVA QTL+G Q+EN  +KINWAF++QQ + +DDTFNLFVGDLNVDVDDETL+
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVS-SDDTFNLFVGDLNVDVDDETLS 139

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            TF+EFPTFIQAHVMWDMQ+GRSRGYGFVSF  QEEAQKAMDA QG +L+GR IR+NWA 
Sbjct: 140 STFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAA 199

Query: 224 K 224
           K
Sbjct: 200 K 200

 Score =  172 bits (437), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 82/90 (91%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+E MIRRAP RVTTAYIGNIPH+A E DLIPLLQNFGFI+DF HY EKGCCFIKYDTH+
Sbjct: 258 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHD 317

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAA+CIVALANFPFQGR LRTGWGKE+ +F
Sbjct: 318 QAALCIVALANFPFQGRTLRTGWGKEKPSF 347

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  283 bits (723), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 132/187 (70%), Positives = 154/187 (82%), Gaps = 1/187 (0%)

Query: 38  DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY 97
           +D   VVPA+A  GGRETSD++LYVGNLDKSI E+ LKQYFQ GGPI NVK+I D KN  
Sbjct: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNS 117

Query: 98  VNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDV 157
           VNYAFVEY++ HDA+VA + LNG  +E K LKINWAF++QQ   ++  FNLFVGDLNVDV
Sbjct: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDV 177

Query: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           DDETL   F EFP+F+QAHVMWDMQTGRSRGYGF+SFSNQE+AQ AMD MQ  +L+GRQI
Sbjct: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237

Query: 218 RINWATK 224
           RINWA+K
Sbjct: 238 RINWASK 244

 Score =  174 bits (442), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A++DMIRRAP RVTT YIGNIPH+ATEADLIPLLQNFGFILDF +YPEKG CFIKYDTHE
Sbjct: 312 AVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHE 371

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIV LAN+PFQGRNL+TGWGKE+  F
Sbjct: 372 QAAVCIVVLANYPFQGRNLKTGWGKEKAVF 401

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQTL 118
           L+VG+L+  + ++ L   F          ++ DM+      Y F+ +    DA  A+  +
Sbjct: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227

Query: 119 NGVQLENKTLKINWAFETQQA 139
              +L  + ++INWA + + A
Sbjct: 228 QSTELNGRQIRINWASKRENA 248

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  278 bits (711), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 132/186 (70%), Positives = 154/186 (82%), Gaps = 1/186 (0%)

Query: 39  DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV 98
           D+  V P  ATKGGRETSDR+LYVGNLDK+I ED LKQYFQ GGPI NVK++ D  NE  
Sbjct: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103

Query: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVD 158
           NYAFVEY + HDANVA QTL+G Q+E   +KINWAF++Q  + +DDTFNLFVGDLNVDVD
Sbjct: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVS-SDDTFNLFVGDLNVDVD 162

Query: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR 218
           DETL GTF+EFP+FIQAHVMWDM +GRSRGYGFVSFS Q+ AQ+AM++ QG  L+GR IR
Sbjct: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222

Query: 219 INWATK 224
           INWA+K
Sbjct: 223 INWASK 228

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 78/88 (88%), Positives = 81/88 (92%)

Query: 304 EDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQA 363
           E MIRRAP RVTTAYIGNIPH+A E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQA
Sbjct: 303 EAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 362

Query: 364 AVCIVALANFPFQGRNLRTGWGKERTNF 391
           AVCIVALANFPFQGRNLRTGWGKE+  F
Sbjct: 363 AVCIVALANFPFQGRNLRTGWGKEKPAF 390

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  277 bits (709), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 129/187 (68%), Positives = 155/187 (82%), Gaps = 1/187 (0%)

Query: 38  DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY 97
           +++P + PA+  +GGRETSD++LYVGNLDKSITEDLLKQYFQ GGP+ NVKI+ D  N+ 
Sbjct: 24  EEQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKNNQE 83

Query: 98  VNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDV 157
            NYAFVEY + HDANVA QTL+G  +EN  +KINWAF++ Q A +D++FNLFVGDLNVDV
Sbjct: 84  ANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVA-SDESFNLFVGDLNVDV 142

Query: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           DDETLA  F EF  FIQAHVMWDMQ+GRSRGYGFVSF  QE+AQKAM+  QG +L+GR I
Sbjct: 143 DDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNGRAI 202

Query: 218 RINWATK 224
           RINWA+K
Sbjct: 203 RINWASK 209

 Score =  182 bits (463), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 79/88 (89%), Positives = 83/88 (94%)

Query: 304 EDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQA 363
           E MIRRAPPR+TTAYIGNIPH+ATE DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQA
Sbjct: 287 EAMIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQA 346

Query: 364 AVCIVALANFPFQGRNLRTGWGKERTNF 391
           AVCIVALANFPFQGRNLRTGWGKE+  F
Sbjct: 347 AVCIVALANFPFQGRNLRTGWGKEKPTF 374

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  276 bits (707), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 128/186 (68%), Positives = 158/186 (84%), Gaps = 1/186 (0%)

Query: 39  DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV 98
           ++P+V PA+A++GGRETSDR+LYVGNLD ++TE++LKQYFQ GG I NVKI+ D  N+  
Sbjct: 48  EEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDKNNKQA 107

Query: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVD 158
           NYAFVE+ + HDANVA QTL+G Q+EN  +KINWAF++QQ + ++DTFNLFVGDLNVDVD
Sbjct: 108 NYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVS-SEDTFNLFVGDLNVDVD 166

Query: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR 218
           DETLA TF++ PTFIQAHVMWDMQTGRSRGYGFVSF  Q +AQKAM+  QG  ++GR IR
Sbjct: 167 DETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVVNGRAIR 226

Query: 219 INWATK 224
           INWA+K
Sbjct: 227 INWASK 232

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 71/90 (78%), Positives = 81/90 (90%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+E M+R APPRVTT YIGNIPH+ATE DLIPLLQNFGFI+DF HYP++GCCFIKY THE
Sbjct: 308 AVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHE 367

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCI+ L NFPFQGRNLRTGWGKE+ ++
Sbjct: 368 QAAVCILTLGNFPFQGRNLRTGWGKEKPSY 397

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 37/97 (38%), Gaps = 7/97 (7%)

Query: 41  PSVVPASATKGGRETSDRV--LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV 98
           P V P +     R    RV  +Y+GN+    TE  L    Q  G I + K   D      
Sbjct: 302 PQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDR----- 356

Query: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFE 135
              F++Y     A V + TL     + + L+  W  E
Sbjct: 357 GCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKE 393

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  276 bits (706), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 136/228 (59%), Positives = 167/228 (73%), Gaps = 5/228 (2%)

Query: 1   MSEEIKNXXXXXXXXXXXXXXXXSQEVEGDNASQE----NDDDKPSVVPASATKGGRETS 56
           M+EE                   S + E +  SQE        +P+V PA+AT+GGRETS
Sbjct: 1   MAEETPETRPEQPEIAEQQGTAGSSQTEAEQPSQEPQTAGKAAEPAVTPANATRGGRETS 60

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           DR+LYVGNLD ++TED+LKQYFQ GG I NVKI+ D  N+  NYAFVE+ + HDA+VA Q
Sbjct: 61  DRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQ 120

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
           TL+G Q+EN  +KIN+AF++QQ + ++DTFNLFVGDLNVDVDDETLA TF+  PTFIQAH
Sbjct: 121 TLDGKQIENHVIKINYAFQSQQVS-SEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAH 179

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           VMWDMQTGRSRGYGFVSF  Q +AQKAM+  QG  ++GR IRINWA+K
Sbjct: 180 VMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

 Score =  168 bits (426), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 70/90 (77%), Positives = 79/90 (87%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           AIE MIR AP RVTT YIGNIPH+A+E DLIPLLQNFGFI+DF HYP++GCCFIKY THE
Sbjct: 311 AIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHE 370

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAA+CI+ L NFPFQGRNLRTGWGKE+  +
Sbjct: 371 QAAICILTLGNFPFQGRNLRTGWGKEKPTY 400

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  272 bits (695), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 150/183 (81%)

Query: 42  SVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYA 101
           +V+PASA +GGRETSD+VLY+GNLDKSI ED LKQYFQ  G I +VK++ D KN +VNYA
Sbjct: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYA 74

Query: 102 FVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDET 161
           F+EY  +HDANVALQTLNG+Q+ENK +KINWAF++Q    +D +FNLF+GDLNV+VDD T
Sbjct: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134

Query: 162 LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
           LA  F+  P F+QAHVMWDMQT RSRGYGFVSF   E AQ AMD MQG +++GR IRINW
Sbjct: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194

Query: 222 ATK 224
           ATK
Sbjct: 195 ATK 197

 Score =  191 bits (485), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (96%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+EDMIRRAPPRVTTAYIGNIPH+ATE DLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE
Sbjct: 247 AVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 306

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAAVCIVAL+NF FQGRNLRTGWGKER+ F
Sbjct: 307 QAAVCIVALSNFQFQGRNLRTGWGKERSTF 336

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 350 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 388
           +G  F+ +DTHE A   +  +      GR +R  W  +R
Sbjct: 160 RGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 318 YIGNIPHYATEADLIPLLQNFGFILDFTHYPEK-----GCCFIKYDTHEQAAVCIVALAN 372
           YIGN+     E  L    Q  G I+D     +K        FI+Y T+  A V +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 373 FPFQGRNLRTGWG-KERTNF 391
              + +N++  W  + +TN 
Sbjct: 94  IQIENKNIKINWAFQSQTNL 113

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  274 bits (701), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 130/197 (65%), Positives = 158/197 (80%), Gaps = 1/197 (0%)

Query: 28  EGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNV 87
           +G+   +E D++  S  P  AT+GGRE SD++LYVGNL KSI +DLLKQYFQ GG I +V
Sbjct: 67  DGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSV 126

Query: 88  KIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFN 147
           KII D  ++  NYAFVEY   HDANVA QTLNG ++E K LKINWAF++QQ   +D+TFN
Sbjct: 127 KIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQ-VNSDETFN 185

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVGDLNVDVDD TLAGTF+EFP+FIQAHVMWDMQ+GRSRGYGFVSF  Q++AQ AM+  
Sbjct: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245

Query: 208 QGKDLSGRQIRINWATK 224
           QG +L+GR +RINWA+K
Sbjct: 246 QGFELNGRALRINWASK 262

 Score =  184 bits (466), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 84/90 (93%)

Query: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361
           A+EDM+RRAPPRVTTAYIGNIPH+A E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 346 AVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 405

Query: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNF 391
           QAA+CIVAL NFPFQGRNLRTGWGKE+  F
Sbjct: 406 QAALCIVALTNFPFQGRNLRTGWGKEKPTF 435

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 102/192 (53%), Gaps = 6/192 (3%)

Query: 32  ASQENDDDKPSVVPASATKGGRETS---DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVK 88
           ASQE      +   +SA+ GG   +      LYVG LD S++E LL   F   GP+ +++
Sbjct: 22  ASQEESSSGSAAEVSSASNGGNSGTAVDSASLYVGELDPSVSEALLYDIFSPIGPVSSIR 81

Query: 89  IIED-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFN 147
           +  D +    + YA+V +       VA++ LN   ++ K  +I W+ +   +   + + N
Sbjct: 82  VCRDAVTKTSLGYAYVNFNDHDSGKVAIEKLNYTPIKGKPCRIMWS-QRDPSMRKNGSGN 140

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+ +L+ D+D++ L  TF  F   +   +  D +TG+S+G+GFV F     A +A+DA+
Sbjct: 141 IFIKNLHADIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDTAASEAIDAI 199

Query: 208 QGKDLSGRQIRI 219
            G  L+G ++ +
Sbjct: 200 NGMMLNGLEVYV 211

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 92/180 (51%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   TE+  ++ F+  GPI ++ + +D + ++  + FV Y     A  A+  LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
            ++ +++ L +  A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM + +TG+S+G+GFV FS+ EEA +A+     + ++G+ + +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D+ +L+VG+L+  V +  L   F          V  D  T  S GY +V+F++ +  + A
Sbjct: 49  DSASLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVA 108

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           ++ +    + G+  RI W+ +
Sbjct: 109 IEKLNYTPIKGKPCRIMWSQR 129

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 101/195 (51%), Gaps = 4/195 (2%)

Query: 26  EVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ 85
           E EG  A+ E +   P+     A     +T+   LYVG LD S++E LL   F   GP+ 
Sbjct: 19  ETEGAPAASETEG-TPAASETEANNSNVDTTSASLYVGELDPSVSEALLYDIFSPIGPVT 77

Query: 86  NVKIIED-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD 144
           ++++  D +    + YA+V +        A++ LN   ++ K  +I W+ +   A     
Sbjct: 78  SIRVCRDAITKTSLGYAYVNFNDHESGRTAIEKLNYSPIKGKPCRIMWS-QRDPALRKKG 136

Query: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204
             N+F+ +L+ D+D++ L  TF  F   +   +  D +TG+S+G+GFV F     A +A+
Sbjct: 137 AGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDNAAVEAV 195

Query: 205 DAMQGKDLSGRQIRI 219
           DA+ G  L+GR++ +
Sbjct: 196 DAINGMMLNGREVYV 210

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D    ED     F   GPI ++ + +D + ++  + F+ +    DA  A++ LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 120 GVQLENKTLKINWA---------FETQQAAENDDTF------NLFVGDLNVDVDDETLAG 164
            ++ + + L +  A          + Q  A   +        NLFV +L+  +DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F +   A VM + + G+S+ +GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 79/170 (46%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL   I    L   F   G I + KI  D   +   + FV +   + A  A+  +N
Sbjct: 140 IFIKNLHPDIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDNAAVEAVDAIN 199

Query: 120 GVQLENKTLKINWAF-----ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + + +         E++      +  N++V +++VD  ++     F ++   I 
Sbjct: 200 GMMLNGREVYVAQHVSKKDRESKLEEVKANFTNVYVKNVDVDTPEDEFTALFSKYGP-IT 258

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +  M     G+ RG+GF++F N ++A KA++ +   +  G+++ +  A K
Sbjct: 259 SIAMEKDSEGKFRGFGFINFENHDDAAKAVEELNDLEFKGQKLYVGRAQK 308

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 133 AFETQQAAENDDTFN--LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYG 190
           A ET+    N DT +  L+VG+L+  V +  L   F          V  D  T  S GY 
Sbjct: 35  ASETEANNSNVDTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYA 94

Query: 191 FVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +V+F++ E  + A++ +    + G+  RI W+ +
Sbjct: 95  YVNFNDHESGRTAIEKLNYSPIKGKPCRIMWSQR 128

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 106/181 (58%), Gaps = 14/181 (7%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIED---MKNEYVNYAFVEYIR 107
           G ET+   LY+G+LD S TE+ +KQ +   G P   VK+I++   M N    Y FVE+  
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEPNVQVKLIKNSGPMNNS--GYCFVEFPS 104

Query: 108 SHDA-NVALQTLNGVQLE-NKTLKINWA-FETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
           +  A N  L+T   + ++ +++LK+NWA F T    E    F++FVGDL  +V +  L  
Sbjct: 105 NLSATNALLKTGLPIPVDPSRSLKLNWASFATAPGTE----FSIFVGDLAPNVSESQLFE 160

Query: 165 TF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            F   + + + A +++D  TG S+GYGFV F N+ E Q+++  MQG  L+GR IR++  +
Sbjct: 161 LFISRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTS 220

Query: 224 K 224
           K
Sbjct: 221 K 221

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 283 PNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQ 342

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 343 GFPIGNSRIRLSWGRS 358

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TE+ L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 339

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNL 148
            + G  + N  ++++W    +QAA     F +
Sbjct: 340 KMQGFPIGNSRIRLSWGRSAKQAAGMQQVFAM 371

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V +E L   F+ F   +   +         +G GFV + ++  A+ A+  M
Sbjct: 288 VFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVG------KGCGFVQYVDRSSAENAIAKM 341

Query: 208 QGKDLSGRQIRINWA 222
           QG  +   +IR++W 
Sbjct: 342 QGFPIGNSRIRLSWG 356

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 103/187 (55%), Gaps = 7/187 (3%)

Query: 38  DDKPSVVPAS----ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED- 92
           D++P+  PA+    A     E     LYVG LD S++E LL   F   G + ++++  D 
Sbjct: 19  DEQPAATPATTAIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDA 78

Query: 93  MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGD 152
           +    + YA+V +        A++ LN   ++ +  +I W+ +   +     + N+F+ +
Sbjct: 79  ITKTSLGYAYVNFNDHEAGKTAIEKLNYTAIKGRPCRIMWS-QRDPSMRKKGSGNIFIKN 137

Query: 153 LNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL 212
           L+ D+D++TL  TF  F   +   +  D +TG+S+G+GFV F N+E A++A+DA+ G  L
Sbjct: 138 LHPDIDNKTLYETFSVFGNILSCKIAND-ETGKSKGFGFVHFENEEAAREAIDAINGMLL 196

Query: 213 SGRQIRI 219
           +G+++ +
Sbjct: 197 NGQEVYV 203

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 89/180 (49%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV NLD   TE+  +  F+  G I +V + +D + +   + FV++    DA  A++ LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
             + + +TL +  A   +E  Q  +                 NLF+ +L+  +DDE L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T   A VM   + G+S+G+GFV FS  EEA +A+     + ++G+ + +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 78/170 (45%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL   I    L + F   G I + KI  D   +   + FV +     A  A+  +N
Sbjct: 133 IFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAREAIDAIN 192

Query: 120 GVQLENKTLKINWAFETQQAAENDDT-----FNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + + +      +      D       N++V +L+++  +E     F+ + T   
Sbjct: 193 GMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFKPYGTITS 252

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             +  D + G+SRG+GFV F N E+A KA++A+   +  G+ + +  A K
Sbjct: 253 VALEKDAE-GKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQK 301

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%)

Query: 133 AFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFV 192
           A E +     + T +L+VG+L+  V +  L   F    +     V  D  T  S GY +V
Sbjct: 30  AIEAESPNVENVTASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYV 89

Query: 193 SFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +F++ E  + A++ +    + GR  RI W+ +
Sbjct: 90  NFNDHEAGKTAIEKLNYTAIKGRPCRIMWSQR 121

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 104/181 (57%), Gaps = 12/181 (6%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNE----YVNYAFVEYI 106
           G ++ +  LY+G+LD S  E++++  + + G     +K++ + +N     ++ Y FV++ 
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGESNVEIKLMWNNRNAGVRTHLGYCFVQFS 101

Query: 107 -RSHDANVALQTLNGVQLE---NKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETL 162
            RS  +N  L+  NG+ +    +KTL++NW+  +  +A+  +  ++FVGDL  +V +  L
Sbjct: 102 SRSQASNALLK--NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDL 159

Query: 163 AGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
              F  + P+   A VM+D  TG S+GY FV F NQE+ Q+A+  M G  L GR IR+  
Sbjct: 160 FELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGS 219

Query: 222 A 222
           A
Sbjct: 220 A 220

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPE-KGCCFIKYDTHEQAAVCIVALANF 373
           TT ++ ++ H  TE +L    Q FG ++ +   PE K C F++Y     A + I+ L  F
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVI-YAKLPENKQCGFVQYVDRASAEMAILKLQGF 337

Query: 374 PFQGRNLRTGWGK 386
           P +G  ++  WG+
Sbjct: 338 PIRGSRIKISWGR 350

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 88/226 (38%), Gaps = 55/226 (24%)

Query: 46  ASATKGGRETSDRV-LYVGNLDKSITEDLLKQYFQAGGP-IQNVKIIED-MKNEYVNYAF 102
           +SA+    + S+ + ++VG+L  ++TE  L + F +  P   N K++ D +      YAF
Sbjct: 130 SSASGNSADGSNEISVFVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAF 189

Query: 103 VEYIRSHDANVALQTL-----------------------NGVQLENKTLKINWAFETQQA 139
           V +    D   ALQ +                       NG  LENK   +N    + + 
Sbjct: 190 VRFGNQEDQQRALQEMTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLKGLNATVSSPKP 249

Query: 140 AENDDT-----------------------FNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
           A    T                         LFV  L+  V +  L   F+ F   I A 
Sbjct: 250 ANISSTNFSQFILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAK 309

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           +  + Q G      FV + ++  A+ A+  +QG  + G +I+I+W 
Sbjct: 310 LPENKQCG------FVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 99/177 (55%), Gaps = 6/177 (3%)

Query: 44  VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAF 102
            P+SAT    E S   LYVG+LD S++E LL   F   G + ++++  D +    + YA+
Sbjct: 29  TPSSATT---ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAY 85

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETL 162
           V +        A++ LN   ++ +  +I W+ +   A     + N+F+ +L+ D+D++ L
Sbjct: 86  VNFNDHEAGKKAIEKLNYTPIKGRLCRIMWS-QRDPALRKKGSANIFIKNLHSDIDNKAL 144

Query: 163 AGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
             TF  F   + + +  D +TG+S+G+GFV F +   A++A+DA+ G  L+G++I +
Sbjct: 145 YDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQEIFV 200

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N++   T++   + F   G + +  + +    +   + FV++    DA  A++ LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
           G Q +++ L ++ A   +E  Q  +                 NLF+ +L+  +DDE L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  +       VM   + G+SRG+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D   +   + FV +     A 
Sbjct: 123 RKKGSANIFIKNLHSDIDNKALYDTFSVFGNILSSKIATDETGKSKGFGFVHFEDDTAAK 182

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +      +    Q  E+   F N++V ++N++  DE     F 
Sbjct: 183 EAIDALNGMLLNGQEIFVGPHLSRKERDSQLEESKANFTNIYVKNINLETTDEEFTELFS 242

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           ++   + A  +   + G+ +G+GFV F N E+A KA++ + G     +++ ++ A K
Sbjct: 243 KYGKVLSA-ALEKTEDGKLKGFGFVDFENHEDAAKAVEELNGSQFKDQELFVSRAQK 298

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%)

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQE 198
           A   + + +L+VGDL+  V +  L   F    +     V  D  T  S GY +V+F++ E
Sbjct: 33  ATTENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHE 92

Query: 199 EAQKAMDAMQGKDLSGRQIRINWATK 224
             +KA++ +    + GR  RI W+ +
Sbjct: 93  AGKKAIEKLNYTPIKGRLCRIMWSQR 118

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 99/189 (52%), Gaps = 4/189 (2%)

Query: 34  QENDDDKPSVVPASATKGGR--ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIE 91
           Q N  + P   P S     +  ETS   LYVG LD +++E LL   F   G + ++++  
Sbjct: 14  QLNLQEAPQTAPTSTDSDSQKVETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCR 73

Query: 92  D-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFV 150
           D +    + YA+V +        A++ LN   ++ +  +I W+ +   +     + N+F+
Sbjct: 74  DAITKTSLGYAYVNFNDYEAGRQAIEKLNYTPIKGQPCRIMWS-QRDPSLRKKGSGNIFI 132

Query: 151 GDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK 210
            +L+ D+D++ L  TF  F   +   +  D  TG S+G+GFV F + E A++A+DA+ G 
Sbjct: 133 KNLHADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGM 192

Query: 211 DLSGRQIRI 219
            L+G+++ +
Sbjct: 193 LLNGQEVYV 201

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 86/180 (47%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +Y+ N+     E   +++F+   P+ +V + +D + +   + FV Y     A  A++ LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 120 GVQLENKTLKINWA---FETQQ------------AAENDDTFNLFVGDLNVDVDDETLAG 164
           GV+   + L +  A   +E QQ              E     NLF+ +L+  +DDE L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 77/171 (45%), Gaps = 7/171 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++ NL   I    L   F   G I + KI  D +      + FV +     A  A+  +
Sbjct: 130 IFIKNLHADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAI 189

Query: 119 NGVQLENKTL----KINWAFETQQAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFI 173
           NG+ L  + +     ++      +  E    F N+++ +++++  ++     F++     
Sbjct: 190 NGMLLNGQEVYVAPHVSRKDRQSKLEEAKANFTNVYIKNISLETPEQEFEEFFKKVAPVT 249

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             H+  D + G+ RG+GFV++     A KA++ + G +  G+Q+ +  A K
Sbjct: 250 SVHLEKDSE-GKLRGFGFVNYETHAGAAKAVEELNGVEFHGQQLHVGRAQK 299

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%)

Query: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204
           T +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F++ E  ++A+
Sbjct: 39  TASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGRQAI 98

Query: 205 DAMQGKDLSGRQIRINWATK 224
           + +    + G+  RI W+ +
Sbjct: 99  EKLNYTPIKGQPCRIMWSQR 118

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 103/179 (57%), Gaps = 10/179 (5%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNE-YVNYAFVEYIRSH 109
           G +TS   LY+G+LD S TE  +KQ +   G     VK+I++        Y FVE+  + 
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNL 105

Query: 110 DA-NVALQTLNGVQLE-NKTLKINWA-FETQQAAENDDTFNLFVGDLNVDVDDETLAGTF 166
            A N  L+T   + ++ ++TLK+NWA F T   +E    F++FVGDL  +V +  L   F
Sbjct: 106 AATNALLKTGLPIPVDASRTLKLNWASFATTPGSE----FSIFVGDLAPNVTESQLFELF 161

Query: 167 -REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
              + + + A +++D  TG S+GYGFV F N+ E Q+++  MQG  L+GR IR++  +K
Sbjct: 162 ISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSK 220

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVA 369
           A P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 370 LANFPFQGRNLRTGWGKE 387
           +  FP     +R  WG+ 
Sbjct: 337 MQGFPIGNSRVRLSWGRS 354

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 335

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +Q A
Sbjct: 336 KMQGFPIGNSRVRLSWGRSAKQTA 359

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 138 QAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           Q A+ ++T  +F+G L+  V ++ L   F+ F   +   +         +G GFV + ++
Sbjct: 275 QFADPNNT-TVFIGGLSSLVTEDELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDR 327

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWA 222
             A+ A+  MQG  +   ++R++W 
Sbjct: 328 SSAENAIAKMQGFPIGNSRVRLSWG 352

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 100/186 (53%), Gaps = 5/186 (2%)

Query: 37  DDDKPSVVPASATKGGR--ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-M 93
           D+ + +V PAS     +  ETS   LYVG LD S++E LL   F   G + ++++  D +
Sbjct: 19  DEPQQNVAPASNEPESQKVETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAI 78

Query: 94  KNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL 153
               + YA+V +        A++ LN   ++    +I W+ +   +     + N+F+ +L
Sbjct: 79  TKTSLGYAYVNFNDHEAGKTAIEKLNYAPIKGVPCRIMWS-QRDPSMRKKGSGNIFIKNL 137

Query: 154 NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS 213
           + D+D++ L  TF  F   +   +  D + G SRG+GFV F + E A++A+DA+ G  L+
Sbjct: 138 HPDIDNKALHDTFSVFGNILSCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLN 196

Query: 214 GRQIRI 219
           G+++ +
Sbjct: 197 GQEVYV 202

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+     ++  +++F   GPI +  + +D + +   + FV Y   +DA  A++ LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 120 GVQLENKTLKINWAFETQ---------------QAAENDDTFNLFVGDLNVDVDDETLAG 164
               + +TL +  A +                 +  E     NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  + T     VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 75/177 (42%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D       + FV +     A 
Sbjct: 125 RKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATDEAGNSRGFGFVHFEDDEAAK 184

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDT-----FNLFVGDLNVDVDDETLAGTFR 167
            A+  +NG+ L  + + +      +      D       N++V +++ D  DE     F 
Sbjct: 185 EAIDAINGMLLNGQEVYVAQHVSKKDRQSKLDEAKANFTNVYVKNIHPDTGDEEFEEFFT 244

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +      AH+  D + G+ RG+GFV++ N  +A KA++ +   D  G+ + +  A K
Sbjct: 245 KVGPITSAHLEKDNE-GKLRGFGFVNYENHNDAAKAVEELNETDFKGQTLHVGRAQK 300

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F++ E  + A++ 
Sbjct: 43  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEK 102

Query: 207 MQGKDLSGRQIRINWATK 224
           +    + G   RI W+ +
Sbjct: 103 LNYAPIKGVPCRIMWSQR 120

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           E ++  LYVG LD +ITE LL   F   GPI ++++  D +    + YA+V Y       
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A+Q LN  ++  +  +I W+ E   A     + N+F+ +L+  +D++ L  TF  F   
Sbjct: 106 KAIQELNYAEINGRPCRIMWS-ERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEV 164

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +   V  D + G SRG+GFV F  + +A+ A++A+ G  ++G ++ +
Sbjct: 165 LSCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 90/180 (50%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   T++  +Q F   G I +  + +D + +   + FV ++  + A  A++ LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 120 GVQLENKTLKINWAFETQQAAENDDT---------------FNLFVGDLNVDVDDETLAG 164
           G + +++ L +  A +  + AE                    NLF+ +L+  +DDE L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  + T   A VM D Q G S+G+GFV FS+ EEA KAM     + ++G+ + +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 82/177 (46%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL  +I    L + F   G + + K+  D       + FV +    DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A++ +NG+ +    + +      +    +  E    F N++V +++V+  DE     F 
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           ++   + A +  D + G+ +G+GFV+F +   A KA++ + GK+   + + +  A K
Sbjct: 253 QYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQK 308

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
           EN++  +L+VG+L+ ++ +  L   F          V  D  T  S GY +V++++ E  
Sbjct: 46  ENNNA-SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAG 104

Query: 201 QKAMDAMQGKDLSGRQIRINWATK 224
           +KA+  +   +++GR  RI W+ +
Sbjct: 105 KKAIQELNYAEINGRPCRIMWSER 128

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 93/174 (53%), Gaps = 3/174 (1%)

Query: 47  SATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEY 105
           S   G  + +   LYVG LD S++E LL   F   G + ++++  D +    + YA+V +
Sbjct: 36  SQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNF 95

Query: 106 IRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGT 165
                   A++ LN   ++ K  +I W+ +   +       N+F+ +LN D+D++ L  T
Sbjct: 96  SDHEAGKQAIEKLNYTPIKGKLCRIMWS-QRDPSLRKKGHGNIFIKNLNQDIDNKALFDT 154

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           F  F   + + +  D +TG+S+G+GFV F  +  A +A+DA+ G  L+G++I +
Sbjct: 155 FSVFGNILSSKIATD-ETGKSKGFGFVHFEEESAANEAIDALNGMLLNGQEIYV 207

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 88/180 (48%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   T++  K++F   G + +V +      +   + FV Y   +DA  A++ LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
           G + +++ L +  A   +E  Q+ +                 NLFV +L+  +DDE L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F       VM   + G+S+G+GFV FS+ EEA KA+     + ++G+ + +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL++ I    L   F   G I + KI  D   +   + FV +     AN A+  LN
Sbjct: 137 IFIKNLNQDIDNKALFDTFSVFGNILSSKIATDETGKSKGFGFVHFEEESAANEAIDALN 196

Query: 120 GVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + + +      +    Q  E    F N++V +++++  DE     F +  T + 
Sbjct: 197 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNIDLETTDEEFKEFFGKIGT-VT 255

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +  +     G+ +G+GFV++ +  +A KA++ + G +   +++ +  A K
Sbjct: 256 SVALERGPDGKLKGFGFVNYEDHNDAVKAVEELNGAEFKDQELFVGRAQK 305

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 135 ETQQAAENDDT-FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVS 193
           E+QQA +ND T  +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+
Sbjct: 35  ESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVN 94

Query: 194 FSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           FS+ E  ++A++ +    + G+  RI W+ +
Sbjct: 95  FSDHEAGKQAIEKLNYTPIKGKLCRIMWSQR 125

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           ET    LYVG+LD S++E  L   F   G + ++++  D +    + YA+V +     A 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ K  +I W+ +   +       N+F+ +L+ D+D++ L  TF  F   
Sbjct: 91  TAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + + V  D +TG+S+G+G+V F   E A +A+DA+ G  L+G++I +
Sbjct: 150 LSSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYV 195

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +Y+ N++   T+   ++     G   +V +    + E   + FV ++   DA   ++ LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
             + + + L +N A   +E QQ  +                 NLF+ +L+  +DD+ L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 75/170 (44%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL   I    L   F   G I + K+  D   +   + +V +     A+ A+  LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 120 GVQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + + +      ++     +       N+++ ++N +  D+       +F     
Sbjct: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-TD 243

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           + V+     G ++G+GFV+F N E+A K ++ +   +  G+ + +N A K
Sbjct: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%)

Query: 122 QLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDM 181
           QLEN +L+       ++      + +L+VGDL+  V +  L   F          V  D 
Sbjct: 11  QLENLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDA 70

Query: 182 QTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            T  S GY +V+F++ + A+ A++ +    + G+  RI W+ +
Sbjct: 71  ITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFG----FILDFTHYPE-KGCCFIKYDTHEQAAVCIVA 369
           T  YI NI    T+ +   L+  FG     +L+ T   E KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 370 LANFPFQGRNL 380
           L N  F+G+ L
Sbjct: 276 LNNTEFKGQPL 286

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 90.1 bits (222), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 99/186 (53%), Gaps = 5/186 (2%)

Query: 36  NDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MK 94
           NDD + +     +     +TS   LYVG LD ++TE LL   F   G + ++++  D + 
Sbjct: 18  NDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAIT 77

Query: 95  NEYVNYAFVEYIRSHDAN-VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL 153
              + YA+V +   HDA   A+Q LN   ++ +  +I W+ +   +     + N+F+ +L
Sbjct: 78  KTSLGYAYVNF-HDHDAGRTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNL 135

Query: 154 NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS 213
           +  +D++ L  TF  F   +   +  D + G S+G+GFV F  +  A++A+DA+ G  L+
Sbjct: 136 HPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLN 194

Query: 214 GRQIRI 219
           G+++ +
Sbjct: 195 GQEVYV 200

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 79/180 (43%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   T++  +  F   G I +  +  D + +   + F+ +     A  A+  LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
               +++ L +  A   +E  Q                    NLFV +L+  +DDE L  
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F     A VM D   G S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  +I    L   F   G I + KI  D       + FV +   + A  A+  +N
Sbjct: 130 IFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAIN 189

Query: 120 GVQLENKTL----KINWAFETQQAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + +     ++      +  E    F N++V +++++   E     F +F     
Sbjct: 190 GMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGKITS 249

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           A +  D + G+ RG+GF++F + E A KA+D +   D   +++ +  A K
Sbjct: 250 AVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQK 298

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 122 QLENKTLKIN-------WAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           QLE   LKIN        + E++ A  +  + +L+VG+L+  V +  L   F    +   
Sbjct: 11  QLEQ--LKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSS 68

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             V  D  T  S GY +V+F + +  + A+  +    + GR  RI W+ +
Sbjct: 69  IRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 92/161 (57%), Gaps = 3/161 (1%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LYVG LD +++E LL   F   G + ++++  D +    + YA+V +        A++ L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N   ++ +  +I W+ +   A     + N+F+ +L+ D+D++ L  TF  F   + + + 
Sbjct: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            D +TG+S+G+GFV F ++  A++A+DA+ G  L+G++I +
Sbjct: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 87/180 (48%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N++   T++   + F   G + +  + +    +   + FV++ +  DA  A++ LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
           G + +++TL ++ A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  + T     VM     G+S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 78/170 (45%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL   I    L + F   G I + KI  D   +   + FV +     A  A+  LN
Sbjct: 125 IFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALN 184

Query: 120 GVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L  + + +      +    Q  E    F N++V ++N++  DE     F ++   + 
Sbjct: 185 GMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLS 244

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +  +   + G+ +G+GFV F   E+A KA++ + G +   + + ++ A K
Sbjct: 245 SS-LEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQK 293

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F++ E  +KA++ 
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 207 MQGKDLSGRQIRINWATK 224
           +    + GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 102/189 (53%), Gaps = 5/189 (2%)

Query: 34  QENDDDKPSVVPASATKGGRET--SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIE 91
           Q N  D+    P+S    G+++  +   LYVG+LD S++E LL   F   G + ++++  
Sbjct: 14  QLNIKDEQQNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCR 73

Query: 92  D-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFV 150
           D +    + YA+V +       VA++ LN   ++ +  +I W+ +   A       N+F+
Sbjct: 74  DAITKTSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWS-QRDPALRKKGNGNIFI 132

Query: 151 GDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK 210
            +LN D+D++ L  TF  F   + + +  D + G S+G+GFV F  +  A++A+DA+ G 
Sbjct: 133 KNLNADIDNKALYDTFSVFGNILSSKIATD-ENGNSKGFGFVHFEEEAAAKEAIDALNGM 191

Query: 211 DLSGRQIRI 219
            L+G++I +
Sbjct: 192 LLNGQEIYV 200

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 85/180 (47%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+    TE+  K+ F+  G   ++ + +    +   + FV Y    DA  A++ LN
Sbjct: 223 VYVKNVPLDTTEEEFKELFEKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELN 282

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
             + + + L +  A   +E  QA +                 NLF+ +L+  +DDE L  
Sbjct: 283 NTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM   + G+S+G+GFV FS+ EEA KA+     + ++G+ + +  A +
Sbjct: 343 EFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 80/177 (45%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+  +  +++ NL+  I    L   F   G I + KI  D       + FV +     A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 113 VALQTLNGVQLENKTLKINWAF-----ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +         ++Q      +  N++V ++ +D  +E       
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVKNVPLDTTEEEFK-ELF 241

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           E P    + V+   + G+ +G+GFV++ N E+A KA++ +   +  G+++ +  A K
Sbjct: 242 EKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQK 298

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 115 LQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           L+ LN ++ E +    +   E QQ+  N  +  L+VGDL+  V +  L   F    +   
Sbjct: 12  LEQLN-IKDEQQNAPSSTGSEGQQSDSNSTS--LYVGDLDPSVSEALLYDIFSPIGSVTS 68

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             V  D  T  S GY +V+F++ E  + A++ +    + GR  RI W+ +
Sbjct: 69  IRVCRDAITKTSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWSQR 118

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 350 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKER 388
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  +++
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 92/169 (54%), Gaps = 3/169 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           ETS   LYVG LD S++E LL   F   G + ++++  D + N  + YA+V +       
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ K  +I W+ +   +     + N+++ +L+  +D+++L  TF  F   
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
           +   V  D   G SRG+GFV F N+ +A+ A++A+ G  ++ +++ + W
Sbjct: 153 LSCKVATD-DNGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAW 200

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   +++  +Q F   G I +  + +D + +   + F+ +     A  A+  LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
                 +TL +  A    E QQ  +                 NLF+ +L+  +DDE L  
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM D + G SRG+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 80/170 (47%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +Y+ NL  +I    L + F   G I + K+  D       + FV +    DA  A++ +N
Sbjct: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDARDAIEAVN 187

Query: 120 GVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ + ++ + + W    +    +  E    F N++V +++++   E     F ++     
Sbjct: 188 GMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLFSKYGKITS 247

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           A +  D + G+ RG+GF++F +   A +A+D +   D  G+ + +  A K
Sbjct: 248 AVLEKDSE-GKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQK 296

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F + E  +KA++ 
Sbjct: 39  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGRKAIEQ 98

Query: 207 MQGKDLSGRQIRINWATK 224
           +    + G+  RI W+ +
Sbjct: 99  LNYTLIKGKPCRIMWSQR 116

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 98/177 (55%), Gaps = 17/177 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDM---KNEYVN---YAFVEYIRSHDAN 112
           LY+G+L+   TE+ +K  +   G P   VK+I+     K+  VN   Y FVE+     A+
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 113 VALQTLNGVQL---ENKTLKINWA-FETQQAAENDDTFNLFVGDLNVDVDDETLAGTF-R 167
            AL   +G+++    N  LK+NWA F T   +E    F LFVGDL  +V +  L   F  
Sbjct: 118 NALMK-SGLRVPMDSNYALKLNWASFATAPGSE----FTLFVGDLAPNVTEAQLFELFIS 172

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            + + + A +++D  TG S+GYGFV F N+ E Q+A+  MQG  L+GR IR+   +K
Sbjct: 173 RYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSK 229

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 313 PNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQ 372

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 373 GFPIGNSRIRLSWGRS 388

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   ITED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGK-----GCGFVQYVDRISAETAIS 369

Query: 117 TLNGVQLENKTLKINWA 133
            + G  + N  ++++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  + ++ L   F+ F   +   +         +G GFV + ++  A+ A+  M
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISAETAISKM 371

Query: 208 QGKDLSGRQIRINWA 222
           QG  +   +IR++W 
Sbjct: 372 QGFPIGNSRIRLSWG 386

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 98/180 (54%), Gaps = 5/180 (2%)

Query: 41  PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVN 99
           P+   + +TKG  E S   LYVG LD S+TE LL   F   G + ++++  D +    + 
Sbjct: 25  PTSTDSESTKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLG 82

Query: 100 YAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDD 159
           YA+V +   +    A++ LN   ++ +  +I W+ +   +     + N+F+ +L+  +D+
Sbjct: 83  YAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDN 141

Query: 160 ETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + L  TF  F   +   +  D +TG+SR +GFV F  +E A++A+DA+ G  L+G ++ +
Sbjct: 142 KALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 80/180 (44%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D    +D  ++ F   G I +  +  D + +   + FV +   + A  A++ LN
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
                 + L +  A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM D   G S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 74/170 (43%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  +I    L   F   G I + KI  D   +   + FV +     A  A+  +N
Sbjct: 130 VFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAKEAIDAIN 189

Query: 120 GVQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ L    + +      +      D       N++V +++ +   +     F ++     
Sbjct: 190 GMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITS 249

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           A +  D + G+ RG+GFV+F +   A KA++ +   D +G+++ +  A K
Sbjct: 250 AVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQK 298

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F +      A++ 
Sbjct: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100

Query: 207 MQGKDLSGRQIRINWATK 224
           +    + GR  RI W+ +
Sbjct: 101 LNYTPIKGRPCRIMWSQR 118

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 99/192 (51%), Gaps = 23/192 (11%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKII------EDMKNEYVNYAFVEY 105
           G  T    LY+G+LD S  E ++K  + A G  +N+ +        D   + + Y FVE+
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGE-ENIGVRMMWGGDADFHRKNLGYCFVEF 136

Query: 106 IRSHDANVALQTLNGVQLE---NKTLKINWAFET----------QQAAENDDTFN-LFVG 151
                A+ AL   NG+++    +K LK+NW+ ++            A  N  T N +FVG
Sbjct: 137 PSPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVG 195

Query: 152 DLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK 210
           DL   V +  L   F  ++P+ + A VM+D  TG S+GYGFV F +  + Q+A+  MQG 
Sbjct: 196 DLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGC 255

Query: 211 DLSGRQIRINWA 222
            L+GR I+I  A
Sbjct: 256 FLNGRAIKIGIA 267

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 384 GFPIANSRVRLSWGRS 399

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  ++VG L   +TED L+ YF+  G I  VKI            FV+Y+    A  A+ 
Sbjct: 326 NTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGK-----GCGFVQYVERSSAETAIT 380

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    ++ A
Sbjct: 381 KMQGFPIANSRVRLSWGRSAKKTA 404

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 81/218 (37%), Gaps = 55/218 (25%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGP-IQNVKIIED-MKNEYVNYAFVEYIRSHDA 111
           + ++  ++VG+L  S+TE  L   F    P   + K++ D +      Y FV++  S D 
Sbjct: 186 QQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQ 245

Query: 112 NVALQTLNGVQLENKTLKINWA----------FETQQAAENDDTFN-------------- 147
             AL  + G  L  + +KI  A              Q   ND+  N              
Sbjct: 246 QRALVEMQGCFLNGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLP 305

Query: 148 -----------------------LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTG 184
                                  +FVG L+  V ++ L   F  F T I   +       
Sbjct: 306 QQFVNATPQQPVLNHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIP------ 359

Query: 185 RSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
             +G GFV +  +  A+ A+  MQG  ++  ++R++W 
Sbjct: 360 AGKGCGFVQYVERSSAETAITKMQGFPIANSRVRLSWG 397

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 96/173 (55%), Gaps = 13/173 (7%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQN--VKIIEDMKNEYVN--YAFVEYIRSHDANVAL 115
           LY+G+LD S  E  +K  + + G  QN  VK+I +      N  + FVE+    +A+ AL
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGE-QNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNAL 115

Query: 116 QTLNGVQLEN---KTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTF-REFPT 171
              NG+ + N   K LK+NWA     +    + +++FVGDL  +V +  L   F   + +
Sbjct: 116 LK-NGLPVPNAVNKFLKLNWA---SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSS 171

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            + + +++D  TG S+GYGFV F N+ E  +A+  MQG  L+GR IR++  +K
Sbjct: 172 TLNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSK 224

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 278 PNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQ 337

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 338 GFPIGNSRIRLSWGRS 353

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ YFQ  G I  VKI            FV+YI    A  A+ 
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGK-----GCGFVQYIDRISAETAIA 334

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +Q A
Sbjct: 335 KMQGFPIGNSRIRLSWGRSAKQTA 358

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 86/223 (38%), Gaps = 57/223 (25%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEY 105
           +T  G E S   ++VG+L  ++TE  L + +        N KI+ D +      Y FV++
Sbjct: 138 STTPGNEYS---IFVGDLAPNVTEAQLFELFISRYSSTLNSKIVFDQLTGVSKGYGFVKF 194

Query: 106 IRSHDANVALQTLNGVQLENKTLKIN---------------------------------- 131
               + + AL  + GV L  + ++++                                  
Sbjct: 195 GNEAEQHRALLEMQGVFLNGRAIRVSTTSKNKPKFQQLQQLQSQSQSKSQPLQQTPINST 254

Query: 132 -------WAFETQQAAE-----NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW 179
                  + F  QQ        + +   +F+G L+  V ++ L   F+ F + +   +  
Sbjct: 255 ATQLQSQFVFPVQQTPSINQFTDPNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPV 314

Query: 180 DMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
                  +G GFV + ++  A+ A+  MQG  +   +IR++W 
Sbjct: 315 G------KGCGFVQYIDRISAETAIAKMQGFPIGNSRIRLSWG 351

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 106/205 (51%), Gaps = 16/205 (7%)

Query: 28  EGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQ-YFQAGGPIQN 86
            GD A Q++     S    +     R  S   LY+G+LD S  E+ ++  +   G P   
Sbjct: 16  RGDYAPQQSIHHTQSHSSPAEQSASRSNS---LYMGDLDPSWDENAIRAVWANLGEPNVQ 72

Query: 87  VKIIEDMKNEYVN--YAFVEYIRSHDANVALQTLNGVQL---ENKTLKINWA-FETQQAA 140
           VK+I +  +   +  Y FVE+    +A+ AL   NG+ +    N+ LK+NWA F T    
Sbjct: 73  VKLIRNSGSTGGSSGYCFVEFPSHLNASNALLK-NGLLIPNARNRYLKLNWASFATAPGN 131

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E+     +FVGD+  +V +  L   F   + + + A +++D  TG S+GYGFV F  + E
Sbjct: 132 EHS----VFVGDIAPNVSEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESE 187

Query: 200 AQKAMDAMQGKDLSGRQIRINWATK 224
            Q+A+  MQG  L+GR +R++  +K
Sbjct: 188 QQRALLEMQGVFLNGRAVRVSTTSK 212

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   ++ED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 272 NTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGK-----GCGFVQYVDRISAETAIA 326

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTF 146
            + G  + N  ++++W    +QAA     F
Sbjct: 327 KMQGYPIGNSRIRLSWGRSAKQAAVMQQAF 356

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    +E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 329

Query: 372 NFPFQGRNLRTGWGKE 387
            +P     +R  WG+ 
Sbjct: 330 GYPIGNSRIRLSWGRS 345

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           TQ    N+ T  +F+G L+  V ++ L   F+ F + +   +         +G GFV + 
Sbjct: 265 TQYTDPNNTT--VFIGGLSSLVSEDELRAYFQPFGSIVYVKIP------VGKGCGFVQYV 316

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           ++  A+ A+  MQG  +   +IR++W 
Sbjct: 317 DRISAETAIAKMQGYPIGNSRIRLSWG 343

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 100/188 (53%), Gaps = 16/188 (8%)

Query: 45  PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVN--YA 101
           PAS     R  S   LY+G+LD +  E  ++  +   G P   +K+I    +   N  Y 
Sbjct: 35  PASEHHSTRSNS---LYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYC 91

Query: 102 FVEYIRSHDANVALQTLNGVQLEN---KTLKINWA-FETQQAAENDDTFNLFVGDLNVDV 157
           FVE+    +A+ AL   NG+ + N   + LK+NWA F T    E    +++FVGD+  +V
Sbjct: 92  FVEFPSHTNASNALLK-NGLVIPNTGNRILKLNWASFATTPGNE----YSVFVGDVAPNV 146

Query: 158 DDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQ 216
            +  L   F   + + + A +++D  TG S+GYGFV F  + E Q+++  MQG  L+GR 
Sbjct: 147 TEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRA 206

Query: 217 IRINWATK 224
           IR++  +K
Sbjct: 207 IRVSTTSK 214

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQ 329

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 330 GFPIGNSRIRLSWGRS 345

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ +FQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGK-----GCGFVQYVDRLSAETAIA 326

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +QAA
Sbjct: 327 KMQGFPIGNSRIRLSWGRSAKQAA 350

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 8/87 (9%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           TQ    N+ T  +F+G L+  V ++ L   F+ F + +   +         +G GFV + 
Sbjct: 265 TQYTDPNNTT--VFIGGLSSLVTEDELRAFFQPFGSIVYVKI------PVGKGCGFVQYV 316

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           ++  A+ A+  MQG  +   +IR++W 
Sbjct: 317 DRLSAETAIAKMQGFPIGNSRIRLSWG 343

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           E S   LYVG+L+ S++E  L   F   G + ++++  D +    + YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ +  +I W+ +   +     + N+F+ +L+ D+D++ L  TF  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + + +  D + G+S+G+GFV F  +  A++A+DA+ G  L+G++I +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 88/181 (48%), Gaps = 18/181 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           LYV N++   T++  ++ F   GPI +  + +D   +   + FV Y +  DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 120 GVQLENKTLKINW----------------AFETQQAAENDDTFNLFVGDLNVDVDDETLA 163
             +L  + L +                  A+  ++ A+     NLFV +L+  VDDE L 
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A 
Sbjct: 340 EEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 224 K 224
           +
Sbjct: 399 R 399

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 81/177 (45%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D   +   + FV +     A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +      +    Q  E    + NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +F   + A +  D   G+ +G+GFV++   E+A KA++A+   +L+G ++ +  A K
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 138 QAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           Q+ EN    +L+VGDL   V +  L   F    +     V  D  T  S GY +V+F++ 
Sbjct: 31  QSVENSSA-SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDH 89

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWATK 224
           E  +KA++ +    + GR  RI W+ +
Sbjct: 90  EAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           E S   LYVG+L+ S++E  L   F   G + ++++  D +    + YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ +  +I W+ +   +     + N+F+ +L+ D+D++ L  TF  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + + +  D + G+S+G+GFV F  +  A++A+DA+ G  L+G++I +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 88/181 (48%), Gaps = 18/181 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           LYV N++   T++  ++ F   GPI +  + +D   +   + FV Y    DA  A++TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 120 GVQLENKTLKINW----------------AFETQQAAENDDTFNLFVGDLNVDVDDETLA 163
             +L  + L +                  A+  ++ A+     NLFV +L+  VDDE L 
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A 
Sbjct: 340 EEFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 224 K 224
           +
Sbjct: 399 R 399

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 81/177 (45%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D   +   + FV +     A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +      +    Q  E    F NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +F   + A +  D   G+ +G+GFV++ N E+A KA++ +   +L+G ++ +  A K
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQK 296

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 122 QLENKTL----KINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHV 177
           QLEN  +    K   A    Q+ EN    +L+VGDL   V +  L   F    +     V
Sbjct: 11  QLENLNIQDDQKQATAGSEGQSVENSSA-SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRV 69

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             D  T  S GY +V+F++ E  +KA++ +    + GR  RI W+ +
Sbjct: 70  CRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           E S   LYVG+L+ S++E  L   F   G + ++++  D +    + YA+V +       
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ +  +I W+ +   +     + N+F+ +L+ D+D++ L  TF  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + + +  D + G+S+G+GFV F  +  A++A+DA+ G  L+G++I +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 18/181 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           LYV N++   T++  +  F   GPI +  + +D   +   + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 120 GVQLENKTLKINWA----------------FETQQAAENDDTFNLFVGDLNVDVDDETLA 163
              L  + L +  A                +  ++ A+     NLFV +L+  VDDE L 
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDSVDDEKLE 339

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A 
Sbjct: 340 EEFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 224 K 224
           +
Sbjct: 399 R 399

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D   +   + FV +     A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +      +    Q  E    + NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +F   + A +  D   G+ +G+GFV++ N E+A KA++A+   DL+G ++ +  A K
Sbjct: 241 QFGPIVSASLEKDAD-GKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQK 296

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 138 QAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           Q+ EN    +L+VGDL   V +  L   F    +     V  D  T  S GY +V+F++ 
Sbjct: 31  QSVENSSA-SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDH 89

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWATK 224
           E  +KA++ +    + GR  RI W+ +
Sbjct: 90  EAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 95/166 (57%), Gaps = 16/166 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           VLY+G+LD S  E ++ Q + + G P  +VK++         Y F+ ++ S  A+ AL  
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEPNVSVKMMN-------RYCFITFLDSLTASNALLK 85

Query: 118 LNGVQLEN---KTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTF-REFPTFI 173
            NG+ +     K LK+NWA   Q ++   + +++FVGDL+ +V +  L   F  ++ +  
Sbjct: 86  -NGMLIPGYGGKRLKLNWA---QASSNASNGYSIFVGDLSPNVTEAQLFDLFINKYASTD 141

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            A +++D  TG SRGYGFV F++  + Q A+  MQG  L+GR I+I
Sbjct: 142 HAKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE +L    + FG I+       KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVAL 115
           ++  ++VG L   +TED L++YF+  G I  VKI            FV+YI    A  A+
Sbjct: 242 NNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKG-----CGFVQYIDRVSAENAI 296

Query: 116 QTLNGVQLENKTLKINWA 133
             + G  + N  ++++W 
Sbjct: 297 SKMQGFPIANSRIRLSWG 314

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L+  V ++ L   F+ F T +   +         +G GFV + ++  A+ A+  M
Sbjct: 246 VFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKGCGFVQYIDRVSAENAISKM 299

Query: 208 QGKDLSGRQIRINWA 222
           QG  ++  +IR++W 
Sbjct: 300 QGFPIANSRIRLSWG 314

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 96/189 (50%), Gaps = 12/189 (6%)

Query: 47  SATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEY 105
           S +  G +  D  +YVGN+D SIT++LL + F    PI  +   +D +   +  YAF+++
Sbjct: 2   SGSGSGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDF 61

Query: 106 IRSHDANVALQTL-NGVQLENKTLKI---------NWAFETQQAAENDDTFNLFVGDLNV 155
               DAN A+Q   N VQL N+ LK+           +    QA        +FV +L+ 
Sbjct: 62  YTEEDANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDS 121

Query: 156 DVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGR 215
            VD   L+  F++F +  +   ++ +  G  R   +V F + E+A +A+ ++ G+ ++ +
Sbjct: 122 SVDVAYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNK 180

Query: 216 QIRINWATK 224
           +I I +A K
Sbjct: 181 RINIEYAFK 189

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 92/167 (55%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           ETS   LYVG L+ +++E LL   F   G + ++++  D + N  + YA+V +       
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ K  +I W+ +   +     + N+++ +L+  +D+++L  TF  F   
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +   V  D + G SRG+GFV F N+ +A+ A++A+ G  ++ +++ +
Sbjct: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 87/180 (48%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D+  +++  ++ F   G I +  + +D + +   + FV +     A  A+  LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
            ++ + + L +  A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T   A VM D +TG SRG+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 79/170 (46%), Gaps = 6/170 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +Y+ NL  +I    L + F   G I + K+  D       + FV +    DA  A++ ++
Sbjct: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187

Query: 120 GVQLENK----TLKINWAFETQQAAENDDTF-NLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           G+ + ++     L ++      +  E    F N++V +++ +   E     F ++     
Sbjct: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS 247

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           A +  D + G+ RG+GFV+F +   A KA+D +   +  G+++ +  A K
Sbjct: 248 AVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +L+VG+L   V +  L   F    +     V  D  T  S GY +V+F + E   KA++ 
Sbjct: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98

Query: 207 MQGKDLSGRQIRINWATK 224
           +    + G+  RI W+ +
Sbjct: 99  LNYTLIKGKPCRIMWSQR 116

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 96/179 (53%), Gaps = 19/179 (10%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY-----------VNYAFVEYIRS 108
           LY+G+LD S  E+ ++Q + + G   NV I   + N             + Y F+E+  +
Sbjct: 47  LYMGDLDPSWDENTIRQIWGSLGE-SNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEFPST 105

Query: 109 -HDANVALQTLNGVQLEN---KTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
            H +N  L+  NG+Q+ N   K LK+NWA  +  +A   + +++FVGDL  +V +  L  
Sbjct: 106 VHASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFE 163

Query: 165 TF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
            F   F +     +++D  TG S+GY FV F+N    Q+A+  MQG  LSGR IR++ A
Sbjct: 164 LFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNA 222

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query: 43  VVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAF 102
           V P  A     + ++  ++VG L   + ED L+ YFQ  G I  VKI            F
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK-----GCGF 322

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA 140
           V+Y+    A  A+  + G  + N  ++++W    +QAA
Sbjct: 323 VQYVDRISAETAIAKMQGFPIGNSRVRLSWGRSAKQAA 360

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +     E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 280 PNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 339

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 340 GFPIGNSRVRLSWGRS 355

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/213 (19%), Positives = 81/213 (38%), Gaps = 56/213 (26%)

Query: 60  LYVGNLDKSITED-LLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQT 117
           ++VG+L  ++TE  L + +        +VKI+ D +      YAFV++        AL  
Sbjct: 147 VFVGDLAPNVTESQLFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLE 206

Query: 118 LNGVQLENKTLKINWAFETQQAAEND---------------------------------- 143
           + G+ L  + ++++ A   Q +A+                                    
Sbjct: 207 MQGIFLSGRAIRVSNAGHLQNSADGKSKATGAASASNANAVGGINTGNNSGLMSGSQFMY 266

Query: 144 --------------DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGY 189
                         +   +FVG L+  V ++ L   F+ F T +   +         +G 
Sbjct: 267 PVQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIP------VGKGC 320

Query: 190 GFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           GFV + ++  A+ A+  MQG  +   ++R++W 
Sbjct: 321 GFVQYVDRISAETAIAKMQGFPIGNSRVRLSWG 353

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           E S   LYVG+L+ +++E  L   F   G + ++++  D +    + YA+V +       
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
            A++ LN   ++ +  +I W+ +   +     + N+F+ +L+ D+D++ L  TF  F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + + +  D + G S+G+GFV F  +  A++A+DA+ G  L+G++I +
Sbjct: 153 LSSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYV 198

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 86/181 (47%), Gaps = 18/181 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           LYV N++   T++  ++ F   GPI +  + +D   +   + FV Y    DA  A++ LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 120 GVQLENKTLKINW----------------AFETQQAAENDDTFNLFVGDLNVDVDDETLA 163
              L  + L +                  A+  ++ A+     NLFV +L+  VDDE L 
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGV-NLFVKNLDDTVDDEKLE 339

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F  + T   A VM   + G+S+G+GFV FS  EEA KA+     + ++G+ + +  A 
Sbjct: 340 EEFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398

Query: 224 K 224
           +
Sbjct: 399 R 399

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL   I    L   F   G I + KI  D       + FV +     A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 113 VALQTLNGVQLENKTLKINWAFETQ----QAAENDDTF-NLFVGDLNVDVDDETLAGTFR 167
            A+  LNG+ L  + + +      +    Q  E    + NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +F   + A +  D   G+ +G+GFV++ N E+A KA++A+   DL+G ++ +  A K
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQK 296

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 138 QAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           Q+ EN    +L+VGDL   V +  L   F    +     V  D  T  S GY +V+F++ 
Sbjct: 31  QSVENSSA-SLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDH 89

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWATK 224
           E  +KA++ +    + GR  RI W+ +
Sbjct: 90  EAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 114/221 (51%), Gaps = 35/221 (15%)

Query: 29  GDNAS-QENDDDKPSVVPASATKGGRETSDRV--LYVGNLDKSITEDLLKQYFQAGGPIQ 85
           G N++  +N++  P  +P+S  +    + ++   LY+G+LD    E  +KQ + + G  +
Sbjct: 32  GSNSTIMKNNNGNP--LPSSMNRSSNPSVNKTTQLYMGDLDPMWDESTIKQIWNSLG--E 87

Query: 86  N---VKIIED-----MKNEYVNYAFVEYIRSHDANVALQTLNGVQL---ENKTLKINWAF 134
           N   VKII +     M      Y F+E+   ++A+ AL   NG+ +    +K LK+NWA 
Sbjct: 88  NNIVVKIITNSNMTSMGRNNPGYCFIEFSNYNNASNALLK-NGLVIPGYNSKVLKLNWAS 146

Query: 135 ETQQAAENDDT---------------FNLFVGDLNVDVDDETLAGTF-REFPTFIQAHVM 178
              ++  N +                F++FVGDL  +V +  L   F   + + I A ++
Sbjct: 147 MHTRSNGNTNCTANNNTSSNNSTNNDFSVFVGDLAPNVTEAQLFDLFINRYSSTIHAKIV 206

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +D  T  S+GYGFV F+N  + Q++++ MQG  L+GR IR+
Sbjct: 207 YDQMTNVSKGYGFVRFNNSADQQRSLNEMQGVFLNGRSIRV 247

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    +E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 372 NFPFQGRNLRTGWGK 386
            FP     +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   ++E  L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 339 NTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKG-----CGFVQYVDRSAAETAIS 393

Query: 117 TLNGVQLENKTLKINWAFETQQAAE 141
            + G  + N  ++++W    +Q+A+
Sbjct: 394 KMQGFPIGNSRIRLSWGRFAKQSAQ 418

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V +  L   F+ F T +   +         +G GFV + ++  A+ A+  M
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAETAISKM 395

Query: 208 QGKDLSGRQIRINWA 222
           QG  +   +IR++W 
Sbjct: 396 QGFPIGNSRIRLSWG 410

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 99/197 (50%), Gaps = 36/197 (18%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYVN----------- 99
           G  T+   LY+G+LD +  ++ ++Q + + G    NV++   M N  +N           
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRM---MWNNSLNNGSRSPMGSKN 104

Query: 100 ---YAFVEYIRS-HDANVALQTLNGV---QLENKTLKINWAFETQQAAENDDTFN----- 147
              Y FV++  S H AN  L+  NG+      N+ LK+NWA  T   +  + TFN     
Sbjct: 105 NQGYCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWA--TSSYSSGNSTFNNVKSS 160

Query: 148 ----LFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQK 202
               +FVGDL  +V +  L   F   + +   A V+ D  TG S+GYGFV F+N +E Q 
Sbjct: 161 NNCSVFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQS 220

Query: 203 AMDAMQGKDLSGRQIRI 219
           A+  MQG  L+GR I++
Sbjct: 221 ALLEMQGVFLNGRAIKV 237

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQ 369

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 370 GFPIANSRVRLSWGRS 385

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAETAIA 366

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +Q A
Sbjct: 367 RMQGFPIANSRVRLSWGRSAKQTA 390

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V ++ L   F+ F T +   +         +G GFV + ++  A+ A+  M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAETAIARM 368

Query: 208 QGKDLSGRQIRINWA 222
           QG  ++  ++R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 99/240 (41%), Gaps = 62/240 (25%)

Query: 45  PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN--------- 95
           P S+T        R L++G+LD +  E  ++Q + A G   +VK+I   KN         
Sbjct: 16  PPSSTMQTSNEPPRTLWMGDLDPAFDESSIQQIWAALGKSVSVKLIRAKKNLLIPCSTSS 75

Query: 96  ----------------------------------EYVNYAFVEYIRSHDANVALQTLNGV 121
                                              +  Y FVE+ +  DA  AL TLN  
Sbjct: 76  TFNAGEDASTAQLTDPQKIKINGVSFIDPNTTQLHHAGYCFVEFQKLEDAQWAL-TLNST 134

Query: 122 QLEN---------------KTLKINWA--FETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
            L N               ++ ++NWA     Q A  +   F+LFVGDL+    +  L  
Sbjct: 135 PLPNILSNSTHSQTNPTLQRSFRLNWASGATLQSAIPSTPEFSLFVGDLSPSATEAHLLS 194

Query: 165 TF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            F + F +     VM D  TG SR +GFV F++++E ++A+  M G    GR +R+ +AT
Sbjct: 195 LFQKNFKSVKTVRVMTDPITGASRCFGFVRFADEQERRRALVEMNGVWCQGRCLRVAYAT 254

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P+ TT +IG +    +E  L  L   FG I +      KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 372 NFPFQGRNLRTGWGKE 387
            F   G  +R  WG+ 
Sbjct: 424 GFIVGGNPIRLSWGRS 439

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 6/81 (7%)

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           N     +F+G L   + +  L   F  F +     +       + +G GFV F ++ +A+
Sbjct: 363 NPKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRI------PQGKGCGFVKFESRIDAE 416

Query: 202 KAMDAMQGKDLSGRQIRINWA 222
            A+  MQG  + G  IR++W 
Sbjct: 417 AAIQGMQGFIVGGNPIRLSWG 437

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 41  PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNY 100
           P+ +P ++    + T+   +++G L   I+E  L   F   G I NV+I +         
Sbjct: 353 PTSIPKNSYTNPKNTT---VFIGGLASQISEPQLYSLFLPFGSITNVRIPQGK-----GC 404

Query: 101 AFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
            FV++    DA  A+Q + G  +    ++++W 
Sbjct: 405 GFVKFESRIDAEAAIQGMQGFIVGGNPIRLSWG 437

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 96/172 (55%), Gaps = 11/172 (6%)

Query: 55  TSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYVN--YAFVEYIRSHDA 111
           T    LY+G+LD +  E++++Q ++  G    +VK++ +  N  VN  Y FVE+      
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWN-SNLGVNQGYCFVEFPSMEHG 102

Query: 112 NVALQTLNGVQLEN---KTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTF-R 167
           N AL   NG+ +     + LK+NWA  +  A  N+  F++FVGDL+ +V +  L   F  
Sbjct: 103 NNALLK-NGIVIPGFPQRRLKLNWA--SAGANGNNSGFSVFVGDLSPNVTEAQLFELFIG 159

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            +P+   A V+ D  TG S+ YGFV F++  + Q+ +  MQG  L+GR I++
Sbjct: 160 RYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKV 211

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    +E DL    Q FG I+       KGC F++Y     A + I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 340 GFPLANSRIRLSWGRS 355

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           + ++  +++G L   ++ED L+QYFQ  G I  VKI            FV+Y+    A +
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGK-----GCGFVQYVDRLSAEL 333

Query: 114 ALQTLNGVQLENKTLKINWAFETQQ 138
           A+  + G  L N  ++++W   ++Q
Sbjct: 334 AISKMQGFPLANSRIRLSWGRSSKQ 358

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V ++ L   F+ F   I   +     TG+  G GFV + ++  A+ A+  M
Sbjct: 285 VFIGGLSSLVSEDDLRQYFQPFGDIIYVKI----PTGK--GCGFVQYVDRLSAELAISKM 338

Query: 208 QGKDLSGRQIRINWA 222
           QG  L+  +IR++W 
Sbjct: 339 QGFPLANSRIRLSWG 353

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 89/161 (55%), Gaps = 3/161 (1%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LYVG LD S+TE LL   F   G + ++++  D +    + YA+V +   +    A++ L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N   ++ +  +I W+ +   +     + N+F+ +L+  +D++ L  TF  F   +   + 
Sbjct: 102 NYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            D +TG+SR +GFV F  +E A++A+DA+ G  L+G ++ +
Sbjct: 161 TD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 65.9 bits (159), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (45%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +YV N+D   T++  ++ F   G I +  +  D + +   + FV +   + A  A + LN
Sbjct: 223 VYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELN 282

Query: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164
               + + L +  A   +E  Q  +                 NLFV +L+  VDD+ L  
Sbjct: 283 DTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSVDDQKLEE 342

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F  F T     VM D + G S+G+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 73/177 (41%), Gaps = 6/177 (3%)

Query: 53  RETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           R+     +++ NL  +I    L   F   G I + KI  D   +   + FV +     A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFR 167
            A+  +NG+ L    + +      +      D       N++V +++ +   E     F 
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFS 242

Query: 168 EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            +     A +  D + G+ RG+GFV+F +   A KA + +   D  G+++ +  A K
Sbjct: 243 NYGAITSAVLERDNE-GKLRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQK 298

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           L+VG+L+  V +  L   F    +     V  D  T  S GY +V+F +    + A++ +
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 208 QGKDLSGRQIRINWATK 224
               + GR  RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 96/188 (51%), Gaps = 13/188 (6%)

Query: 49  TKGGRETSDRVLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVNYAFVEYIR 107
           TK  +      L+VG L  S+ ++ LK  F   GG +    I+E   +    Y +V++  
Sbjct: 140 TKKSKTQEPATLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFED 199

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNV 155
              A  AL+ + G +++ + + ++ +        ++D            +  LF+G+L+ 
Sbjct: 200 ISYAEKALKEMQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSF 259

Query: 156 DVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGR 215
           D D + L   F +F   I   +    +T + +G+G+V ++N E+A+KA+DA+QG+ ++ R
Sbjct: 260 DADRDNLYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDR 319

Query: 216 QIRINWAT 223
            +R++++T
Sbjct: 320 PVRLDFST 327

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 96/177 (54%), Gaps = 13/177 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  G +   ++I E   +    Y +V++     A  A+Q 
Sbjct: 172 TIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQE 231

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD-----------TFNLFVGDLNVDVDDETLAGTF 166
           + G +++ + + ++ +  ++ A  ND            +  LF+G+L+ + D + +  TF
Sbjct: 232 MQGKEIDGRPINVDMS-TSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETF 290

Query: 167 REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            ++   I   +    +T + +G+G+V FSN E+A+KA++ +QG+ +  R +R++++T
Sbjct: 291 SKYGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYST 347

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 94/177 (53%), Gaps = 12/177 (6%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F+  G +   ++I E   +    Y +V++     A  A++ 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD-----------TFNLFVGDLNVDVDDETLAGTF 166
           ++G +++ + +  + +     A  ND            +  LF+G+L+ + D + ++  F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 167 REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            +F   +   +    +T + +G+G+V ++N E+A+KA+DA+QG+ +  R +R++++T
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFST 342

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 53/72 (73%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V +ETL G F +FP+F+ A V  D  T +S G+G+++F ++EEA++AM+ +
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 208 QGKDLSGRQIRI 219
              D++GR+IRI
Sbjct: 153 NYTDVNGREIRI 164

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 80/178 (44%), Gaps = 6/178 (3%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIR 107
           A+K  + +S   +++ NL    T D +  +F   GPI+++ +    K +Y+ +AFV Y  
Sbjct: 293 ASKNNQSSSQNSIFIKNLPIITTRDDVLNFFSEVGPIKSIYLSNATKVKYL-WAFVTYKS 351

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFETQQAA---ENDDTFNLFVGDLNVDVDDETLAG 164
           + D+  A++  N      K L ++ A + ++ A   E+     LF+ +L+   + E L  
Sbjct: 352 NEDSEKAIKRYNNFYFRGKKLLVSRAQDKEERAKFIESQKMSTLFLENLSAVCNKEFLKY 411

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGY-GFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
              +        +  D     S  Y G + F N E+A +  + +  + + G  +  +W
Sbjct: 412 LCHQ-ENIRPFKIQIDGYNESSATYSGHIKFRNFEDATRIFNFLNNRLVGGSIVMTSW 468

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 73/159 (45%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+L +++TE+ LK  F       + K+ ++ +  + + + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N   +  + ++I  +       +N  T N+F  +L +   +  L  T   + TF +   +
Sbjct: 153 NYTDVNGREIRIMPSLRNTTFRKNFGT-NVFFSNLPL---NNPLLTTRVFYDTFSRYGKI 208

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F N++ A+  +         G++I
Sbjct: 209 LSCKLDSRKDIGFVYFENEKTARNVIKMYNNTSFFGKKI 247

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 94/178 (52%), Gaps = 15/178 (8%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  G +   ++I E   +    Y +V++     A  A+Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           + G +++ +   IN    T + A N+D            +  LF+G+L+ + D + +   
Sbjct: 229 MQGKEIDGRP--INCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFEL 286

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F +    +   +    +T + +G+G+V FSN E+A+KA+DA+QG+ +  R +R+++++
Sbjct: 287 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 344

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (59%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           Q+  E ++   +FVG L+  +DDE L   F      I A V+++  T RSRGYG+V F N
Sbjct: 159 QKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFEN 218

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +  A+KA+  MQGK++ GR I  + +T
Sbjct: 219 KSYAEKAIQEMQGKEIDGRPINCDMST 245

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 94/177 (53%), Gaps = 12/177 (6%)

Query: 59  VLYVGNLDKSITEDLLKQYFQ-AGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  GG +    I+E   +    Y +V++     A  A++ 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD-----------TFNLFVGDLNVDVDDETLAGTF 166
           + G +++ + + ++ +     A  ND            +  LF+G+L+ + D + ++  F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 167 REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            ++   I   +    +T + +G+G+V ++N E+A+KA++ +QG+ +  R +R++++T
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYST 339

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 95/188 (50%), Gaps = 26/188 (13%)

Query: 57  DRVLYVGNLDKSITEDLLKQYF-QAGGPIQNVKIIEDMKNEYVN-----------YAFVE 104
           + VLY+G LD S  E ++K  + + G P  NV+++ +M+ ++ N           Y FVE
Sbjct: 42  NNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVE 101

Query: 105 YIRSHDANVALQTLNGVQL---ENKTLKINW---------AFETQQAAENDDTFNLFVGD 152
           +     A+ A+   NG  +   + +  K+NW         A  T+      + +++FVGD
Sbjct: 102 FSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSNDYSVFVGD 160

Query: 153 LNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKD 211
           L  +V +  L   F+  + + + + ++ D  T  S+GYGF+ F +Q +   A+  MQ K 
Sbjct: 161 LGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQNKI 220

Query: 212 LSGRQIRI 219
           L+GR I++
Sbjct: 221 LNGRGIKV 228

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWA--FETQQ 138
            +  Y FVE+    DA  AL +LN   L N               +T ++NWA     Q 
Sbjct: 125 HHAGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQS 183

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F+  F +     VM D  TG SR +GFV F N+
Sbjct: 184 SIPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNE 243

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M GK   GR +R+ +AT
Sbjct: 244 DERRRALIEMSGKWFQGRALRVAYAT 269

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +     E  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           + ++  ++VG L     E  L+  F+  GPI NV+I         N  FV++ +  DA  
Sbjct: 355 DPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEA 409

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDT 145
           ++Q L G  +    ++++W   +   A+   T
Sbjct: 410 SIQGLQGFIVGGSPIRLSWGRPSSSNAKAAST 441

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L     +  L   F+ F   +   +         +  GFV F  + +A+ ++  +
Sbjct: 361 VFVGGLVPKTAEFQLRSLFKPFGPILNVRI------PNGKNCGFVKFEKRIDAEASIQGL 414

Query: 208 QGKDLSGRQIRINWA 222
           QG  + G  IR++W 
Sbjct: 415 QGFIVGGSPIRLSWG 429

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 96/234 (41%), Gaps = 56/234 (23%)

Query: 45  PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN--------- 95
           P S T    +   R L++G+LD S  E  ++Q +   G    VK+I   KN         
Sbjct: 9   PPSTTIQTSDEPPRTLWMGDLDPSFDETTIQQIWMTLGHQVQVKLIRAKKNLLIPCSTSS 68

Query: 96  ----------------------------EYVNYAFVEYIRSHDANVALQTLNGVQLEN-- 125
                                        +  Y FV++    +A   LQ LN   L N  
Sbjct: 69  TLASSQHVEDERIQINGVSFIDPNTTQLHHAGYCFVQFPSLQEAQAGLQ-LNSTPLPNLI 127

Query: 126 -------------KTLKINWAFETQQAAENDDT--FNLFVGDLNVDVDDETLAGTFR-EF 169
                        +  ++NWA      ++   T  F+LFVGDL+    +  L   F+ +F
Sbjct: 128 SSTTHNPTNPTAKRNFRLNWASGATLQSDIPTTPEFSLFVGDLSPTATEAHLLSLFQTKF 187

Query: 170 PTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            +     VM D  TG SR +GFV F++++E ++A+  M G    GRQ+R+ +AT
Sbjct: 188 KSVKTVRVMTDPITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVAYAT 241

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 35/75 (46%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG + +  TE+ L  L   FG IL     P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 372 NFPFQGRNLRTGWGK 386
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
            +F+G LN  + +  L   F  F   +   V         +G GFV F ++ +A+ A+  
Sbjct: 399 TVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAEAAIQG 452

Query: 207 MQGKDLSGRQIRINW 221
           MQG  +    IR++W
Sbjct: 453 MQGFIVGNSAIRLSW 467

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           G  + S+  +++G L+  ITE  L+  F   G I +VK+            FV++    D
Sbjct: 391 GYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGK-----GCGFVKFEHRLD 445

Query: 111 ANVALQTLNGVQLENKTLKINW 132
           A  A+Q + G  + N  ++++W
Sbjct: 446 AEAAIQGMQGFIVGNSAIRLSW 467

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 98/188 (52%), Gaps = 25/188 (13%)

Query: 55  TSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYVN-----------YAF 102
           T+   LY+G+LD +  ++ ++Q + + G    NV+++ +  +   +           Y F
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCF 100

Query: 103 VEYIRS-HDANVALQTLNGV---QLENKTLKINWAFETQQAAEND------DTFNLFVGD 152
           +++  S H AN  L+  NG+      N+ LK+NWA  +     N       +++++FVGD
Sbjct: 101 IDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGD 158

Query: 153 LNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKD 211
           L  +V +  L   F   + +   A ++ D  TG S+GYGFV F+N +E Q A+  MQG  
Sbjct: 159 LAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVF 218

Query: 212 LSGRQIRI 219
           L+GR I++
Sbjct: 219 LNGRAIKV 226

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 302 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQ 361

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 362 GFPIANSRVRLSWGRS 377

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 304 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAEAAIA 358

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +Q A
Sbjct: 359 GMQGFPIANSRVRLSWGRSAKQTA 382

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V ++ L   F+ F T +   +         +G GFV + ++  A+ A+  M
Sbjct: 307 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAEAAIAGM 360

Query: 208 QGKDLSGRQIRINWA 222
           QG  ++  ++R++W 
Sbjct: 361 QGFPIANSRVRLSWG 375

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWA--FETQQ 138
            +  Y FVE+    DA  AL +LN   L N               +T ++NWA     Q 
Sbjct: 125 HHAGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQS 183

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F+  F +     VM D  TG SR +GFV F N+
Sbjct: 184 SIPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNE 243

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M GK   GR +R+ +AT
Sbjct: 244 DERRRALIEMSGKWFQGRALRVAYAT 269

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 413 GFIVGGSPIRLSWGR 427

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           + ++  ++VG L    TE  L+  F+  GPI NV+I         N  FV++ +  DA  
Sbjct: 352 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEA 406

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAE 141
           ++Q L G  +    ++++W   +   A+
Sbjct: 407 SIQGLQGFIVGGSPIRLSWGRPSSSNAK 434

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L     +  L   F+ F   +   +         +  GFV F  + +A+ ++  +
Sbjct: 358 VFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGKNCGFVKFEKRIDAEASIQGL 411

Query: 208 QGKDLSGRQIRINWA 222
           QG  + G  IR++W 
Sbjct: 412 QGFIVGGSPIRLSWG 426

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWA--FETQQ 138
            +  Y FVE+    DA  AL +LN   L N               +T ++NWA     Q 
Sbjct: 125 HHAGYCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQS 183

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F+  F +     VM D  TG SR +GFV F N+
Sbjct: 184 SIPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNE 243

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M GK   GR +R+ +AT
Sbjct: 244 DERRRALIEMSGKWFQGRALRVAYAT 269

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVAL 115
           ++  ++VG L    TE  L+  F+  GPI NV+I         N  FV++ +  DA  ++
Sbjct: 357 TNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEASI 411

Query: 116 QTLNGVQLENKTLKINWAFETQQAAE 141
           Q L G  +    ++++W   +  +A+
Sbjct: 412 QGLQGFIVGGSPIRLSWGRPSSSSAK 437

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 9/112 (8%)

Query: 114 ALQTLNGVQL---ENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFP 170
           ALQ ++ V L    N  ++ N +  +     +     +FVG L     +  L   F+ F 
Sbjct: 324 ALQNVHSVHLNESSNSNMRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPFG 383

Query: 171 TFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
             +   +         +  GFV F  + +A+ ++  +QG  + G  IR++W 
Sbjct: 384 PILNVRI------PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 97/192 (50%), Gaps = 32/192 (16%)

Query: 55  TSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYVN-------------- 99
           T+   LY+G+LD +  ++ ++Q + + G    NV++   M N  +N              
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRM---MWNNTLNNGSRSSMGPKNNQG 107

Query: 100 YAFVEYIRS-HDANVALQTLNGV---QLENKTLKINWA-------FETQQAAENDDTFNL 148
           Y FV++  S H AN  L+  NG+      NK LK+NWA         +    ++ +  ++
Sbjct: 108 YCFVDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSI 165

Query: 149 FVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           FVGDL  +V +  L   F   + +   A ++ D  TG S+GYGFV F+N +E Q A+  M
Sbjct: 166 FVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEM 225

Query: 208 QGKDLSGRQIRI 219
           QG  L+GR I++
Sbjct: 226 QGVFLNGRAIKV 237

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCC-FIKYDTHEQAAVCIVAL 370
           P  TT +IG +    TE +L    Q FG I+ +   P   CC F++Y     A   I  +
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIV-YVKIPVGKCCGFVQYVDRLSAEAAIAGM 368

Query: 371 ANFPFQGRNLRTGWGKE 387
             FP     +R  WG+ 
Sbjct: 369 QGFPIANSRVRLSWGRS 385

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   +TED L+ YFQ  G I  VKI            FV+Y+    A  A+ 
Sbjct: 312 NTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKC-----CGFVQYVDRLSAEAAIA 366

Query: 117 TLNGVQLENKTLKINWAFETQQAA 140
            + G  + N  ++++W    +Q A
Sbjct: 367 GMQGFPIANSRVRLSWGRSAKQTA 390

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V ++ L   F+ F T +   +      G+    GFV + ++  A+ A+  M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKI----PVGKC--CGFVQYVDRLSAEAAIAGM 368

Query: 208 QGKDLSGRQIRINWA 222
           QG  ++  ++R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 93/180 (51%), Gaps = 17/180 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  GG I    I E   +    Y +V++     A  A+Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD--------------TFNLFVGDLNVDVDDETLA 163
           + G +++ +   IN    T + A N++              +  LF+G+L+ + D + + 
Sbjct: 208 MQGKEIDGRP--INCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIF 265

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F +    +   +    +T + +G+G+V FSN E+A+KA+DA+QG+ +  R +R+++++
Sbjct: 266 ELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSS 325

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (60%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           Q+  E+++   +FVG L+  +DDE L   F      I A V+++  T RSRGYG+V F N
Sbjct: 138 QKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFEN 197

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +  A+KA+  MQGK++ GR I  + +T
Sbjct: 198 KSYAEKAIQEMQGKEIDGRPINCDMST 224

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 85/166 (51%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G +  +KI++D        + F+ +    DA  ++  +
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSF----DAPSSVDEV 187

Query: 119 NGVQ--LENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
              Q  L+ K +    A   +   E D T  +FVG L  DV  +     F ++ T I A 
Sbjct: 188 VKTQHILDGKVIDPKRAIPRE---EQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQ 244

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           +M D  TGRSRG+GFV++ + + A+K  ++   ++  G+QI I  A
Sbjct: 245 LMLDKDTGRSRGFGFVTYDSPDAAEKVCESRY-REFKGKQIEIKRA 289

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 93/179 (51%), Gaps = 16/179 (8%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F+  G + + ++I E   +    Y +V++     A  A++ 
Sbjct: 162 TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKE 221

Query: 118 LNGVQLENKTLKINWAFETQQAAEN-------------DDTFNLFVGDLNVDVDDETLAG 164
           + G +++ +   IN    T + A N             + +  LF+G+L+ D D + +  
Sbjct: 222 MQGKEIDGRP--INCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYE 279

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            F ++   I   +    +T + +G+G+V + + E A+KA+DA+QG+ ++ R +R++++T
Sbjct: 280 VFSKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFST 338

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (60%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           Q+  E+++   +FVG L+  +DDE L   F      + A V+++  T RSRGYG+V F N
Sbjct: 152 QKPDESEEPATIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKN 211

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +  A+KA+  MQGK++ GR I  + +T
Sbjct: 212 KTFAEKAIKEMQGKEIDGRPINCDMST 238

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 71/146 (48%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWAF--ETQQ 138
            +  Y FVE+    DA  AL +LN   L N               +T ++NWA     Q 
Sbjct: 126 HHAGYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQS 184

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F+  F +     VM D  TG SR +GFV F ++
Sbjct: 185 SIPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDE 244

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M GK   GR +R+ +AT
Sbjct: 245 DERRRALIEMSGKWFQGRALRVAYAT 270

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE  L  L + FG IL+      K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 417 GFIVGGSPIRLSWGR 431

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           + ++  ++VG L    TE  L+  F+  GPI NV+I         N  FV++ +  DA  
Sbjct: 356 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEA 410

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTF 146
           ++Q L G  +    ++++W   +   A+ + T 
Sbjct: 411 SIQGLQGFIVGGSPIRLSWGRPSSSNAKTNSTI 443

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 40/95 (42%), Gaps = 6/95 (6%)

Query: 128 LKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSR 187
           +++N +  +     +     +FVG L     +  L   F+ F   +   +         +
Sbjct: 342 MRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGK 395

Query: 188 GYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
             GFV F  + +A+ ++  +QG  + G  IR++W 
Sbjct: 396 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 30/193 (15%)

Query: 55  TSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYV-----------NYAF 102
           T+   LY+G+LD +  ++ + Q + + G    NV+++ +  +               Y F
Sbjct: 54  TAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSSSRPSMGPKNNQGYCF 113

Query: 103 VEYIRS-HDANVALQTLNGV---QLENKTLKINWA-----------FETQQAAENDDTFN 147
           V++  S H AN  L+  NG+      NK LK+NWA             +   +++ + ++
Sbjct: 114 VDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGNNGGNNSISNSKSGNNYS 171

Query: 148 LFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +FVGDL  +V +  L   F   + +   A ++ D  TG S+GYGFV FSN +E Q A+  
Sbjct: 172 IFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFVKFSNADEQQLALSE 231

Query: 207 MQGKDLSGRQIRI 219
           MQG  L+GR I++
Sbjct: 232 MQGVFLNGRAIKV 244

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    TE +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 320 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQ 379

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 380 GFPIANSRVRLSWGRS 395

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVAL 115
           ++  +++G L   +TED L+ YFQ  G I  VKI            FV+Y+    A  A+
Sbjct: 321 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG-----CGFVQYVDRLSAETAI 375

Query: 116 QTLNGVQLENKTLKINWAFETQQAA 140
             + G  + N  ++++W    +Q A
Sbjct: 376 AGMQGFPIANSRVRLSWGRSAKQTA 400

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L+  V ++ L   F+ F T +   +         +G GFV + ++  A+ A+  M
Sbjct: 325 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAETAIAGM 378

Query: 208 QGKDLSGRQIRINWA 222
           QG  ++  ++R++W 
Sbjct: 379 QGFPIANSRVRLSWG 393

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 95/181 (52%), Gaps = 17/181 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQ-NVKIIEDMKNEYVN--------YAFVEYIRSHD 110
           LY+G+L+ S  E+++K+ + + G    +VK++    N   N        Y F+++    +
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDFPTHFN 115

Query: 111 ANVAL--QTLNGVQLENKTLKINWAFETQQAAENDDT-----FNLFVGDLNVDVDDETLA 163
           A+ AL    ++     +K LK+NWA  +  +     T     F++FVGDL  +V +  L 
Sbjct: 116 ASNALLKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQLF 175

Query: 164 GTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
             F   +P+   A V+ D+ TG S+GYGF+ F +  + Q A+  MQG  L+GR +++  +
Sbjct: 176 DLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMS 235

Query: 223 T 223
           +
Sbjct: 236 S 236

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 32/76 (42%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +     E +L    Q FG I+       KGC F++Y     A   I  + 
Sbjct: 291 PNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQMQ 350

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 351 GFPISNSRVRLSWGRS 366

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 89/230 (38%), Gaps = 58/230 (25%)

Query: 41  PSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGP-IQNVKIIEDMKNEYV- 98
           PS    S T G    ++  ++VG+L  ++TE  L   F +  P  ++ K++ D+      
Sbjct: 145 PSTAGVSTTGG----NNFSIFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDLSTGVSK 200

Query: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLKI---------------------------- 130
            Y F+ +    D   AL  + GV L  + LK+                            
Sbjct: 201 GYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMSSGQSNSGAGGSRQVGHDRYGGSKPA 260

Query: 131 -------NWAFETQ-------QAAENDDT----FNLFVGDLNVDVDDETLAGTFREFPTF 172
                  N A  +Q       Q A N  T      +F+G L+  V +E L   F+ F   
Sbjct: 261 GGKSNTPNSALFSQFMYPIQQQPALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFGEI 320

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           +   +         +G GFV + ++  A+ A+  MQG  +S  ++R++W 
Sbjct: 321 VYVKIP------VGKGCGFVQYIDRISAETAISQMQGFPISNSRVRLSWG 364

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   + E+ L+QYFQ  G I  VKI            FV+YI    A  A+ 
Sbjct: 293 NTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGK-----GCGFVQYIDRISAETAIS 347

Query: 117 TLNGVQLENKTLKINWAFETQQ 138
            + G  + N  ++++W    +Q
Sbjct: 348 QMQGFPISNSRVRLSWGRSAKQ 369

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 10/99 (10%)

Query: 135 ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPT-FIQAHVMWD------MQTG-RS 186
            T Q   ND    L++GDL    D+  +   +       I   +MW        ++G R+
Sbjct: 43  HTDQNMSNDAGVQLYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRN 102

Query: 187 RGYGFVSFSNQEEAQKAM--DAMQGKDLSGRQIRINWAT 223
           +GY F+ F     A  A+  + M       +++++NWA+
Sbjct: 103 QGYCFIDFPTHFNASNALLKNKMSIPGHPHKKLKLNWAS 141

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 94/233 (40%), Gaps = 55/233 (23%)

Query: 45  PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN--------- 95
           P S T        R L++G+LD S  E  ++  +   G    VK+I   KN         
Sbjct: 9   PPSTTVQTSSEPPRTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSS 68

Query: 96  ---------------------------EYVNYAFVEYIRSHDANVALQTLNGVQLEN--- 125
                                       +  Y FV++    +A   LQ LN   L N   
Sbjct: 69  TLSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVS 127

Query: 126 ------------KTLKINWAFETQQAAENDDT--FNLFVGDLNVDVDDETLAGTFR-EFP 170
                       +  ++NWA      ++   T  F+LFVGDL+    +  L   F+ +F 
Sbjct: 128 PTTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFK 187

Query: 171 TFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +     VM D  TG SR +GFV F++++E ++A+  M G    GRQ+R+ +AT
Sbjct: 188 SVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYAT 240

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFP 374
           TT +IG + +  +E  L  L   FG IL     P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 375 FQGRNLRTGWGK 386
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 144 DTFN--LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           DT N  +F+G L+  + +  L   F  F   +   V         RG GFV F N+ +A+
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAE 375

Query: 202 KAMDAMQGKDLSGRQIRINWA 222
            A+  MQG  + G  IR++W 
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWG 396

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           +T++  +++G L   I+E  L   F   G I +VK+            FV +    DA  
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGR-----GCGFVRFENRMDAEA 376

Query: 114 ALQTLNGVQLENKTLKINWA 133
           A+Q + G  +    ++++W 
Sbjct: 377 AIQGMQGFIVGGNAIRLSWG 396

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 95/178 (53%), Gaps = 13/178 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV-NYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F+  G + + ++I +   E    Y +V++     A  A++ 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           + G +++ + + ++ +     +   +D            +  LF+G+L+ + D + +   
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDNIFEL 331

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F+++ + I   +    +T + +G+G+V +++ EEAQKA+D +QG+ +  R +R+++++
Sbjct: 332 FKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSS 389

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 91/180 (50%), Gaps = 17/180 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVN--YAFVEYIRSHDANVAL- 115
           +Y+G LD + TE  +K  +++ G  + NVK+I + KN  +N  Y F+E+     A+ AL 
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWN-KNLGLNQGYCFIEFPSEQHASNALL 130

Query: 116 -QTLNGVQLENKTLKINWAF----------ETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
              +N  +   K +K+NW             + Q       +++FVGDL  +V +  L  
Sbjct: 131 KNGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFD 190

Query: 165 TF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            F   F +   A ++ D  T  S+ YGFV F++  + Q+A+  MQG  L+GR I+I   T
Sbjct: 191 LFISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKIGTTT 250

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +    TE  L    Q FG I+       KGC F++Y     A   I+ + 
Sbjct: 323 PNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQ 382

Query: 372 NFPFQGRNLRTGWGKE 387
            FP     +R  WG+ 
Sbjct: 383 GFPIGNSRIRLSWGRS 398

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L+  V +E L   F+ F T I   +         +G GFV + ++  A+ A+  M
Sbjct: 328 VFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPI------GKGCGFVQYFDRISAETAILRM 381

Query: 208 QGKDLSGRQIRINWA 222
           QG  +   +IR++W 
Sbjct: 382 QGFPIGNSRIRLSWG 396

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVAL 115
           ++  ++VG L   +TE+ L+  FQ  G I  VKI            FV+Y     A  A+
Sbjct: 324 NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGK-----GCGFVQYFDRISAETAI 378

Query: 116 QTLNGVQLENKTLKINWAFETQQAAE 141
             + G  + N  ++++W   ++Q  +
Sbjct: 379 LRMQGFPIGNSRIRLSWGRSSRQQGQ 404

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 95/181 (52%), Gaps = 18/181 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQ-AGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  GG I    I+E   +    Y +V++     A  A+Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTFN---------------LFVGDLNVDVDDETL 162
           + G +++ +   IN    T + A N++  +               LF+G+L+ + D +T+
Sbjct: 198 MQGKEIDGRP--INCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTI 255

Query: 163 AGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              F +    +   +    +T + +G+G+V ++N ++A+KA+DA+QG+ +  R +R++++
Sbjct: 256 FEMFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYS 315

Query: 223 T 223
           +
Sbjct: 316 S 316

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (58%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           Q+  E+ +   +FVG L+  +DDE L   F      I A V+ +  T RSRGYG+V F N
Sbjct: 128 QKNEESQEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFEN 187

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           Q  A+KA+  MQGK++ GR I  + +T
Sbjct: 188 QSYAEKAIQEMQGKEIDGRPINCDIST 214

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 94/180 (52%), Gaps = 17/180 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F   G + + ++I E   +    Y +V++     A  A++ 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 118 LNGVQLENKTLKINWAFETQQAAEN--DD------------TFNLFVGDLNVDVDDETLA 163
           ++G +++ +   IN    T + A N  DD            +  LF+G+L+ + D + + 
Sbjct: 248 MHGKEIDGRP--INCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIY 305

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F +F   +   +    +T + +G+G+V + N ++A+KA+DA+QG+ +  R +R++++T
Sbjct: 306 EMFSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYST 365

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 82/166 (49%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G L+   TED LK YF   G + ++KI++D        + F+ +  S   +  ++T 
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 255 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLM 309

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TGRSRG+GF+++ + E   +     Q K  D  G+QI I  A
Sbjct: 310 LDKDTGRSRGFGFITYDSSEAVDR---VCQNKYIDFKGKQIEIKRA 352

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 68.6 bits (166), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 97/192 (50%), Gaps = 18/192 (9%)

Query: 39  DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEY 97
           D  S VPA+            +YVGN+D  ++++LL + F   GP+  ++  +D +   +
Sbjct: 2   DGSSTVPANT-----------VYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTH 50

Query: 98  VNYAFVEYIRSHDANVALQTLNG-VQLENKTLKINWAFETQQAAENDDTFN----LFVGD 152
             +AFVE+    DA  A + LN  V+L ++TLK+  A     +  + +  +    LF+ +
Sbjct: 51  QGFAFVEFNSPQDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKN 110

Query: 153 LNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL 212
           ++  VD E L   F +F + ++   ++ ++ G  R   ++ +S  E +  A++ +  + +
Sbjct: 111 IDELVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMV 169

Query: 213 SGRQIRINWATK 224
             + I I++A K
Sbjct: 170 MNKCISIDYAYK 181

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 87/168 (51%), Gaps = 4/168 (2%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +YVGNLD  +T++ L + F   GP+  ++  +D +  EY  +AFVE+  + D   A+++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 119 -NGVQLENKTLKINWAFE-TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            N V L  K LK+    E T           LFV +L+  VD + L   F +F   ++  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            ++ ++ G  +   ++ +S  + + +A+  +  + L+ R I I++A K
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 44/85 (51%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           GG   S   L+V NLD S+    L++ F   GP+     I  +KN  +  A++ Y     
Sbjct: 91  GGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYSTFKH 150

Query: 111 ANVALQTLNGVQLENKTLKINWAFE 135
           ++ ALQ LN   L N+ + I++AF+
Sbjct: 151 SDEALQKLNKQILANRVISIDYAFK 175

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F   G + + ++I E   +    Y +V++   H A  A++ 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           ++G +++ + +  + +     AA  DD            +  LF+G+L+ + D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           F +    I   +    +T + +G+G+V + + ++A+KA +A+QG+ +  R +R++++
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYS 350

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (60%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L+  +DDE L   F      + A V+++  + RSRGYG+V F ++  A+KA+  M
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 208 QGKDLSGRQIRINWAT 223
            GK++ GR I  + +T
Sbjct: 235 HGKEIDGRPINCDMST 250

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 70/146 (47%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWA--FETQQ 138
            +  Y FVE+    DA  AL +LN   L N               +  ++NWA     Q 
Sbjct: 137 HHAGYCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQS 195

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFRE-FPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F++ F +     VM D  TG SR +GFV F N+
Sbjct: 196 SIPSRPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNE 255

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           EE ++A+  M G    GR +R+ +AT
Sbjct: 256 EERRRALVEMNGVWCQGRCLRVAYAT 281

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 33/76 (43%)

Query: 311 PPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVAL 370
           PP  TT +IG +     EA L  L   FG IL       K C F+KY+    A   I  +
Sbjct: 382 PPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQGM 441

Query: 371 ANFPFQGRNLRTGWGK 386
             F   G  +R  WG+
Sbjct: 442 QGFIVGGNPVRLSWGR 457

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L   +++  L   F  F   +   +       + +  GFV + N+ +A+ A+  M
Sbjct: 388 VFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYENRIDAEAAIQGM 441

Query: 208 QGKDLSGRQIRINWA 222
           QG  + G  +R++W 
Sbjct: 442 QGFIVGGNPVRLSWG 456

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   I E  L+  F   G I  VKI +       N  FV+Y    DA  A+Q
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGK-----NCGFVKYENRIDAEAAIQ 439

Query: 117 TLNGVQLENKTLKINWAFET 136
            + G  +    ++++W   T
Sbjct: 440 GMQGFIVGGNPVRLSWGRNT 459

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED---MKNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TED L++YF   G + ++KI++D    ++    +   E   S D  V  Q
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    +   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 219 HI----LDGKVIDPKRSIPRE---EQDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDAQ 271

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GFV++ + E   +     Q K  D  G+QI I  A
Sbjct: 272 LMLDKDTGRSRGFGFVTYDSPEAVDR---VCQNKYIDFKGKQIEIKRA 316

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++ L   F ++   I   +M D  +GRSRG+GF++F   S+ +E 
Sbjct: 155 DNCKMFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEV 214

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 215 VKTQHILDGK 224

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 90/171 (52%), Gaps = 7/171 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LY+GN+D ++T+DLL + F    PI  ++   D + + +  YAF+E+    DA+  ++ +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 119 NG-VQLENKTLKINWAFETQQAAENDDTF----NLFVGDLNVDVDDETLAGTFREFPTFI 173
           N  VQL N+TLK+  A     A++          LFV +L+  VD   LA  F +F  F 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           +   ++ ++    +   ++ ++  +++ +A+  +  + +  R I +++A K
Sbjct: 132 KQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFK 181

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           L+V NLD  +    L + F   GP      I  +K      A++ Y    D++ AL  LN
Sbjct: 106 LFVKNLDDLVDVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLN 165

Query: 120 GVQLENKTLKINWAFETQQAAE 141
              + N+++ +++AF+ ++  E
Sbjct: 166 NQIVFNRSISVDYAFKDEKGNE 187

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 101/245 (41%), Gaps = 60/245 (24%)

Query: 37  DDDKPSV-VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN 95
           D  +P V +P  AT    +   R L++G+LD +  E  +K+ ++  G   ++K++   KN
Sbjct: 15  DKCEPEVPLPPFATVSTSDEPPRTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAKKN 74

Query: 96  ----------------------------------------EYVNYAFVEYIRSHDANVAL 115
                                                    +  Y F+E+    DA   L
Sbjct: 75  LLIPCSSFTNNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQFGL 134

Query: 116 QTLNGVQLEN---------------KTLKINWAF--ETQQAAENDDTFNLFVGDLNVDVD 158
            +LN   + N               +T ++NWA     Q +      ++LFVGDL+    
Sbjct: 135 -SLNSKPIPNFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPEYSLFVGDLSPMTT 193

Query: 159 DETLAGTFRE-FPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +  L   F++ F +     VM D  TG SR +GF+  S++ E ++A+D M G  L GRQ+
Sbjct: 194 EADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLHGRQL 253

Query: 218 RINWA 222
           R+  A
Sbjct: 254 RVALA 258

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 87/220 (39%), Gaps = 59/220 (26%)

Query: 55  TSDRVLYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           T +  L+VG+L    TE DLLK + +    ++ V+++ D +  E   + F+      +  
Sbjct: 178 TPEYSLFVGDLSPMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFERE 237

Query: 113 VALQTLNGVQLENKTLKINWA---------------------------FETQQA------ 139
            AL  +NG  L  + L++  A                            ET +       
Sbjct: 238 EALDKMNGTLLHGRQLRVALANPRNANLQEQAPSQVVEDKKKHNEPLLLETAKKLFSKEL 297

Query: 140 -----------------AENDDT-FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDM 181
                            ++ND T   +FVG+LN  + ++ L   F  F        +  +
Sbjct: 298 LKNSSSNVNDVKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPF------GAIEKV 351

Query: 182 QTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
           +    +  GFV F N+ +A+ +M  +QG  ++G  IRI+W
Sbjct: 352 KIPPGKKCGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 24  SQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGP 83
           S+E+  +++S  ND      V ++      + ++  ++VGNL+  ITED L++ F+  G 
Sbjct: 294 SKELLKNSSSNVND------VKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGA 347

Query: 84  IQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINW 132
           I+ VKI    K       FV++    DA  ++  L G  +    ++I+W
Sbjct: 348 IEKVKIPPGKK-----CGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++GN+    TE +L  + + FG I      P K C F+K+     A   +  L 
Sbjct: 319 PTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQ 378

Query: 372 NFPFQGRNLRTGW 384
            +   G  +R  W
Sbjct: 379 GYFVAGSPIRISW 391

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 91/215 (42%), Gaps = 30/215 (13%)

Query: 29  GDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVK 88
           G    QE+  D PS    SA+      SD  +     ++S  + L          I  V 
Sbjct: 108 GAQPPQEDTRDSPSNTTGSASN--TPASDSGIQTSEGEQSTQQPLKIN-------INGVS 158

Query: 89  IIEDMKNE--YVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKIN 131
            I+    +  +  Y FVE+    DA   L  LN   L N               +T ++N
Sbjct: 159 FIDPATTQLHHAGYCFVEFESQKDAQEGL-ALNSTPLPNFVSTTTGQDINPTGQRTFRLN 217

Query: 132 WAF--ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRG 188
           WA     Q +      ++LFVGDL+    +  L   F+ +F +     VM D  TG SR 
Sbjct: 218 WASGATLQSSIPTTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRC 277

Query: 189 YGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +GFV F N+EE ++A+  M G    GR +R+ +AT
Sbjct: 278 FGFVRFGNEEERRRALIEMNGVHFQGRTLRVAYAT 312

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT ++G +     E  L  + Q FG IL     P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 372 NFPFQGRNLRTGWGK 386
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVAL 115
           ++  ++VG L  ++ E  L++ FQ  G I ++KI         N  FV++    DA  A+
Sbjct: 465 TNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK-----NCGFVKFEHKIDAEAAI 519

Query: 116 QTLNGVQLENKTLKINWA 133
           Q L G  L    ++++W 
Sbjct: 520 QGLQGFVLVENPIRLSWG 537

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 15/113 (13%)

Query: 119 NGVQLENKTLKINWAF---ETQQAAEND----DTFN--LFVGDLNVDVDDETLAGTFREF 169
           N   L  K   IN +F   +  +AA ND    D  N  +FVG L   V ++ L   F+ F
Sbjct: 431 NRADLGRKDGMINTSFVNTQVSEAALNDFFATDPTNTTVFVGGLGPTVQEQQLRKIFQPF 490

Query: 170 PTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              +       ++    +  GFV F ++ +A+ A+  +QG  L    IR++W 
Sbjct: 491 GNIL------SIKIPPGKNCGFVKFEHKIDAEAAIQGLQGFVLVENPIRLSWG 537

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 318 YIGNIPHYATEADLIPLLQN-------FGFILDFTHYPEKGCCFIKYDTHEQAAVCIVAL 370
           ++G++   ATEADL+ L Q           + D      +   F+++   E+    ++ +
Sbjct: 237 FVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEM 296

Query: 371 ANFPFQGRNLRTGWGKERT 389
               FQGR LR  +   R+
Sbjct: 297 NGVHFQGRTLRVAYATPRS 315

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 93/180 (51%), Gaps = 17/180 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQA-GGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  S+ ++ LK  F+  GG I    I+E   +    Y +V++     A  A++ 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 118 LNGVQLENKTLKINWAFETQQAAEN---------DDTFN-----LFVGDLNVDVDDETLA 163
           ++G +++ +   IN    T + A N          DT +     LF+G+L+ + D + + 
Sbjct: 317 MHGKEIDGRP--INCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIF 374

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            TF E    +   +    +T + +G+G+V +S+ +EAQKA +A+QG  +  R +R++++T
Sbjct: 375 ETFAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFST 434

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 133 AFETQQAA--ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYG 190
           A E+++A    N +   +FVG L+  VDDE L   F      I A V+ +  T RSRGYG
Sbjct: 241 ATESKKAKTESNGEPATIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYG 300

Query: 191 FVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +V F N+  A+KA+  M GK++ GR I  + +T
Sbjct: 301 YVDFENKFYAEKAVKEMHGKEIDGRPINCDMST 333

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDLN DV  ETL   F  +P+F+ A V +D QT  S G+G+++F ++E+A+KA+D  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 208 QGKDLSGRQIRI 219
               L  + IRI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 75/159 (47%), Gaps = 4/159 (2%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           L++G+L++ +T++ L+  F       + K+  D + N  + + ++ +    DA  A+   
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N ++L +K ++I  +   +   ++  T N+F    N+  +D  L  + + F  F Q   +
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGT-NVFFT--NLPDEDNRLFHSRKFFEIFRQFGKI 219

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +   ++  GF+SF ++E A+  +         G +I
Sbjct: 220 LSCRLDPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRI 258

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 77/169 (45%), Gaps = 5/169 (2%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  ++V NL  SIT + ++ +F   G I N+  I D  +    +AFV+Y  +  A  A++
Sbjct: 310 ENTVFVSNLPTSITVEEIRNHFNKIGNIMNL-FISDKISSNALWAFVKYSTAACAIRAIK 368

Query: 117 TLNGVQLENKTLKINWAF---ETQQAAENDDTFN-LFVGDLNVDVDDETLAGTFREFPTF 172
            LN   +  K + ++ AF   ETQ       T   L++ +L+   D + ++    +    
Sbjct: 369 ELNNTFIRKKQIVVSQAFRRGETQFHLSRKPTKRILYLKELSRICDKDFVSQFCHQRRIK 428

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
                +  +   +S     +     E+A+K  +++  + ++G  I+ +W
Sbjct: 429 FDEISLTKVNLEKSTHTARIKCRTDEDARKLYNSINNRLIAGSIIKASW 477

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 69/146 (47%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWA--FETQQ 138
            +  Y FVE+    DA   L +LN   L N               +  ++NWA     Q 
Sbjct: 156 HHAGYCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQS 214

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFRE-FPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +  +   F+LFVGDL+    +  L   F++ F +     VM D  TG SR +GFV F N+
Sbjct: 215 SIPSRPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNE 274

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           EE ++A+  M G    GR +R+ +AT
Sbjct: 275 EERRRALVEMNGVWCQGRCLRVAYAT 300

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 31/75 (41%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +     E  L  L   FG IL       K C F+K++    A   I  + 
Sbjct: 418 PNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQ 477

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 478 GFVVGGCPIRLSWGR 492

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L   I E+ L+  F   G I  VKI +       N  FV++ +  DA  A+Q
Sbjct: 420 NTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGK-----NCGFVKFEKRIDAEAAIQ 474

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFN 147
            + G  +    ++++W   T     +  T N
Sbjct: 475 GMQGFVVGGCPIRLSWGRNTVSTPTSAGTGN 505

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G L   +++  L   F  F   +   +       + +  GFV F  + +A+ A+  M
Sbjct: 423 VFIGGLTPKINENQLQTLFSPFGNILTVKIP------QGKNCGFVKFEKRIDAEAAIQGM 476

Query: 208 QGKDLSGRQIRINWA 222
           QG  + G  IR++W 
Sbjct: 477 QGFVVGGCPIRLSWG 491

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 102/209 (48%), Gaps = 19/209 (9%)

Query: 28  EGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNV 87
           E    S E++DD      A A K   +     ++VG L  S+ ++ LK  F   G +   
Sbjct: 143 ESKKRSAESEDD------AVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGA 196

Query: 88  KII-EDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD-- 144
           ++I E   ++   Y +V++     A  A++ ++G +++ + +  + +     +A  +D  
Sbjct: 197 RVIYERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRA 256

Query: 145 ----------TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF 194
                     +  LF+G+L+ + D + L   F +    I   +    ++ + +G+G+V +
Sbjct: 257 KKYGDTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQY 316

Query: 195 SNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            + EEAQ A+DA+QG+ +  R +RI++++
Sbjct: 317 GSVEEAQAALDALQGEYIDNRPVRIDFSS 345

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 84/166 (50%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED+L+QYF   G + +VKI+ D  N +   + F+ +  S   +  ++T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ + I A +M
Sbjct: 212 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLM 266

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TGRSRG+GFV++ + +   K     Q K  +  G+ I I  A
Sbjct: 267 LDKDTGRSRGFGFVTYDSPDAVDK---VCQNKFIEFKGKTIEIKRA 309

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ---EEA 200
           D+  +F+G LN D  ++ L   F ++   I   +M D   G+SRG+GF++F N    +E 
Sbjct: 148 DSCKMFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEV 207

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 208 VKTQHILDGK 217

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 90/219 (41%), Gaps = 54/219 (24%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV------------------- 98
           R L++G+LD    E ++   +Q+ G    VK+I+   N  V                   
Sbjct: 20  RTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEIN 79

Query: 99  ---------------NYAFVEYIRSHDANVALQTLNGVQLEN----------------KT 127
                           Y FVE+    DA  AL TLN   + N                + 
Sbjct: 80  GVSFIDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRK 138

Query: 128 LKINWAFETQQAAENDDT--FNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTG 184
            ++NWA      +    T  F+LFVGDL+    +  L   F+ ++ +     VM D  TG
Sbjct: 139 FRLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITG 198

Query: 185 RSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            SR +GFV F+N+ E + A+  M G    GRQ+R+ +AT
Sbjct: 199 ASRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYAT 237

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFP 374
           TT ++G +     E  L  L + FG I D    P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 375 FQGRNLRTGWGK 386
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG LN ++++  L   F+ F T      + D++    +  GFV ++ + EA+ A++ +
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGT------ITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 208 QGKDLSGRQIRINWA 222
           QG  + G  IR++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 7/82 (8%)

Query: 316 TAYIGNIPHYATEADLIPLLQ-------NFGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 368
           + ++G++  +ATEADL+ L Q           + D      +   F+++    +    ++
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 369 ALANFPFQGRNLRTGWGKERTN 390
            +    FQGR LR  +   R N
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNN 241

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 55  TSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVA 114
            S   ++VG L+ +I E  L + F+  G I +VKI    +       FV+Y    +A  A
Sbjct: 442 VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQ-----CGFVKYNERLEAEAA 496

Query: 115 LQTLNGVQLENKTLKINWA 133
           +  L G  +    ++++W 
Sbjct: 497 INGLQGFIIMGSPIRLSWG 515

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 97/180 (53%), Gaps = 17/180 (9%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK+ F+  G + + ++I E   +    Y +V++     A  A+Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 118 LNGVQLENKTLKINWAFETQQAAEND---------DTFN-----LFVGDLNVDVDDETLA 163
           + G +++ +   IN    T + A N+         DT +     LF+G+L+ + D +T+ 
Sbjct: 202 MQGKEIDGRP--INCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIF 259

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F +    +   +    +T + +G+G+V FS+ E+++KA++++QG+ +  R +R+++++
Sbjct: 260 ELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSS 319

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (58%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           Q+  E+ +   +FVG L+  +DDE L   F      I A V+ +  T RSRGYG+V F N
Sbjct: 132 QKNEESGEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFEN 191

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +  A+KA+  MQGK++ GR I  + +T
Sbjct: 192 KSYAEKAIQEMQGKEIDGRPINCDLST 218

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED---MKNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TED L+ YF   G ++ +KI++D    ++    +   E   S D  V  Q
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 184 HI----LDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GF+++   +   K     Q K  D  GR+I I  A
Sbjct: 237 LMLDKDTGRSRGFGFITYDTPDAVDK---VCQNKFIDFKGRKIEIKRA 281

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 82/166 (49%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L+ YF   G + ++KI++D        + F+ +  S   +  ++T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 221 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM 275

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TGRSRG+GFV++ + +   +     Q K  D  G++I I  A
Sbjct: 276 LDKDTGRSRGFGFVTYDSPDAVDR---VCQNKFIDFKGKKIEIKRA 318

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 120 GVQL-ENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           G Q+ EN  L  N A    +A  + D   +F+G LN +  ++TL   F ++   I   +M
Sbjct: 135 GSQMSENSALAANNAV---KADLSRDICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIM 191

Query: 179 WDMQTGRSRGYGFVSF---SNQEEAQKAMDAMQGK 210
            D  TGRSRG+GF++F   S+ +E  K    + GK
Sbjct: 192 KDTNTGRSRGFGFLTFDSSSSVDEVVKTQHILDGK 226

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 94/178 (52%), Gaps = 13/178 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LKQ F+  G +   +++ E   +    Y +V++     A  A++ 
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           ++G +++ + + ++ +         +D            +  LF+G+L+ + D + +   
Sbjct: 237 MHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEI 296

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F +F   I   +    +T + +G+G+V +++ ++A+KA++A+QG+ +  R +R++++T
Sbjct: 297 FGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYST 354

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 52/87 (59%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           ++A  + +   +FVG L+  +DDE L   F      + A VM++  T RSRGYG+V F +
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFED 226

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWAT 223
           +  A+KA+  M GK++ GR I ++ +T
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMST 253

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 90/174 (51%), Gaps = 4/174 (2%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112
           + ++  +YVGNLD  ++++LL + F    P+  ++  +D +K E+  +AFVE     D +
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 113 VALQTLNG-VQLENKTLKINWAFE-TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFP 170
            A+++LN  V L  K LK+    E  + +A       LFV +L+  +D   L   F +F 
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

Query: 171 TFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
              +   ++ ++ G  R   +V F+    + +A++ +  + ++ + I I++A K
Sbjct: 123 PLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 44/82 (53%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           L+V NLD +I    L++ F   GP+     +  +K+  +  A+V +     ++ AL+ LN
Sbjct: 100 LFVKNLDSTIDAVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLN 159

Query: 120 GVQLENKTLKINWAFETQQAAE 141
              + N+ + I++AF+  +A E
Sbjct: 160 NQIVANQIISIDYAFKEGKAGE 181

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 65.9 bits (159), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 89/174 (51%), Gaps = 7/174 (4%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVAL 115
           D  +YVGN+D  +T ++L + F    P+  ++  +D +   +  +AFVE+  + D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 116 QTL-NGVQLENKTLKINWAFETQQAAENDDTFN----LFVGDLNVDVDDETLAGTFREFP 170
           + L N ++L ++TLK+  A     A  N +  +    LFV +++  VD   L   F +F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 171 TFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
              +A  ++ ++ G  +   +VS++  E + KA+  +  + +  + I +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L+ YF   G + ++KI++D        + F+ +      +  ++T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 219 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLM 273

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TGRSRG+GFV++ + +   +     Q K  D  G++I I  A
Sbjct: 274 LDKDTGRSRGFGFVTYDSPDAVDR---VCQNKFIDFKGKKIEIKRA 316

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++TL   F ++   I   +M D  TGRSRG+GF++F   S+ +E 
Sbjct: 155 DICKMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEV 214

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 215 VKTQHILDGK 224

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 51/72 (70%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V +ETL   F ++P+F+ A V  D  + +S G+G+++F ++EEA KAM+ +
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 208 QGKDLSGRQIRI 219
              +++G++IRI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 83/188 (44%), Gaps = 6/188 (3%)

Query: 38  DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY 97
           +DK S    S +K    +S   +++ NL    T D +  +F   GPI+++ +    K +Y
Sbjct: 283 NDKQSKRNNSESKNNLPSSQNSIFIKNLPVITTRDDILNFFSEVGPIKSIYLSNATKVKY 342

Query: 98  VNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA---ENDDTFNLFVGDLN 154
           + +AFV Y    D+  A++  N      K L ++ A   ++ A   E+     LF+ +L+
Sbjct: 343 L-WAFVTYKSDDDSEKAIKRYNNFYFRGKKLSVSRAQNKEERAKFIESQKMSTLFLENLS 401

Query: 155 VDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGY-GFVSFSNQEEAQKAMDAMQGKDLS 213
              + E L     +        +  D  +  S  Y G++ F N EEA +  + +  + + 
Sbjct: 402 AVCNKEFLKYLCHQ-ENIRPFKIQIDGYSENSSAYSGYIKFKNFEEATRIFNFLNNRLVG 460

Query: 214 GRQIRINW 221
           G  +  +W
Sbjct: 461 GSIVTTSW 468

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 74/159 (46%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+L +++TE+ LK  F       + K+ ++ +  + + + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N  ++  K ++I  +       +N  T N+F  +L ++    T       + TF +   +
Sbjct: 153 NYTEVNGKEIRIMPSLRNTTFRKNFGT-NVFFSNLPLNNPQLTTRAF---YDTFSRYGKI 208

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F +++ A+  +      +  G++I
Sbjct: 209 LSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (61%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L+  +DDE L   F      I A VM +  T RSRGYG+V FS++  A+KA+  M
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 208 QGKDLSGRQIRINWAT 223
            GK++ GR+I  + +T
Sbjct: 219 HGKEIDGREINCDMST 234

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 92/179 (51%), Gaps = 14/179 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYF-QAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  SI ++ LK  F   GG I    ++E   +    Y +V++     A  A++ 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 118 LNGVQLENKTLKINWAFETQQAAEN-------------DDTFNLFVGDLNVDVDDETLAG 164
           ++G +++ + +  + +      + N             + +  LF+G+L+ + D +++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
            F +F   +   +    +T + +G+G+V + N ++A+KA++A+QG+ +  R +R++++T
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYST 336

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TED L+ YF   G +  +KI++D    ++    +   E+  S D  V  Q
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    +   +   E D    +FVG +  DV  +     F +F T I A 
Sbjct: 259 HI----LDGKVIDPKRSIPKE---EQDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDAQ 311

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GF+++ + +   K     Q K  D  G+QI +  A
Sbjct: 312 LMLDKDTGRSRGFGFITYDSADAVDK---VCQNKYIDFKGKQIEVKRA 356

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D+  +F+G LN +  ++ L   F ++   I+  +M D  TGRSRG+GF++F   S+ +E 
Sbjct: 195 DSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEV 254

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 255 VKTQHILDGK 264

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L+ YF   G + ++KI+ D        + F+ +  S   +  ++T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 244 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDAQLM 298

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TGRSRG+GF+++   +   +     Q K  +  G++I I  A
Sbjct: 299 LDKDTGRSRGFGFITYDTPDAVDR---VCQNKFIEFKGKRIEIKRA 341

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++ L   F ++       +M D  TGRSRG+GF++F   S+ +E 
Sbjct: 180 DMCKMFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEV 239

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 240 VKTQHILDGK 249

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 83/169 (49%), Gaps = 17/169 (10%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TED L+ YF   G +  +KI++D    ++    +   E   S D  V  Q
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 226 HI----LDGKVIDPKRAIPRE---EQDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDAQ 278

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM-QGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GFV++    ++  A+D + Q K  +  G+QI I  A
Sbjct: 279 LMLDKDTGRSRGFGFVTY----DSPDAVDRVCQSKYIEFKGKQIEIKRA 323

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNE----YVNYAFVEYIRSHDANVAL 115
           +YVGNLD  + + LL + F   GPI  +K  ++ ++E    +  YAF++++      V  
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 116 QTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQA 175
              N V L  K LK+  + +  +  + D    LFV +L+  +D   L+  F+ F   ++ 
Sbjct: 65  LFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLRK 124

Query: 176 HVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
             ++ +Q G  R   +V F+  + + +A+  +   +L+ + I I++A K
Sbjct: 125 PEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYK 172

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           L+V NLD+SI    L   F+  G +     +  ++N  +  A+V +     ++ ALQ LN
Sbjct: 97  LFVKNLDESIDVPQLSNIFKIFGKLLRKPEVFYLQNGTLRCAYVWFTTFKHSDEALQQLN 156

Query: 120 GVQLENKTLKINWAF--ETQQAAENDD 144
              L NK + I++A+  + Q+ A++ D
Sbjct: 157 ETNLANKLIYIDYAYKDDMQKTAKHGD 183

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 49/80 (61%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           +T  +FVG L+  VDDE L   F      I A V+++  T RSRGYG+V FS++  A++A
Sbjct: 176 ETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERA 235

Query: 204 MDAMQGKDLSGRQIRINWAT 223
           +  M GK + GR+I  + +T
Sbjct: 236 VKEMHGKQIDGREINCDMST 255

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 87/178 (48%), Gaps = 13/178 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  S+ ++ LK  F+  G +   ++I E   +    Y +V++     A  A++ 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           ++G Q++ + +  + +          D            +  LF+G+L+ + D + +   
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYEL 298

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F +    I   +    +T + +G+G+V + N  +AQ A+DA+QG+ +  R +R++++T
Sbjct: 299 FSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFST 356

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 6/136 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED LK YF   G + ++KI+ D        + F+ +  +   +  ++T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 271 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 325

Query: 179 WDMQTGRSRGYGFVSF 194
            D  TGRSRG+GF+++
Sbjct: 326 LDKDTGRSRGFGFITY 341

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++ L   F ++       +M D  TGRSRG+GF++F   S+ +E 
Sbjct: 207 DICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEV 266

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 267 VKTQHILDGK 276

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 81/168 (48%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TE+ L+ YF   G + ++KI++D    ++    +   E+  S D  V  Q
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    +   +   E D T  +FVG +  DV  +     F ++   I A 
Sbjct: 156 HI----LDGKVIDPKRSIPRE---EQDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDAQ 208

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GFV++ + +   +     Q K  +  G+QI I  A
Sbjct: 209 LMLDKDTGRSRGFGFVTYDSPDAVDR---VCQSKYIEFKGKQIEIKRA 253

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 6/136 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED LK YF   G + ++KI+ D        + F+ +  +   +  ++T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 270 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 324

Query: 179 WDMQTGRSRGYGFVSF 194
            D  TGRSRG+GF+++
Sbjct: 325 LDKDTGRSRGFGFITY 340

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF- 194
           T +A  + D   +F+G LN +  ++ L   F ++       +M D  TGRSRG+GF++F 
Sbjct: 198 TNKADLSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFA 257

Query: 195 --SNQEEAQKAMDAMQGK 210
             S+ +E  K    + GK
Sbjct: 258 EASSVDEVVKTQHILDGK 275

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TED LK YF   G +  +KI++D    ++    +   E   S D  V  Q
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    +   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 258 HI----LDGKVIDPKRSIPRE---EQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQ 310

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GFV++ + +   +     Q K  +  G+QI I  A
Sbjct: 311 LMLDKDTGRSRGFGFVTYDSGDAVDR---VCQNKYIEFKGKQIEIKRA 355

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ---EEA 200
           D   +F+G LN +  ++ L   F ++   ++  +M D  TGRSRG+GF++F N    +E 
Sbjct: 194 DNCKMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEV 253

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 254 VKTQHILDGK 263

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 6/136 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G +  VKI+ D        + F+ +  +   +  ++T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +FVG +  DV  +     F E+ + I A +M
Sbjct: 233 H--ILDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDAQLM 287

Query: 179 WDMQTGRSRGYGFVSF 194
            D  TGRSRG+GF+++
Sbjct: 288 LDKDTGRSRGFGFITY 303

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++ L   F ++ T  +  +M D  TGRSRG+GF+SF   S+ +E 
Sbjct: 169 DINKMFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEV 228

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 229 VKTQHILDGK 238

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 85/180 (47%), Gaps = 19/180 (10%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +YVGN+D  +T++LL + F   G ++ VK  +D +  EY  +AF+E+  + DA+  L  +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 119 -NGVQLENKTLKINWAFETQQAAENDD-------------TFNLFVGDLNVDVDDETLAG 164
            N V+L  K LKI     + QA + DD                +FV D+   V+   L  
Sbjct: 68  NNNVKLYQKVLKIR---RSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQ 124

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F +F    +   ++ +  G  R   F+ F   + A  A+  + G+ +  ++  + +A K
Sbjct: 125 LFSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFK 183

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 58/112 (51%), Gaps = 12/112 (10%)

Query: 24  SQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGP 83
           +Q V+ D+A+++++ D  S++P +            ++V ++  ++    L Q F   GP
Sbjct: 84  NQAVQKDDANKKHELD-ASLLPVAK-----------VFVKDIADTVEVRHLTQLFSKFGP 131

Query: 84  IQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFE 135
           +     +  + N  V  AF+ +    +A++A+QTLNG  + NK   + +AF+
Sbjct: 132 LAKTPEVFTVSNGEVRCAFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFK 183

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 100/205 (48%), Gaps = 15/205 (7%)

Query: 31  NASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQA-GGPIQNVKI 89
           N  + +DD++ S      T+   E +   ++VG L  SI ++ LK  F+  GG I    +
Sbjct: 171 NKRKADDDEEKSESKKPKTELAGEPA--TIFVGRLSWSIDDEWLKTEFEPIGGVISARVM 228

Query: 90  IEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD----- 144
            E   +    Y +V++     A  A++ ++G +++ + +  + +      A  DD     
Sbjct: 229 YERGTDRSRGYGYVDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKF 288

Query: 145 -------TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
                  +  LF+G+L+ + D + L   F ++   +   +    +T + +G+G+V + + 
Sbjct: 289 GDVPSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSI 348

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWA 222
           E+A KA + +QG+ ++ R +R++++
Sbjct: 349 EDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +FVG L+  +DDE L   F      I A VM++  T RSRGYG+V F ++  A+KA+  M
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 208 QGKDLSGRQIRINWAT 223
            GK++ GR I  + +T
Sbjct: 258 HGKEIDGRPINCDMST 273

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 72/142 (50%), Gaps = 10/142 (7%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           L++G L+   TE+ LK YF   G + ++KI++D    ++    +   E+  S D  V  Q
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 291 HI----LDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 343

Query: 177 VMWDMQTGRSRGYGFVSFSNQE 198
           +M D  TGRSRG+GF+++ + E
Sbjct: 344 LMLDKDTGRSRGFGFITYDSGE 365

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           ++  LF+G LN +  +E L   F ++   +   +M D  +GRSRG+GF+SF   S+ +E 
Sbjct: 227 ESCKLFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEV 286

Query: 201 QKAMDAMQGK 210
            K+   + GK
Sbjct: 287 VKSQHILDGK 296

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TE+ L+ YF   G +  +KI++D    ++    +   E   S D  V  Q
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVVKTQ 217

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    A   +   E D T  +FVG +  DV  +     F ++ T I A 
Sbjct: 218 HI----LDGKVIDPKRAIPRE---EQDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDAQ 270

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GFV++ + +   +     Q K  +  G+QI I  A
Sbjct: 271 LMLDKDTGRSRGFGFVTYDSPDAVDR---VCQNKFIEFKGKQIEIKRA 315

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ---EEA 200
           D+  +F+G LN +  +ETL   F ++   ++  +M D  TGRSRG+GF++F +    +E 
Sbjct: 154 DSCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEV 213

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 214 VKTQHILDGK 223

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 69/146 (47%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLENKT---------------LKINWAFETQ--Q 138
            +  Y FVE+    DA  AL TLN   L + T                ++NWA       
Sbjct: 108 HHAGYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLS 166

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           A  +   F+LFVGDL+    +  L   F ++F +     VM D  TG SR +GFV F ++
Sbjct: 167 AIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDE 226

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M G    GR +R+ +AT
Sbjct: 227 QERRRALVEMNGVWCQGRNLRVAYAT 252

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +    +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 372 NFPFQGRNLRTGWGK 386
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           + A  N +   +F+G L   + +  L   F  F   I      +++    +G GFV ++ 
Sbjct: 387 RSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAII------NVKIPPGKGCGFVKYAY 440

Query: 197 QEEAQKAMDAMQGKDLSGRQIRINWA 222
           + +A+ A+  MQG  + G  IR++W 
Sbjct: 441 RIDAEAAIQGMQGFIVGGNPIRLSWG 466

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 45/104 (43%), Gaps = 7/104 (6%)

Query: 32  ASQENDDDKPSVV--PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKI 89
           AS  + D  P+ +  P +        ++  +++G L   I+E  L   F   G I NVKI
Sbjct: 368 ASDVSSDHVPAFMAQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKI 427

Query: 90  IEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
                  +V YA+       DA  A+Q + G  +    ++++W 
Sbjct: 428 PPGKGCGFVKYAY-----RIDAEAAIQGMQGFIVGGNPIRLSWG 466

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 45/71 (63%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           ++F LF+G LN  V  E L   F++FP+FI A V  DM+T +S GYG+++FSNQ +  + 
Sbjct: 92  NSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQNDILRL 151

Query: 204 MDAMQGKDLSG 214
           ++    + L G
Sbjct: 152 VEKYNYRSLFG 162

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 12/163 (7%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           L++G L++ +T+++LK+ F+      + K+  DMK  + + Y ++ +   +D    ++  
Sbjct: 96  LFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQNDILRLVEKY 155

Query: 119 NGVQLEN-KTLKINWAFETQQAAENDDTFNLFVGDL---NVDVDDETLAGTFREFPTFIQ 174
           N   L     +KI  +       +N  T N+F  +L   N  +       TF+ +   + 
Sbjct: 156 NYRSLFGCPEIKIMPSLRNTFYRKNIGT-NVFFSNLPLHNPQLTTRYFYDTFKVYGRILS 214

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
             + +       +  GFV F N E A+K +     K+  G +I
Sbjct: 215 CKLDY------RKNIGFVYFDNNESAKKVIYEYNEKNFLGNKI 251

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+ +V ++ L  TFR FP+ I   +  D +TG S GYG+++F + ++A+ A++  
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 208 QGKDLSGRQIRI 219
              +L GR++RI
Sbjct: 77  SYVNLFGREVRI 88

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 13/166 (7%)

Query: 55  TSDRV--LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY-VNYAFVEYIRSHDA 111
           TS +V  L++G+LD ++TE +L   F+    + +VKI  D +    + Y ++ +  S DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 112 NVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVD---VDDETLAGTFRE 168
             A++T + V L  + ++I  +       +N  T N+F  +L ++   +       TFRE
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGT-NVFFSNLPLEQPALTTRVFYETFRE 128

Query: 169 FPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSG 214
           +   +        +  R +  GFV F +   A+KA+ +   K+  G
Sbjct: 129 YGKVLSC------KLDRRKNIGFVYFESDAAARKAIASYNNKEYYG 168

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 80/193 (41%), Gaps = 34/193 (17%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL  +I  + L  YF   GP+++V     ++    ++ FV Y +  D   AL +LN
Sbjct: 227 IHVKNLPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLN 285

Query: 120 GVQLENKTLKINWAFET-----------QQAAENDDTF------------------NLFV 150
           G    ++ L++N A +             + A ND  F                   LF+
Sbjct: 286 GAIFMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFRSSDENSISSLLSNGYRQTLFL 345

Query: 151 GDLNVDVDDETLAGTFREFPTFIQAH-VMWDMQTGRSRGY-GFVSFSNQEEAQKAMDAMQ 208
            DL++  +D+ L    R     I  H ++ D        Y G++   ++ +A +  + + 
Sbjct: 346 SDLSLVCNDKFLGELCR--AEKINYHKIVVDHYDEECLTYSGYIVCKSRPDANRLFEVLN 403

Query: 209 GKDLSGRQIRINW 221
            K +    +R++W
Sbjct: 404 NKLIGDSIVRVSW 416

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (58%)

Query: 133 AFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFV 192
             ++Q   E+  T  LF+GDL+  +D+E L   F++F +     V  D +TG+S GYG++
Sbjct: 90  GLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYL 149

Query: 193 SFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +FS +++   A +    + + G+++RI
Sbjct: 150 NFSRRQDTLAATEEFNYRPIFGKEVRI 176

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 83/195 (42%), Gaps = 19/195 (9%)

Query: 27  VEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQN 86
           V   N + +N  D  SV+ +  T          L++G+LD+ I E++L Q F+    + +
Sbjct: 80  VATSNTNTQNGLDSQSVIESQPTIA--------LFIGDLDEQIDEEILIQIFKKFKSLTS 131

Query: 87  VKIIEDMKN-EYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDT 145
           VK+  D +  + + Y ++ + R  D   A +  N   +  K ++I  +       +N  T
Sbjct: 132 VKVCTDAETGKSLGYGYLNFSRRQDTLAATEEFNYRPIFGKEVRIMPSLRNTFYRKNIGT 191

Query: 146 FNLFVGDL---NVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQK 202
            N+F  +L   N ++       TF+ +   +   +       + +  GF+ F N   A+ 
Sbjct: 192 -NIFFSNLPLENSNLTTRVFYDTFKVYGNILSCKL------DKRKNIGFIYFDNDHAARV 244

Query: 203 AMDAMQGKDLSGRQI 217
            +    G +  G +I
Sbjct: 245 VIKEFNGSEFFGNKI 259

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 77/171 (45%), Gaps = 15/171 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL  S  +D +  YF   GP+++V      K E  ++AFV Y +  D N A++  +
Sbjct: 316 IFVKNLPPSCPDDEILDYFSNLGPVKSVFSSTSHKYE-SSWAFVTYKKGSDTNKAVKIYH 374

Query: 120 GVQLENKTLKINWAFETQQAAENDDTFN-----------LFVGDLNVDVDDETLAGTFRE 168
           G Q + + L +    + + A     ++N           L++ +L+   +++ L     E
Sbjct: 375 GAQFKGRKLSV---IKAESARNGHGSYNKQSSKISYRPILYLQNLSSVCNEQFLLQMCME 431

Query: 169 FPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
               I+   + D         G+V   ++++A K +  +  + + G +++I
Sbjct: 432 ERIKIENLGITDFFHDSFTYSGYVKCKSKKDADKILKLLNNRLIGGCEVKI 482

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 89/180 (49%), Gaps = 12/180 (6%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVA 114
           SD  +YVGN+D  IT+D L + F    P+  +K  +D +   Y  YAF+E+    DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 115 LQTLNG-VQLENKTLKINW---AFETQQAAENDD------TFNLFVGDLNVDVDDETLAG 164
           +Q +N  V+L ++ +K+     +  T   + N+          LFV +L   +D + LA 
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSIDIDQLAK 126

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F +F   I    ++ +  G+ +    V F + E+A  A+ ++  + ++  +I I++A K
Sbjct: 127 IFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDYAFK 185

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 86/167 (51%), Gaps = 13/167 (7%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L+ YF   G + ++KI++D    +   + F+ + +S   +  ++T 
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A   +   E D T  +F+G +  DV  +     F ++   I A +M
Sbjct: 232 H--ILDGKVIDPKRAIPRE---EQDKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDAQLM 286

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAM-QGK--DLSGRQIRINWA 222
            D  TGRSRG+GFV++    ++  A+D + Q K  +  G+QI I  A
Sbjct: 287 LDKDTGRSRGFGFVTY----DSPDAVDRVCQHKFIEFKGKQIEIKRA 329

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 88/178 (49%), Gaps = 13/178 (7%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNYAFVEYIRSHDANVALQT 117
            ++VG L  +I +  LK  F+  G +Q+ ++I E        Y +V++     A  A++ 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD------------TFNLFVGDLNVDVDDETLAGT 165
           ++G +L+ + +  + +         +D            +  LF+G+L+ + D + +   
Sbjct: 297 MHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIYEL 356

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F      I   +    +T + +G+G+V +++ + AQKA++ +QG+ +  R +R++++T
Sbjct: 357 FSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFST 414

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           +++A  + +   +FVG L+ ++DD+ L   F        A V+++  + RSRGYG+V F+
Sbjct: 226 SKKAKLSGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFT 285

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           ++  A+KA+  M GK+L GR I  + +T
Sbjct: 286 DKSYAEKAVKEMHGKELDGRPINCDMST 313

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 90/181 (49%), Gaps = 14/181 (7%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVA 114
           S   +YVGN+D  IT++ L + F    PI  +K  +D +   Y  YAF+E+    DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 115 LQTLNG-VQLENKTLKINWAFETQQAAENDDTFN----------LFVGDLNVDVDDETLA 163
           +Q +N  V+L ++ +K+     +  AA N  + N          LFV +L   VD E L 
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGAA-NASSNNSKGISLPIAKLFVKNLADSVDIEQLE 125

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
             F +F   +    ++ + TG+ +   +V F + E+A  A+ ++  + ++  +I +++A 
Sbjct: 126 KIFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYAF 184

Query: 224 K 224
           K
Sbjct: 185 K 185

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 69/146 (47%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWAF--ETQQ 138
            +  Y FVE+    DA  AL +LN   + N               +  ++NWA     Q 
Sbjct: 162 HHAGYCFVEFQNQEDAQYAL-SLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQS 220

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFRE-FPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           +      F+LFVGDL+    +  L   F++ + +     VM D  TG SR +GF+ F +Q
Sbjct: 221 SIPVTPEFSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQ 280

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E ++A+  M G    GR +R+ +AT
Sbjct: 281 DERKRALSEMNGVWCQGRPLRVAYAT 306

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%)

Query: 314 VTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANF 373
           V+T +IG +     E+ +  L + FG I++    P K C F+K++    A   I  L  F
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 374 PFQGRNLRTGWGK 386
              G  +R  WGK
Sbjct: 439 IVAGNPIRLSWGK 451

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 80/214 (37%), Gaps = 43/214 (20%)

Query: 44  VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFV 103
           +P S+T        R L++G+LD S  E  ++Q +++   +  VK+I   KN  +  +  
Sbjct: 10  LPPSSTIETSSEPPRTLWMGDLDPSFDESTIQQIWKSLDRLVTVKLIRAKKNLLIPCSST 69

Query: 104 ------------------EYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDT 145
                               + S  ++ +  T++    ENK+  I     T Q  +   T
Sbjct: 70  INDSFSNSSNSLSPTNSSTRLSSAGSSASPTTVSSSSAENKSNSITNNLSTDQTEDASIT 129

Query: 146 FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGR--SRGYGFVSFSNQEEAQKA 203
            NL         DD+T  G        I      D  T +    GY FV F NQE+AQ A
Sbjct: 130 SNL---------DDDTNGGNQNLHKININGVSFIDPSTVQLHHAGYCFVEFQNQEDAQYA 180

Query: 204 M--------------DAMQGKDLSGRQIRINWAT 223
           +              + +       R  R+NWA+
Sbjct: 181 LSLNSNPIPNILSDSNNLYTNPTGKRNFRLNWAS 214

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           ++  ++N+    +F+G L+  +++  +   F+ F   +      +++    +  GFV F 
Sbjct: 370 SKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFGNIV------NVKLPPGKNCGFVKFE 423

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           N+ +A+ A+  +QG  ++G  IR++W 
Sbjct: 424 NRIDAEAAIQGLQGFIVAGNPIRLSWG 450

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL 118
            +++G L   I E  ++  F+  G I NVK+         N  FV++    DA  A+Q L
Sbjct: 381 TVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGK-----NCGFVKFENRIDAEAAIQGL 435

Query: 119 NGVQLENKTLKINW---AFETQQAAENDDTFNLFVGDLN 154
            G  +    ++++W   +  T   A N+   N  +  LN
Sbjct: 436 QGFIVAGNPIRLSWGKASSMTSGNASNNHNVNGNIDQLN 474

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 87/172 (50%), Gaps = 8/172 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +YVGN+D  +T++ L + F    PI N++  +D +   +  +AFVE+    D    +Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 119 NG-VQLENKTLKINWAFETQQAAENDDTF-----NLFVGDLNVDVDDETLAGTFREFPTF 172
           N  VQL ++ LK+  A      ++  D        +FV +L+  +D+  L+  F +F   
Sbjct: 72  NNTVQLYDRFLKVRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPL 131

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            +   ++ +  G+ R   ++ F N + +  A+  + G+ +  +++ +++A K
Sbjct: 132 AKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 6/99 (6%)

Query: 43  VVPASATKGGRETSDRVL------YVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNE 96
           V  A+    G +T D  +      +V NLD SI E  L + F   GP+     I  + + 
Sbjct: 84  VRKANVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSDG 143

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFE 135
            +  A++ +     +++AL TLNG  + NK + +++AF+
Sbjct: 144 QLRCAYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 48/72 (66%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V ++ L  TF +F +F+ A +  D  T +S GYG+++FSN+E+A++ ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 208 QGKDLSGRQIRI 219
               + GR++RI
Sbjct: 178 NYIPIFGREVRI 189

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 72/160 (45%), Gaps = 7/160 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+LD+ +TE  L+  F       + KI I+    + + Y ++ +    DA   ++  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           N + +  + ++I  +       +N  T N+F  +L +    E LA T R F   F +   
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPL----ENLALTTRVFYDAFKKFGK 232

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +  R +  GFV F     A++A+    GK+  G  I
Sbjct: 233 ILSCKLDRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  +   DLL  YF   GP++++    ++      +AF+ + +  DA  A+  LN
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLN 385

Query: 120 GVQLENKTLKINWA---FETQQAAEN 142
             QL  + ++++ A   F+T   A N
Sbjct: 386 HSQLLGRPIELSRAQKNFQTDIDAAN 411

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 70/146 (47%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQL---------------ENKTLKINWAFETQQAA 140
            +  Y FVE+    DA  AL +LN   +                N+  ++NWA      +
Sbjct: 127 HHAGYCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNNNRNFRLNWASGATLNS 185

Query: 141 ENDDT--FNLFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
               T  F+LFVGDL+  V +  L   F ++F +     VM D  TG SR +GF+ F+++
Sbjct: 186 SIPLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDE 245

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
            E + A+  M G   +GR +R+ +AT
Sbjct: 246 LERKNALIEMNGIWCNGRPLRVAYAT 271

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 48/72 (66%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V ++ L  TF +F +F+ A +  D  T +S GYG+++FSN+E+A++ ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 208 QGKDLSGRQIRI 219
               + GR++RI
Sbjct: 182 NYIPIFGREVRI 193

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 7/160 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+LD+ +TE  L+  F       + KI I+    + + Y ++ +    DA   ++  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           N + +  + ++I  +       +N  T N+F  +L +    E LA T R F   F +   
Sbjct: 182 NYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPL----ENLALTTRVFYDAFKKYGK 236

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +  R +  GFV F     A++A+    GK   G  I
Sbjct: 237 ILSCKLDRRKNIGFVYFEKDSSAKQAIAEYNGKQFYGNNI 276

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  +   DLL  YF   GP++++    ++      +AF+ + +  DA  A+ +LN
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIGPVKSI-FTSNVSKLNSAWAFITFKKGSDAQDAIDSLN 389

Query: 120 GVQLENKTLKINWA---FETQQAAENDDTFN 147
             QL  +T++++ A   F++   A N  T N
Sbjct: 390 HSQLLGRTIELSRAQKNFQSDIDAANAGTGN 420

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 79/168 (47%), Gaps = 15/168 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM---KNEYVNYAFVEYIRSHDANVALQ 116
           +++G L+   TE+ L+ YF   G +  VKI++D    ++    +   E   S D  V  Q
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 117 TLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            +    L+ K +    A   +   E D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 248 HI----LDGKVIDPKRAIPRE---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 300

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
           +M D  TGRSRG+GF+++   +   +     Q K  +  G+QI I  A
Sbjct: 301 LMLDKDTGRSRGFGFITYDTPDAVDR---VCQNKFIEFKGKQIEIKRA 345

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196
           D   +F+G LN +  +E L   F ++    +  +M D  TGRSRG+GF++F N
Sbjct: 184 DINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN 236

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 9/167 (5%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++GNL    TE+ L+ +F   G + N +++   +        VE+    DA  A++  N
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM-SYRGRSKGMGTVEFTNPADAEEAIRQYN 138

Query: 120 GVQLENKTLKINW-------AFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
           GV    + + +           E + +      +  FV +L   +  + L   FRE    
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGDV 198

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           I+A V  D   G SRG+G V ++N+E+  KA+D+  G +L GR + +
Sbjct: 199 IRADVELDYN-GYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 74/203 (36%), Gaps = 40/203 (19%)

Query: 61  YVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNG 120
           +V NL  SIT   LK  F+  G +    +  D       +  V Y    D   A+ + NG
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 121 VQLENKTLKI---------------------------------------NWAFETQQAAE 141
            +LE + L++                                       N +F    + +
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGD 294

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
            +    ++  +L +      L   F        A +++D +TG S G   V +++Q+ A 
Sbjct: 295 GERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAAD 353

Query: 202 KAMDAMQGKDLSGRQIRINWATK 224
             ++ + G +  GR + I +A++
Sbjct: 354 VCINKLNGYNYGGRDLHITYASR 376

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 5/101 (4%)

Query: 38  DDKPSVVPA---SATKG--GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED 92
           +++P + PA   S T+G  G    +  +Y  NL  S T   L   F + G I   +++ D
Sbjct: 274 EEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD 333

Query: 93  MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
                   A VEY     A+V +  LNG     + L I +A
Sbjct: 334 ETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYA 374

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 7/78 (8%)

Query: 313 RVTTAYIGNIPHYATEADLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAAVC 366
           R  T Y  N+P   T  DL  L  + G       + D T     G   ++Y + + A VC
Sbjct: 297 RNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGT-STGAAVVEYASQDAADVC 355

Query: 367 IVALANFPFQGRNLRTGW 384
           I  L  + + GR+L   +
Sbjct: 356 INKLNGYNYGGRDLHITY 373

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G + ++KI++D        + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A       E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 221 H--ILDGKVIDPKRAIPRD---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 275

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TG+SRG+GFV++ + +   +     Q K  D   R+I I  A
Sbjct: 276 LDKDTGQSRGFGFVTYDSADAVDR---VCQNKFIDFKDRKIEIKRA 318

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G + ++KI++D        + F+ + +    +  ++T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A       E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 224 H--ILDGKVIDPKRAIPRD---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 278

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TG+SRG+GFV++ + +   +     Q K  D   R+I I  A
Sbjct: 279 LDKDTGQSRGFGFVTYDSADAVDR---VCQNKFIDFKDRKIEIKRA 321

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G + ++KI++D        + F+ + +    +  ++T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A       E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 221 H--ILDGKVIDPKRAIPRD---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 275

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TG+SRG+GFV++ + +   +     Q K  D   R+I I  A
Sbjct: 276 LDKDTGQSRGFGFVTYDSADAVDR---VCQNKFIDFKDRKIEIKRA 318

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 11/166 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G + ++KI++D        + F+ + +    +  ++T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    A       E D T  +FVG +  DV  +     F ++ T I A +M
Sbjct: 223 H--ILDGKVIDPKRAIPRD---EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLM 277

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK--DLSGRQIRINWA 222
            D  TG+SRG+GFV++ + +   +     Q K  D   R+I I  A
Sbjct: 278 LDKDTGQSRGFGFVTYDSADAVDR---VCQNKFIDFKDRKIEIKRA 320

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 55/89 (61%)

Query: 131 NWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYG 190
           N+  +  +  E+ +TF+LF+GDL+  V  E L   F ++P+F+ A V +D +T  S G+G
Sbjct: 36  NYEGKKIKILESGETFSLFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHG 95

Query: 191 FVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +++FS++ ++++A+D      L    IR+
Sbjct: 96  YLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 79/160 (49%), Gaps = 5/160 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY-VNYAFVEYIRSHDANVALQTL 118
           L++G+L   +T+++L+  F       + K+  D K +  + + ++ +    D+  A+   
Sbjct: 53  LFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDF 112

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           N  +L +  +++  +F  +   +++  +NLF  +L  +VDD   + T R F   F +   
Sbjct: 113 NCTRLFDSVIRLMPSFRGKNIKKSN--YNLFFSNL-PEVDDTGQSFTPRRFYELFRECGE 169

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +   ++  GF+SF ++  A++ +     K L G+QI
Sbjct: 170 IISCKFEENKNIGFISFQSENVAREVIINYNNKFLFGKQI 209

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 46/72 (63%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V ++ L  TF ++P+ +   +  D  + RS GYG+++FSN E+A+KA +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 208 QGKDLSGRQIRI 219
               L G+++RI
Sbjct: 164 NYVPLFGKEVRI 175

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 7/160 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+LD+ +TE +L+  F     + +VKI  D +    + Y ++ +    DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           N V L  K ++I  +       +N  T N+F  +L +    E L+ T R F  TF +   
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGT-NVFFSNLPL----ENLSLTTRAFYDTFKKYGK 218

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +  R +  GF+ F     A+ A+D   GK+  G  I
Sbjct: 219 ILSCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNI 258

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL  +  ED +  +F   GP+++V     +     ++AFV Y +  D + A++ LN
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSV-FTSKVPKYNSSWAFVTYKKGSDTSEAIEKLN 372

Query: 120 GVQLENKTLKINWAFETQQAAEND 143
           G   +++ +++  A +  Q   N+
Sbjct: 373 GEIFKHRKIEVARAQKNFQHPSNN 396

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 110 DANVALQTLNGVQLENKTLKINWAFETQ--QAAENDDTFNLFVGDLNVDVDDETLAGTF- 166
           DA+  L+T N   L N   ++NWA       A  +   F+LFVGDL+    +  L   F 
Sbjct: 140 DASSPLRT-NPTGLRN--FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQ 196

Query: 167 REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           ++F +     VM D  TG SR +GFV F +++E ++A+  M G    GR +R+ +AT
Sbjct: 197 KKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYAT 253

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%)

Query: 312 PRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           P  TT +IG +  + +E  L  L   FG I++    P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 372 NFPFQGRNLRTGWGKERTN 390
            F   G  +R  WG+  T+
Sbjct: 463 GFIVGGNPIRLSWGRTSTD 481

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           N +   +F+G L     +  L   F  F T I      +++    +G GFV ++ + +A+
Sbjct: 402 NPNNTTVFIGGLTSHTSERQLHSLFAPFGTII------NVKIPPGKGCGFVKYAYRIDAE 455

Query: 202 KAMDAMQGKDLSGRQIRINWA 222
            A+  MQG  + G  IR++W 
Sbjct: 456 AAIQGMQGFIVGGNPIRLSWG 476

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           +  +++G L    +E  L   F   G I NVKI       +V YA+       DA  A+Q
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAY-----RIDAEAAIQ 459

Query: 117 TLNGVQLENKTLKINWA 133
            + G  +    ++++W 
Sbjct: 460 GMQGFIVGGNPIRLSWG 476

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 48/72 (66%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+G+L++DV++E L   F++FP+ +   +  +  T  S GYG+++F ++E+A+KA +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 208 QGKDLSGRQIRI 219
              +L G +++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 74/159 (46%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           L++GNL   + E+ LKQ F+    + +VKI  +    E + Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N + L    +KI  +       +N  T NLF  +L +D  + T   T R + TF +   +
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGT-NLFFCNLPLDNKELT---TRRFYDTFKKYGKI 195

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +  + +  GFV F N + A++ +     K+  G +I
Sbjct: 196 LSCKLDKRKNIGFVYFDNDKSAKEVIKDFNNKEFFGTKI 234

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/192 (18%), Positives = 77/192 (40%), Gaps = 22/192 (11%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDA 111
            ++T    ++V NL  + T++ +  YF   GPI++V   +  K   + ++ + Y +S D+
Sbjct: 326 NKKTYPNSVFVKNLPINTTDEEILDYFSVAGPIKSVFSSKVPKFNSL-WSIITYKKSSDS 384

Query: 112 NVALQTLNGVQLENKTLKINWAFETQQAAENDDTFN--------LFVGDLNVDVDDETLA 163
             A+QT +    + K + +  A      ++N  T+         +++ +L+ D     L 
Sbjct: 385 IKAIQTYDNKTFKEKVISVTKAHSKLHESQNYSTYQNYDNYKKIIYLTNLSPDCSVSFLT 444

Query: 164 G-------------TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK 210
                          + E      ++         +   G++   ++ EA K  +   GK
Sbjct: 445 KFCQHSNIHAEDIQIYAEVINNNNSNNSNSNNNNTTLLSGYIKCKSKYEASKLFELFNGK 504

Query: 211 DLSGRQIRINWA 222
            + G  I+ +W 
Sbjct: 505 LIYGNIIKASWV 516

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           L++GDL  DV +  L   F  + +F+ A +  D +TG S GYG+++ SN+EEA   ++  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 208 QGKDLSGRQIRI 219
              ++ GR++RI
Sbjct: 214 NYTNIFGREVRI 225

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 8/168 (4%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVA 114
           S   LY+G+L K +TE +L   F +     + KI  D K  E + Y ++      +A   
Sbjct: 150 SSIALYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSL 209

Query: 115 LQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           L+  N   +  + ++I  +       +   T N+++  L++    +    T R F  + +
Sbjct: 210 LERYNYTNIFGREVRIMPSLRNSTMRKQIGT-NIYLAGLSL----KKKGITTRIFYDYFK 264

Query: 175 AH-VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL-SGRQIRIN 220
            +  +   +    +  GF+ F N+  A K ++    K L  G +I+ N
Sbjct: 265 IYGKILSCKLNFEKDIGFIFFENKSIANKVIEIYNDKTLFFGNKIKCN 312

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 31/195 (15%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM----KNEYVNYAFVEYIRSHDANVAL 115
           L++G +DK+IT   L   F   GPI ++K+I D     KN   NY FV Y     A   +
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 116 QTLNGVQLENKTLKINWAFETQQ--------AAENDDTFN---LFVGDL-NVDVDD---- 159
             LNG ++ +  L IN+  + ++        A EN++  N   +F+G+L  V V+     
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 160 -----ETLAGTFRE-FPTF-IQAHVM----WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ 208
                ET+    +E F  F I +H       D ++   +GYGFV  +  EEA + +++  
Sbjct: 290 CGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSFN 349

Query: 209 GKDLSGRQIRINWAT 223
           G +  G ++ +N A 
Sbjct: 350 GYEFHGSKLIVNRAV 364

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 18/84 (21%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVM------------------WDMQTGRSRG 188
           NL+V  + ++  D  L   +R+F   I A V+                    +  G+SRG
Sbjct: 440 NLYVKHIPLEWRDTELFDFYRKFGEIISAKVITVGGSRNNSHVDIGESESGTLVHGQSRG 499

Query: 189 YGFVSFSNQEEAQKAMDAMQGKDL 212
           YGFV F N  +A +A+    G ++
Sbjct: 500 YGFVCFENPVDASRAILGTDGFEI 523

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 4/168 (2%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LYVGN+D  +T + L + F    P+ +++   D +      YAFV      DA+ A+Q L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 119 -NGVQLENKTLKINWAF-ETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH 176
            N V L  + LKI  A  ++ +AA+      L+VG L   VD + LA  F +F    +  
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYRPP 127

Query: 177 VMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            +        R Y  V F +  +A  A+DA+ G  L+G ++ + +A +
Sbjct: 128 TVHPAGEA-GRRYALVEFRSYGDADAALDALAGATLAGGRVSVAYARR 174

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 60/109 (55%), Gaps = 4/109 (3%)

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFI 173
           A+Q +N  +L +  L  N ++      E  D   +F+G LNV++ +  +   F ++   +
Sbjct: 6   AIQRINDTELSSGILSPNLSWHN----EYKDRAYIFIGGLNVELTEADILTIFSQYGIPV 61

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              ++ D +TG S+G+G++ + +Q  A  A+D + G  ++GR I+++ A
Sbjct: 62  DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHA 110

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 71/136 (52%), Gaps = 12/136 (8%)

Query: 100 YAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD------------TFN 147
           Y +V++     A  A++ ++G +++ + + ++ +         +D            +  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+G+L+ + + + +   F E+   +   +    +T + +G+G+V +S+ E AQKA+DA+
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 208 QGKDLSGRQIRINWAT 223
           QG  +  R +R++++T
Sbjct: 131 QGHYIDNRPVRLDFST 146

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (70%)

Query: 183 TGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           T RSRGYG+V F ++  A+KA+  M GK++ GR I ++ +T
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMST 45

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 93/184 (50%), Gaps = 16/184 (8%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVA 114
           S++ +YVGN+D  +T D+L + F    PI ++K  +D +   Y  YAF+++    D    
Sbjct: 10  SNKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFFTEDDVQYV 69

Query: 115 LQTLNG-VQLENKTLKI---NWAF--ETQQAAENDDTFN--------LFVGDLNVDVDDE 160
           ++ +N  V+L  K LK+   N+A    T  A+   +T N        +F+ D++     E
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYALSASTANASNKTETANVEILPVPKVFIKDIDSTTTTE 129

Query: 161 TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
           TL+  F++    ++    + +  G+ R   ++   N +++ KA+  +    +  ++++++
Sbjct: 130 TLSSLFKKIGPVLKEPEFFYLSYGKLRC-AYLYMKNYDDSDKAIKILNNSLVGNKRVKVD 188

Query: 221 WATK 224
           +A K
Sbjct: 189 YAFK 192

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+G+L+ DV ++ L   F  +P+FI A V ++  T  S G+G+++F ++E+A+KA + M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 208 QGKDLSGRQIRI 219
               +   +IRI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 67/162 (41%), Gaps = 11/162 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQTL 118
           L++GNLDK +TE  L+  F       + K+  +   N  + + ++ +    DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDL---NVDVDDETLAGTFREFPTFIQA 175
           N  ++ N  ++I  +       +   T N++  +L   N  +       +FR++   +  
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGT-NVYFRNLPTENNMLTTRYFYDSFRKYGKILSC 209

Query: 176 HVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
            +       RS+  GF+ F+ +  A + +         G  I
Sbjct: 210 KI------ERSKKIGFIYFACEVTANEVIKKFNNSSFLGNNI 245

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 53/72 (73%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V +ETL G F+++P+F+ A V  D  T +S G+G+++F ++EEA+KAM+ +
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 208 QGKDLSGRQIRI 219
               ++G++IRI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 14/181 (7%)

Query: 49  TKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRS 108
           +K    +S   +++ NL    T D +  +F   GPI+++ +    K +Y+ +AFV Y  S
Sbjct: 294 SKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKYL-WAFVTYKNS 352

Query: 109 HDANVALQTLNGVQLENKTLKINWAFETQQAA---ENDDTFNLFVGDLNVDVDDETLA-- 163
            D+  A++  N      K L +  A + ++ A   E+     LF+ +L+   + E L   
Sbjct: 353 SDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKFIESQKISTLFLENLSAVCNKEFLKYL 412

Query: 164 ---GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
                 R F   I  +         S   GF+ F N E+A +  + +  + + G  +  +
Sbjct: 413 CHQENIRPFKIQIDGY-----DENSSTYSGFIKFRNFEDATRIFNFLNNRLVGGSIVTTS 467

Query: 221 W 221
           W
Sbjct: 468 W 468

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/159 (19%), Positives = 75/159 (47%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+L +++TE+ LK  F+      + K+ ++ +  + + + ++ +    +A  A++ L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N  ++  K ++I  +       +N  T N+F  +L +   +  L  T   + TF +   +
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGT-NVFFSNLPL---NNPLLTTRVFYDTFSRYGKI 208

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F +++ A+  +         G++I
Sbjct: 209 LSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKI 247

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 90/186 (48%), Gaps = 24/186 (12%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVA 114
           S   +YVGN+D  IT++ L + F    P+  +K  +D +   Y  YAF+E+    DA  A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 115 LQTLNG-VQLENKTLKINWAFETQQAAENDDTFN---------------LFVGDLNVDVD 158
           ++ +N  V+L ++ +K+      +Q   +  T N               LF+ +L   +D
Sbjct: 67  IKIMNNTVRLYDRLIKV------RQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSID 120

Query: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR 218
            + L   F +F   I+   ++ +  G+ +   +V F + E+A  A+ ++  + ++  +I 
Sbjct: 121 SDQLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRIT 179

Query: 219 INWATK 224
           +++A K
Sbjct: 180 VDYAFK 185

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 85/196 (43%), Gaps = 38/196 (19%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL    T D L+ +F   G +    II   +  +     VE+  + D   A++  +
Sbjct: 121 IFVGNLTYDCTPDDLRDFFSQIGEVVRADIIT-SRGHHRGMGTVEFTNNDDVTEAIRQYD 179

Query: 120 GVQLENKTLKI---NWAFETQQ-------------AAEND-------------------- 143
           G     + + +   N   E+++             AA ND                    
Sbjct: 180 GSDFMERQIFVRQDNPPPESRRERVPPSNDHRDRYAASNDRHSRPYDRASSRNTPSDGNY 239

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D F +FV +L   V+ + L   F+     ++A V  D   GRSRG+G V FSNQE+ ++A
Sbjct: 240 DGFEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRA 298

Query: 204 MDAMQGKDLSGRQIRI 219
           +D   G ++ GR++ +
Sbjct: 299 IDDYNGYEIEGRRLDV 314

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 318 YIGNIPHYATEADLIPLLQNFGFIL------DFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           Y  N+P     +DL  L +  G ++      D  + P  G   I+Y+  E A VCI  L 
Sbjct: 366 YCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQP-TGVAVIEYENIEDADVCIERLN 424

Query: 372 NFPFQGRNLRTGWGKE 387
           N+ + G +L   + K+
Sbjct: 425 NYNYGGCDLVISYAKK 440

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 33/74 (44%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +Y  NL  S     L   F+  G + N ++  D  N+    A +EY    DA+V ++ LN
Sbjct: 365 IYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQPTGVAVIEYENIEDADVCIERLN 424

Query: 120 GVQLENKTLKINWA 133
                   L I++A
Sbjct: 425 NYNYGGCDLVISYA 438

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 79/155 (50%), Gaps = 7/155 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           LY+G+L+K +TED+LK +F     + +VKI ++    E + Y ++      +A+  ++  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAH-V 177
           N   +  K ++I  +    Q  +N  T N+F  DL   + ++++  T R+F  F +A+  
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGT-NVFFSDL--PLSEKSI--TTRDFYNFFKAYGN 215

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL 212
           +   +   S+  GF+ F N+  A++ +      +L
Sbjct: 216 ILSCKLNTSKNIGFIFFENESSAKEVISKFNANEL 250

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
           E+  +  L++GDL   V ++ L   F  + + +   +  D  +G S GYG+++ + +EEA
Sbjct: 94  ESKQSIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEA 153

Query: 201 QKAMDAMQGKDLSGRQIRI 219
              M+      + G+ +RI
Sbjct: 154 DDLMERFNYTPIFGKVVRI 172

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 68/136 (50%), Gaps = 6/136 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+   TED L++YF   G +  VKI+ D        + F+ +  +   +  ++T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           +   L+ K +    +  T +A +      +FV  +  DV  +     F ++ + I A +M
Sbjct: 225 H--ILDGKVIDPKESDPTGRARK---AGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLM 279

Query: 179 WDMQTGRSRGYGFVSF 194
            D  TGRSRG+GF+++
Sbjct: 280 LDKDTGRSRGFGFITY 295

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSF---SNQEEA 200
           D   +F+G LN +  ++ L   F ++    +  +M D  TGRSRG+GF+SF   S+ +E 
Sbjct: 161 DINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEV 220

Query: 201 QKAMDAMQGK 210
            K    + GK
Sbjct: 221 VKTQHILDGK 230

>Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 89/180 (49%), Gaps = 12/180 (6%)

Query: 56  SDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVA 114
           S   +YVGNLD  IT++ L + F    P+  +K  +D +   +  YAF+E+    DA   
Sbjct: 7   SGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDAQYV 66

Query: 115 LQTL-NGVQLENKTLKINW---AFETQQAAEN---DDTF---NLFVGDLNVDVDDETLAG 164
           +Q + N V+L ++ +K+     +  T   A N   D T     LF+ +L   ++ + L  
Sbjct: 67  IQIMHNTVKLYDRLIKVRQVTSSIGTSNLASNSSRDITLPVAKLFIKNLADSINCDQLTK 126

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F +F   I    ++ +  G+ +   +V F + E+A  A+ ++  + ++  +I +++A K
Sbjct: 127 IFNKFGRTISEPKIFHLSNGKLKC-AYVYFEDFEKADLAIKSLDNQLVANSRINVDYAFK 185

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 142 NDDTFN-LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
           N D+ N ++VG+L+  +  E L   F +    ++     D      +GY F+ F N+E+A
Sbjct: 4   NTDSGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDA 63

Query: 201 QKAMDAMQGK-DLSGRQIRINWAT 223
           Q  +  M     L  R I++   T
Sbjct: 64  QYVIQIMHNTVKLYDRLIKVRQVT 87

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 4/107 (3%)

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172
           V L   NG    N  +K   +       E+     LF+GDL   V +  L   F +F + 
Sbjct: 68  VKLNYTNGDSAANVGIKSKLS----STLESKSVVALFIGDLEPSVTENMLRDIFGKFRSL 123

Query: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
               +  D  +G+S GYG+++F+N E+A+KA +    + + G+++RI
Sbjct: 124 TSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEFNYRPIEGQEVRI 170

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 79/159 (49%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQTL 118
           L++G+L+ S+TE++L+  F     + +VKI  D  + + + Y ++ +  S DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N   +E + ++I  +       +N  T N+F  +L ++ D       F  + TF +   +
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGT-NVFFSNLPLE-DSRLTTRVF--YDTFKKYGKI 214

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +  + +  GF+ F+N + A+K +    GK+  G ++
Sbjct: 215 LSCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFGNKV 253

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 77/169 (45%), Gaps = 8/169 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL    T + +  +F   GP+++V   +  K   + +AFV Y R  D + ++Q  N
Sbjct: 310 VFVKNLPMDCTNEEILDFFSNIGPVKSVFSSKAPKFNSL-WAFVTYKRGSDTSKSIQFYN 368

Query: 120 GVQLENKTLKINWAFETQ---QAAENDDTFNLFV--GDLNVDVDDETLAG-TFREFPTFI 173
             + +N+ L ++ A   +   Q+  N   +   V   D++  +++E L+    +E     
Sbjct: 369 DKEFKNRRLIVSKAVPKEGKNQSPSNYKNYKTIVQIDDVSPVLNEEFLSQLCIQERIKIN 428

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
           + H+    +   +   GF+    + +A +   ++  + + G  I+ +W 
Sbjct: 429 KLHITSFNEKTLTYS-GFIKCKTKNDATRVFASLNNRLIGGSVIKCSWG 476

>NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa]
           {ON} Anc_1.357 YFR023W
          Length = 611

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 136 TQQAAEN--DDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVS 193
           T++ AEN    T  L++G L+ DV +ETL   F ++ T     +  D  T  S GYG+++
Sbjct: 89  TKKLAENIKPKTTPLYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLN 148

Query: 194 FSNQEEAQKAMDAMQGKDLSGRQIRI 219
           FSN  EA K +D     +L G +I+I
Sbjct: 149 FSNSVEATKLIDDYNYTNLFGNEIKI 174

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LY+G L K +TE+ L + F+    + ++KI  D + NE + Y ++ +  S +A   +   
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N   L    +KI  +       +N  T N+F  +L ++    T   T + + TF +   +
Sbjct: 163 NYTNLFGNEIKIMPSMRNTLYRKNIGT-NVFFSNLPLENKQLT---TRKFYDTFKKYGEI 218

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F N + A +A+     K   G +I
Sbjct: 219 LSCKLDSRKNIGFVYFENDKAALQAIKDYNNKVFFGNKI 257

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/162 (17%), Positives = 76/162 (46%), Gaps = 1/162 (0%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  +  +D +  +F   GP+++V   + +K   + +AFV Y +S D  +A+Q L+
Sbjct: 313 VFIKNLPMTTNDDEILDFFSKIGPVKSVFASQVLKYNSL-WAFVTYKKSSDTELAIQKLD 371

Query: 120 GVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW 179
               +++ + +  A   +   +  D   +++ +L+   ++  +     +    +Q   + 
Sbjct: 372 QTYFKDRAISVTKAKSKKTNFKIHDKKTVYLKNLSPICNERFIERICLQERIRVQKISVD 431

Query: 180 DMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
            +        GFV+   + +A K  + M  + + G  ++++W
Sbjct: 432 PISPDILTNTGFVTCKTEVDANKLFNFMDKRLIGGCSVQVSW 473

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L  ++  E L   F+ + +FI A V  +    RS G+G+++F N+E+A++A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 208 QGKDLSGRQIRI 219
               + G++IRI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 69/160 (43%), Gaps = 7/160 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM-KNEYVNYAFVEYIRSHDANVALQTL 118
           L+VGNL + IT + L + F+      + K+  +   N  + + ++ +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           N  ++  K ++I  +       +N  T N+F    N+ +  E L  T R F   F +   
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGT-NIFFS--NLPLQKEKL--THRMFYDIFRKYGN 180

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +  ++   S+  GFV F +   A+  +     K+  G  I
Sbjct: 181 VLSVKLDSSKNIGFVYFEDDTIARDVIKEFNNKEFLGNII 220

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 47/79 (59%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
           +N     L++G L   ++ +TL  TF++F +   A V +D  TG S GYG+++F++Q+E 
Sbjct: 81  KNKPMLALYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKEL 140

Query: 201 QKAMDAMQGKDLSGRQIRI 219
            K +D    K + G +I++
Sbjct: 141 DKFVDKYNYKRMLGGEIKL 159

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 67/159 (42%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           LY+G L KSI    L + F+    +Q+ K+  D +  + + Y ++ +    + +  +   
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKELDKFVDKY 147

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N  ++    +K+  +       +N  T N+F  +L +     +   T R +  F +   +
Sbjct: 148 NYKRMLGGEIKLMPSLRNSVYRKNIGT-NVFFSNLPL---HNSGLSTRRFYDIFKKYGKI 203

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F + + A K ++     D  G +I
Sbjct: 204 LSCKLDARKNIGFVYFEDDKAATKVINDFNNTDFYGNKI 242

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 49/78 (62%)

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           +D   +LF+G+L+ +V +E L G F  +P FI A + ++  T +S G+G+++FSN+ +A 
Sbjct: 88  SDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAI 147

Query: 202 KAMDAMQGKDLSGRQIRI 219
           +A   +   ++   +IR+
Sbjct: 148 RATKDLNYCNILSSEIRL 165

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 74/164 (45%), Gaps = 15/164 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           L++GNL K++TE+LL+  F       + KI  + +  + + + ++ +    DA  A + L
Sbjct: 94  LFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDAIRATKDL 153

Query: 119 NGVQLENKTLKI-----NWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFI 173
           N   + +  +++     N A+  Q         N+F+ +L +D+   T    +  F  F 
Sbjct: 154 NYCNILSSEIRLMPSMRNAAYRKQIGT------NVFMSNLPLDIPFLTTRFFYVYFSGFG 207

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +   +    +G GF+ F +   A   ++   G  L G+Q+
Sbjct: 208 E---VLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQV 248

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 18/179 (10%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           D  +++GNL    T + L  +F   G +    II   +  +     VE+      + A++
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITS-RGRHRGMGTVEFTSPEGVDNAIR 176

Query: 117 TLNGVQLENKTLKINWAFETQQAAE---------ND-------DTFNLFVGDLNVDVDDE 160
             NGV+   + L +       +  E         ND         F +F+ +L   +  +
Sbjct: 177 DFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQ 236

Query: 161 TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           TL   FRE    I+A +  D + G SRG+G V +  QEE   A++   G D+ GR +++
Sbjct: 237 TLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 313 RVTTAYIGNIPHYATEADLIPLLQNFGFI------LDFTHYPEKGCCFIKYDTHEQAAVC 366
           R T  Y  N+P      DL  L +  G +       D +  P  G   I+Y+  E A  C
Sbjct: 339 RSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVEDADFC 397

Query: 367 IVALANFPFQGRNLRTGWGK 386
           I  L N+ + G +L   + K
Sbjct: 398 IQRLNNYNYGGCDLDISYAK 417

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 4/97 (4%)

Query: 40  KPSVVPASATK---GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNE 96
           +P   P+  T+   GG E S  ++Y  NL  +     L   F+  G +++ ++  D    
Sbjct: 321 EPPTGPSQFTENVVGGGERS-TLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGA 379

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
               A +EY    DA+  +Q LN        L I++A
Sbjct: 380 PTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISYA 416

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 106 IRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFN-----LFVGDLNVDVDDE 160
           +R  D ++     N VQ + +   ++     ++  E   T N     LF+G L   V +E
Sbjct: 66  VRDQDDSIIDDCSNSVQKKKRHEGVSEKMCVKEGVEKKSTKNSRMSSLFIGKLKSTVTEE 125

Query: 161 TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            L  TF+++ +F  A +  D  T +S GYG+++F N+++A+ A      +   G++++I
Sbjct: 126 MLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKEFNYRIFFGQEVKI 184

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 79/175 (45%), Gaps = 8/175 (4%)

Query: 44  VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAF 102
           V   +TK  R +S   L++G L  ++TE++L++ F+     ++ KI  D +  + + Y +
Sbjct: 100 VEKKSTKNSRMSS---LFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGY 156

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETL 162
           + +    DA  A +  N      + +KI  + +     +N  T N+F  +L +D + +  
Sbjct: 157 LNFGNKKDAEAAKKEFNYRIFFGQEVKIMPSMKNTLFRKNIGT-NVFFSNLPLD-NPQLT 214

Query: 163 AGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
             +F  +   I+   +      + +  GFV F N   A+  +     ++  G ++
Sbjct: 215 TRSF--YLIMIEYGNVLSCLLEKRKNIGFVYFDNDISARNVIKKYNNQEFFGSKV 267

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           + + E DD   L +  LN + D+ TL       F    +A V+ + +TGRSRG  FV+FS
Sbjct: 184 RDSKERDDMCTLKIMQLNENADENTLREELLFPFAPIPKAVVVRNRETGRSRGLAFVTFS 243

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           ++E A+KA+  + G+      +R+ W+
Sbjct: 244 SEEMAEKALHFLDGRGFMNLILRVEWS 270

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 96  EYVNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINWAF--ETQQ 138
            +  Y FVE+    D   AL +LN   + N               +T ++NWA     Q 
Sbjct: 117 HHAGYCFVEFESQQDVIAAL-SLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQS 175

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTF-REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
                  ++LF+GDL+    +  +   F +++ +     VM D   G SRG+GF+ FS++
Sbjct: 176 LIPATPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDE 235

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWAT 223
           +E + A++ M G     R  R+  AT
Sbjct: 236 DERKDALENMNGVMCHSRYFRLALAT 261

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFP 374
           TT +IG +     E +L  L + FG IL       K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 375 FQGRNLRTGWGKERTN 390
             G  +R  WGK   N
Sbjct: 402 INGNPIRLSWGKSNNN 417

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 21/122 (17%)

Query: 116 QTLNGVQLENK---TLKINWAFET-----QQAAENDDTFNL-------FVGDLNVDVDDE 160
           QT   + + NK    L +N    T     QQ+A+N D  NL       F+G L+   ++ 
Sbjct: 297 QTTTNINISNKFIDKLDVNNFIPTSNNSLQQSAQNIDHVNLDNSNTTVFIGGLSTSTNEY 356

Query: 161 TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
            L   F  F   +   +         +  GFV F  + EA  A+  MQG  ++G  IR++
Sbjct: 357 ELQVLFEPFGNILSVKIPI------GKNCGFVKFKRKIEANAAIKGMQGFIINGNPIRLS 410

Query: 221 WA 222
           W 
Sbjct: 411 WG 412

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANV 113
           + S+  +++G L  S  E  L+  F+  G I +VKI         N  FV++ R  +AN 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGK-----NCGFVKFKRKIEANA 392

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAA 140
           A++ + G  +    ++++W      A+
Sbjct: 393 AIKGMQGFIINGNPIRLSWGKSNNNAS 419

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 52/72 (72%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL+  V +ETL   F+++P+F+ + V  D  T +S G+G+++F ++EEA+KAM+ +
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 208 QGKDLSGRQIRI 219
               ++G++IRI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 84/195 (43%), Gaps = 13/195 (6%)

Query: 31  NASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKII 90
           N  Q   +D+ S+   S+++         +++ NL    T D +  +F   GPI+++ + 
Sbjct: 283 NEKQLKGNDRQSMSTPSSSQNS-------IFIKNLPTITTRDDILNFFSEVGPIKSIYLS 335

Query: 91  EDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA---ENDDTFN 147
              K +Y+ +AFV Y  + D+  A++  N      + L +  A   ++ A   E+     
Sbjct: 336 NATKVKYL-WAFVTYKSNDDSEKAIKRYNNFYFRGRKLLVTRAQGKEERAKYIESQKIST 394

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGY-GFVSFSNQEEAQKAMDA 206
           LF+ +L+   + E L     +        +  D     S  Y G++ F N E+A +  + 
Sbjct: 395 LFLENLSAVCNKEFLKYLCHQ-ENIRPFKIQIDRYDENSSTYSGYIKFRNFEDATRIFNF 453

Query: 207 MQGKDLSGRQIRINW 221
           +  + + G  +  +W
Sbjct: 454 LNSRLVGGSIVMTSW 468

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 78/159 (49%), Gaps = 5/159 (3%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+LD+++TE+ LK+ F+      + K+ ++ +  + + + ++ +    +A  A++ L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVM 178
           N  ++  K ++I  +       +N  T N+F  +L +   +  L  T   + TF +   +
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGT-NVFFSNLPL---NNPLLTTRVFYDTFSRYGKI 208

Query: 179 WDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
              +    +  GFV F +++ A+  +      +  G++I
Sbjct: 209 LSCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (44%), Gaps = 20/176 (11%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL      + LK+YF   G +    II   +  +     VE+  + D + A++  +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITS-RGHHRGMGTVEFTNADDVDEAIRRFD 222

Query: 120 GVQLENKTLKIN---------------WAFETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
           G  L ++ + +                     Q +A     + +F+ +L   V+ + L  
Sbjct: 223 GSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPG---YEVFIANLPYSVNWQALKD 279

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
            F+E    ++A V  D + G SRGYG V +  +EE Q A++   G +L GR + ++
Sbjct: 280 MFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           ++FVG+L  D   E L   F +    ++A ++     G  RG G V F+N ++  +A+  
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTNADDVDEAIRR 220

Query: 207 MQGKDLSGRQIRI 219
             G  L  R+I +
Sbjct: 221 FDGSTLLDREIFV 233

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFI----LDFTHYPE-KGCCFIKYDTHEQAAVCIVA 369
           +T ++ N+P    ++DL  L +  G +    L F +  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 370 LANFPFQGRNLRTGW 384
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 1/119 (0%)

Query: 104 EYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLA 163
           E I  H A   +  L   ++EN+ L +    +   +        LFV  LN   + + LA
Sbjct: 201 ELIEKHQAKSKMSLLKS-EIENQELALEIIGDIPSSTIKPLKTVLFVCKLNAMTNAKDLA 259

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
             F  F   I   ++ D  TGRS GYGF+ F ++   + A   M+G  +  ++I ++++
Sbjct: 260 QIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDFS 318

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 5/98 (5%)

Query: 44  VPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM-KNEYVNYAF 102
           +P+S  K  +     VL+V  L+       L Q F   G I +V+I+ D      + Y F
Sbjct: 232 IPSSTIKPLK----TVLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGF 287

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAA 140
           +E+       +A   + GV +++K + ++++    + A
Sbjct: 288 IEFDSEGAVELAYSNMEGVIIDDKKIHVDFSQSVSKLA 325

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 7/160 (4%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKI-IEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           L++G+LDK +TE +L   F     + +VKI I+    + + Y ++ +  + +A+ A++  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF-PTFIQAHV 177
           + V+L  K ++I  +       +N  T N+F  +L +    E  A T R F  +F +   
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGT-NVFFTNLPL----ENPALTTRVFYESFRKYGR 210

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           +   +  R +  GFV F +   A+KA+D    ++  G +I
Sbjct: 211 VLSCKLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKI 250

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 44/73 (60%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           +LF+GDL+  V ++ L   F  F T     +  D +T +S GYG+++F++ +EA +A++ 
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 207 MQGKDLSGRQIRI 219
                L G+++RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 1/88 (1%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL   +  + L  YF   GPI++V           ++ F+ Y RS D   AL+ LN
Sbjct: 306 VHVKNLPIGVCNEDLLNYFSKVGPIKSV-YTSKADVYTTSWGFITYKRSRDTIRALEELN 364

Query: 120 GVQLENKTLKINWAFETQQAAENDDTFN 147
           G     K +++  A +     ++  T N
Sbjct: 365 GAIFMGKRVEVTRAVKYNGERKSTSTNN 392

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           NLFV +L+  VDDE L   F  F T I A VM   + G+S+ +GFV FS  EEA +A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRT-EDGKSKNFGFVCFSTPEEATRAITE 80

Query: 207 MQGKDLSGRQIRINWATK 224
              + ++G+ + +  A +
Sbjct: 81  KNQQIVAGKPLYVAIAQR 98

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           L+V NLD S+ ++ L++ F   G I + K++     +  N+ FV +    +A  A+   N
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

Query: 120 GVQLENKTLKINWA 133
              +  K L +  A
Sbjct: 83  QQIVAGKPLYVAIA 96

>NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON}
           Anc_8.797
          Length = 258

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 90/195 (46%), Gaps = 18/195 (9%)

Query: 46  ASATKGGRETSDRVL--YVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAF 102
            S++K   + S+  L  YVGN+D ++T+  L + F    PI  +   +D +   +  YAF
Sbjct: 35  CSSSKMNSQMSNPELSVYVGNIDPNVTKAQLYELFVQVSPISKIAYPKDKLLQTHQGYAF 94

Query: 103 VEYIRSHDANVALQTLNG-VQLENKTLKI-----------NWAFETQQAAENDDTFNLFV 150
           +E+    D N  ++ +N  V L ++ LK+           N  + T +  E      +FV
Sbjct: 95  IEFYTPEDTNYVVKVMNNTVSLYDRFLKVRKSVQNLPSSNNKTYTTSKQVEVLPIAKVFV 154

Query: 151 GDLNVDVDDETLAGTFREF-PTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQG 209
            +L+  VD + L+  F +F P F +  + +         + F  F    +A  A+  +  
Sbjct: 155 KNLDESVDIQQLSNIFEKFGPLFKEPEIFYLSNNTLRCAHIFFKFYPDSDA--AIGKLDN 212

Query: 210 KDLSGRQIRINWATK 224
           + ++ ++I +++A K
Sbjct: 213 ELIANKRINLDYAYK 227

>ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} similar
           to uniprot|Q99181 Saccharomyces cerevisiae YOR319W
          Length = 210

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 90/190 (47%), Gaps = 21/190 (11%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYI 106
           ++   R+TS   +YVGN+D  +T+  L + F    PI+ ++  +D +   +  YAFVE+ 
Sbjct: 2   SSNSNRDTS---IYVGNIDPKVTKAQLYELFVQISPIRRIRYPKDKVLQIHQGYAFVEFY 58

Query: 107 RSHDANVALQTLNG-VQLENKTLKINWAFETQQAAENDDTFN-----------LFVGDLN 154
              D    L+ +N  V L ++TL+I            +++ N           +FV +++
Sbjct: 59  SVEDVQYVLRVMNNVVSLYDRTLRIRRV----NGPGTNNSVNAKELSLLPLAKVFVKNVD 114

Query: 155 VDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSG 214
             +D+  L+  F +F        ++ +  G+ R   FV F +   +  A+ ++  + +  
Sbjct: 115 ESIDNVHLSKIFGKFGPLASLPEIFYLSHGQLRC-AFVYFRDYTHSDAAIKSLDNQLVVN 173

Query: 215 RQIRINWATK 224
           R+I +++A K
Sbjct: 174 RRINLDYAIK 183

>CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q04067 Saccharomyces
           cerevisiae YDR429c TIF35
          Length = 274

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 1/87 (1%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           + A E DD+  L +  LN + D+ TL       F    +  V+ + +TGRSRG  FV+F 
Sbjct: 180 RDARERDDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFI 239

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           N++ A+KA+  + G+      +R++W+
Sbjct: 240 NEDMAEKALHFLDGRGFMNLILRVDWS 266

>NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}
           Anc_1.408 YCL011C
          Length = 464

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 85/192 (44%), Gaps = 34/192 (17%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL    T + L++YF   G +    II   K  +     VE+  S D   A++  +
Sbjct: 112 IFVGNLTYDCTPEDLREYFSGIGEVVRADIIT-SKGHHRGMGTVEFTNSKDVEDAIRQYD 170

Query: 120 G---------VQLEN-------------KTLKINWAFETQQAAE----------NDDTFN 147
           G         V+ +N             +++  +  ++ + ++           N   + 
Sbjct: 171 GSYFLDRQIFVRQDNPPPDGGRSSRRSDESISSSRGYQDKSSSSYDRAPSTRQPNRQGYK 230

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+ +L   ++ + L   F+EF   ++A +  D + GRSRG+G V    +   +KA+  +
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSR-GRSRGFGTVILREKSAMEKAIATL 289

Query: 208 QGKDLSGRQIRI 219
            G ++ GR+I +
Sbjct: 290 NGTEMEGRRIDV 301

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           ++Y  NL  S     L   F++ G I N ++  + K E  + A VEYI   DA+V ++ L
Sbjct: 387 LIYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERL 446

Query: 119 NGVQLENKTLKINWA 133
           NG       L+I++ 
Sbjct: 447 NGYNYGGCELQISYG 461

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 318 YIGNIPHYATEADLIPLLQNFGFILDFT-HYPEKGC----CFIKYDTHEQAAVCIVALAN 372
           Y  N+P     +DL  L ++ G I +    Y +KG       ++Y   E A VCI  L  
Sbjct: 389 YCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLNG 448

Query: 373 FPFQGRNLRTGWGK 386
           + + G  L+  +GK
Sbjct: 449 YNYGGCELQISYGK 462

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 39/96 (40%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  SI    LK  F+  G +    I  D +     +  V          A+ TLN
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVILREKSAMEKAIATLN 290

Query: 120 GVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNV 155
           G ++E + + +   +  +Q   +    N +  D+N 
Sbjct: 291 GTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINT 326

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 82/170 (48%), Gaps = 30/170 (17%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VA 114
           +R +Y+GNL K++  + +    + GG +QN+K++ D      +  FV +I    A    A
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIR-GGLLQNIKLLNDR-----HVCFVTFIDPTAAAQFYA 524

Query: 115 LQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVDVD--------- 158
           + +L+G+ + NK  KI W   +         A     + N+++G++N + D         
Sbjct: 525 MSSLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAKQEESVFA 584

Query: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ 208
           ++TL   F EF T  Q + +++      +   F++F+N   A  A+D ++
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYE------KNCCFINFANISNAILAIDKIK 628

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAV--CI 367
           AP R  T Y+GNIP   T   L+  ++  G + +     EK C F+ +     A +    
Sbjct: 230 APSR--TVYLGNIPATITYKALLDYVRT-GVVEEVKILSEKMCAFVSFVDENDALLFHSD 286

Query: 368 VALANFPFQGRNLRTGWGK 386
             L      GR+++ GWGK
Sbjct: 287 AILKRLNIDGRDIKIGWGK 305

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 1/62 (1%)

Query: 328 EADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 387
           E  L  + + FG +       EK CCFI +     A + I  + + P    NL+  +GK+
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP-HFNNLKINFGKD 643

Query: 388 RT 389
           R 
Sbjct: 644 RC 645

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/200 (19%), Positives = 86/200 (43%), Gaps = 34/200 (17%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++ +S+T++ L  +F    PI++  +++D+  +   + FV +    D  +AL+ 
Sbjct: 22  KTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD----------TFNLFVGDLNVDVDDETLAGTFR 167
               +L+   LK++ A    ++ +N+D          +     GD N +  +E  +   +
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 168 EFPTFIQAHVMW-------------------DMQTGRSR-----GYGFVSFSNQEEAQKA 203
             P  I  ++ W                   D    R R     G+ FV+ +     +KA
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 204 MDAMQGKDLSGRQIRINWAT 223
           ++  +   + GR++ +++A 
Sbjct: 202 LEDTKNLTIDGRKVAVDFAV 221

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%)

Query: 146 FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMD 205
           F++FV ++  D  +E+L   F +F     A  + D  TG ++G  FV+F +++  +  +D
Sbjct: 290 FSVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVD 349

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 87/190 (45%), Gaps = 31/190 (16%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           G     +R +Y+GNL K +  + +    + GG +QNVK++ D      +  FV +I    
Sbjct: 444 GPNNLGNRTVYLGNLPKDVKVEEICNVVR-GGLLQNVKVLSDR-----HVCFVTFIDPTA 497

Query: 111 AN--VALQTLNGVQLENKTLKINWAFETQQ-------AAENDDTFNLFVGDLNVDVDDET 161
           A    A+ +L+G+ ++ +  ++ W             A  N  + N++VG++N D D + 
Sbjct: 498 AAQFYAMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSK- 556

Query: 162 LAGTFREFPTFIQAHV-----MW----DMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL 212
                RE P F ++ +      W     +     R   FV+++N   A  A+D ++G  +
Sbjct: 557 -----REDPIFTESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV 611

Query: 213 SGRQIRINWA 222
             + ++IN+ 
Sbjct: 612 F-KDLKINFG 620

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 317 AYIGNI----------PHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVC 366
            Y+GNI          P + TE+ L  + Q +G +    + PE+ CCF+ Y     A + 
Sbjct: 544 VYVGNINFDEDSKREDPIF-TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILA 602

Query: 367 IVALANFPFQGRNLRTGWGKERT 389
           I  +   P   ++L+  +GK+R 
Sbjct: 603 IDKIKGHPVF-KDLKINFGKDRC 624

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 316 TAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI---VALAN 372
           T Y+GN P   T  +L+  +++ G + D    P+K C F+ +   E AA+       L  
Sbjct: 211 TVYLGNTPITLTVKELLDHVRS-GVVEDVRILPDKMCAFVSF-VDESAALLFHSDAILKR 268

Query: 373 FPFQGRNLRTGWGK 386
               GR+++ GWGK
Sbjct: 269 LHIDGRDIKIGWGK 282

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 86/248 (34%), Gaps = 72/248 (29%)

Query: 40  KPSVV-PASATKGGRETSDRVLYVGNLDKS----------------ITEDLLKQYFQAGG 82
           KP+ + P  AT    + + R +Y+G L+                  ITED L+   Q  G
Sbjct: 282 KPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVTEPVITEDKLRLDLQEFG 341

Query: 83  PIQNVKIIEDMKNEYVNY--------------------------------AFVEYIRSHD 110
            I  +KI+E+    +V++                                AF+   + H+
Sbjct: 342 EIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGKDRCAFITKTQQHN 401

Query: 111 ANVALQTLNG----VQLENKTLKINWAFETQQ----------AAENDDTFNLFVGDLNVD 156
           A   L    G    VQ  +  L  N   +                N     +++G+L  D
Sbjct: 402 AAQFLGVQPGMERLVQFSDSELISNALLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPKD 461

Query: 157 VDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQK--AMDAMQGKDLSG 214
           V  E +    R         ++ +++    R   FV+F +   A +  AM ++ G  +  
Sbjct: 462 VKVEEICNVVR-------GGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLHGITIQK 514

Query: 215 RQIRINWA 222
           R+ R+ W 
Sbjct: 515 RRCRVGWG 522

>AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL004W (HRB1) and
           YCL011C (GBP2)
          Length = 337

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 15/173 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++GNL    T + L+Q F   G +    II   +  +     VEY  + D + A++  N
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHVVRADIITS-RGHHRGMGTVEYTNAQDVDEAIRRFN 67

Query: 120 GVQLENKTLKINW-----AFETQQAA--------ENDDTFNLFVGDLNVDVDDETLAGTF 166
           G+   ++ L +         E ++           +   F +FV +L   +  +TL   F
Sbjct: 68  GMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLKDMF 127

Query: 167 REFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           +E    I A V  D   G SRG+G V  + +E    A++   G +L GR + +
Sbjct: 128 KECSEVIHADVSVDAD-GYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           ++F+G+L  D   E L   F E    ++A ++     G  RG G V ++N ++  +A+  
Sbjct: 8   SVFIGNLTYDTTPEDLRQLFGEVGHVVRADII--TSRGHHRGMGTVEYTNAQDVDEAIRR 65

Query: 207 MQGKDLSGRQI 217
             G D   R++
Sbjct: 66  FNGMDFMHREL 76

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 17/175 (9%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++GNL  + T + LK+YF   G ++   II   +  +     VE+  S D + A++  +
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIIT-SRGHHRGMGTVEFNNSTDVDTAIRDCD 201

Query: 120 GVQLENKTLKIN---------------WAFETQQAAENDDTFNLFVGDLNVDVDDETLAG 164
           G  L  + + +                          +D+ F +FV  L   V+ + L  
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKD 261

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
            F+     + A V+ D + G+SRG+G V  + +E+   A+    G +  GR + +
Sbjct: 262 MFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDV 315

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 43  VVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAF 102
           + P + T GG   S  V++  N+  S TE  L   F +  P+   K++ + +  +   ++
Sbjct: 353 IDPLAITTGGDRNS--VIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSY 410

Query: 103 VEYIRSHDANVALQTLNGVQLENKTLKINWA 133
            ++    DA++ +  L+     +  LK+ +A
Sbjct: 411 CQFETPEDADICISKLDKYSYGDHELKVTYA 441

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           ++F+G+L  +   E L   F +     +A ++     G  RG G V F+N  +   A+  
Sbjct: 142 SIFIGNLTYNTTPEDLKEYFGKIGEVRRADII--TSRGHHRGMGTVEFNNSTDVDTAIRD 199

Query: 207 MQGKDLSGRQI 217
             G  L+GR I
Sbjct: 200 CDGAFLNGRAI 210

>Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON}
           YCL011C (REAL)
          Length = 433

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 81/182 (44%), Gaps = 15/182 (8%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIR 107
           ATK   E S   ++V NL    T + LK+ F   G I    II   K  +     VE+  
Sbjct: 119 ATKRNFENS---IFVRNLTFDCTPEDLKELFGTVGEILEADIITS-KGHHRGMGTVEFTN 174

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFETQQAA----------ENDDTFNLFVGDLNVDV 157
           +     A+   +G    ++ L +       +A+          E D+ F +F+ +L   +
Sbjct: 175 NEAVQDAISKFDGALFMDRKLMVRQDNPPPEASKEFSKKATREEVDNGFEVFIINLPYSI 234

Query: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           + ++L   F+E    ++A V  D   G SRG+G V +  ++E  +A+D   G ++ GR +
Sbjct: 235 NWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTKDEMMRAIDTFNGMEVEGRVL 293

Query: 218 RI 219
            +
Sbjct: 294 EV 295

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 44/109 (40%), Gaps = 2/109 (1%)

Query: 37  DDDKPSVVPASATKGGRETSDR--VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK 94
           D+  P      + K  RE  D    +++ NL  SI    LK  F+  G +    +  D  
Sbjct: 200 DNPPPEASKEFSKKATREEVDNGFEVFIINLPYSINWQSLKDMFKECGHVLRADVELDFN 259

Query: 95  NEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAEND 143
                +  V Y    +   A+ T NG+++E + L++       +  +ND
Sbjct: 260 GFSRGFGSVIYPTKDEMMRAIDTFNGMEVEGRVLEVREGRFNNRRKDND 308

>KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 432

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 86/181 (47%), Gaps = 13/181 (7%)

Query: 54  ETSDRVLYVGNL----DKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSH 109
           + +D  ++V N     D S   +LL QY  +  PI ++++     N    +A+V+ +   
Sbjct: 109 QLTDSTIWVTNFPPGYDASKLRNLLSQYIDS--PILSIRLPSLAFNSRRRFAYVDLVSPE 166

Query: 110 DANVALQTLNGVQLENKTL--KINWAFETQQAAEN--DDTFNLFVGDLNVDVDDETLAGT 165
            A  A   LNG+++ N  L  KI+   E  +  +N   D   + V +L  D+  + L   
Sbjct: 167 VAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIKM 226

Query: 166 FREFPTFIQAHVMWDMQT--GRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWAT 223
           F EF    +A ++   +T  GR   Y F++F N+  A  A+ ++ G  ++G+ + ++   
Sbjct: 227 FNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNAL-SLNGAVMNGKPLHVSKVM 285

Query: 224 K 224
           +
Sbjct: 286 R 286

>YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}
           GBP2Poly(A+) RNA-binding protein, involved in the export
           of mRNAs from the nucleus to the cytoplasm; similar to
           Hrb1p and Npl3p; also binds single-stranded telomeric
           repeat sequence in vitro
          Length = 427

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIR 107
           ATK   E S   ++V NL    T + LK+ F   G +    II   K  +     VE+ +
Sbjct: 115 ATKRNFENS---IFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-KGHHRGMGTVEFTK 170

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFETQQAA----------ENDDTFNLFVGDLNVDV 157
           +     A+   +G    ++ L +       +AA          E D+ F +F+ +L   +
Sbjct: 171 NESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSM 230

Query: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           + ++L   F+E    ++A V  D   G SRG+G V +  ++E  +A+D   G ++ GR +
Sbjct: 231 NWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 289

Query: 218 RI 219
            +
Sbjct: 290 EV 291

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 46  ASATKGGRETSDR--VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFV 103
           A  T+G     DR   +Y  NL  S     L   F   G I N ++      +    A V
Sbjct: 335 AKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVV 394

Query: 104 EYIRSHDANVALQTLNGVQLENKTLKINWA 133
           EY    DA+  +Q LN       +L+I++A
Sbjct: 395 EYENLVDADFCIQKLNNYNYGGCSLQISYA 424

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+GDL  +V ++ L   F +F +F    +  D  T +S GYG+++F + ++A+ A+D  
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 208 QGKDLSGRQIRI 219
               + GR+IR+
Sbjct: 200 NYMPIFGREIRM 211

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 79/170 (46%), Gaps = 9/170 (5%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL  + + D L  +F   GP+++V    D+     ++AF+ Y R  D   A++ LN
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEKLN 446

Query: 120 GVQLENKTLKINWA----FETQQAAENDDTFN----LFVGDLNVDVDDETLAGTFREFPT 171
           G +   +T+++        E  Q   N    N    +F+ +L+V  ++E L     +   
Sbjct: 447 GCKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQERI 506

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
             +  V+   +       G+V  +++ +AQ+  + M+ K L   +++ +W
Sbjct: 507 KTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASW 556

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 79/176 (44%), Gaps = 8/176 (4%)

Query: 38  DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMK-NE 96
           + K S    +  K  ++T+   L++G+L  ++TED+L   F       +VKI  D    +
Sbjct: 121 NSKHSTQQTNTMKSEKQTA---LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKK 177

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVD 156
            + Y ++ +    DA  A+   N + +  + +++  +       +N  T N+F  +L +D
Sbjct: 178 SLGYGYLNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGT-NVFFSNLPLD 236

Query: 157 VDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDL 212
               T    + EF  F +   +   +  R +  GF+ F N   A++A+    GK+ 
Sbjct: 237 NTKLTTRVFYDEFKKFGK---ILSCKLDRRKNIGFIYFENDAAAKEAIKQYNGKEF 289

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 86/180 (47%), Gaps = 16/180 (8%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           +YVGN+D  +T++ L + F    PI  ++  +D +   +  YAF+E+  + D    +Q +
Sbjct: 12  VYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVM 71

Query: 119 NG-VQLENKTLKINWAFET-------QQAAENDD------TFNLFVGDLNVDVDDETLAG 164
           N  V L ++ LK+  + +           +EN +         LFV +L+  +++  L  
Sbjct: 72  NNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQLIK 131

Query: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            F++F    +   ++ +  G+ R   ++ F   E +  A+  +  + +  ++I +++A K
Sbjct: 132 LFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINVDYAFK 190

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 10/113 (8%)

Query: 40  KPSVVPASATKGGRETSDRV----------LYVGNLDKSITEDLLKQYFQAGGPIQNVKI 89
           + SV   +++ GG  TS+            L+V NLD+SI    L + FQ  GP+     
Sbjct: 85  RQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQLIKLFQKFGPLFKDPE 144

Query: 90  IEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAEN 142
           I  + N  +  A++ +    ++++A+  LN   + NK + +++AF+   + +N
Sbjct: 145 IFFLSNGKLRCAYIYFKFYENSDMAIAKLNNELIVNKRINVDYAFKENTSNKN 197

>Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}
           YCL011C (REAL)
          Length = 428

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 82/182 (45%), Gaps = 15/182 (8%)

Query: 48  ATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIR 107
           ATK   E S   ++V NL  + T + LK+ F   G I    II   K  +     VE+  
Sbjct: 116 ATKRNFENS---IFVRNLTFNCTPEDLKELFGTVGEIVEADIITS-KGHHRGMGTVEFTN 171

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFETQQAA----------ENDDTFNLFVGDLNVDV 157
           +     A+   +G    ++ L +       +AA          E D+ F +F+ +L   +
Sbjct: 172 NEAVQDAISKFDGALFMDRKLMVRQDNPPPEAAREFSKKATKEEIDNGFEVFIINLPYSI 231

Query: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           + ++L   F+E    ++A V  D   G SRG+G V +  ++E  +A+D   G ++ GR +
Sbjct: 232 NWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 290

Query: 218 RI 219
            +
Sbjct: 291 EV 292

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 46  ASATKGGRETSDR--VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFV 103
           A  T+G     DR   +Y  NL  S     L   F   G I N ++      +    A V
Sbjct: 336 AKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQDNGQPTGIAVV 395

Query: 104 EYIRSHDANVALQTLNGVQLENKTLKINWA 133
           EY    DA+  +Q LN       +L+I++A
Sbjct: 396 EYENLVDADFCIQKLNNYNYGGCSLQISYA 425

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 114 ALQTLNGVQLENKTLK--INWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPT 171
           ++Q L+  +LE   L    +W FE +  A       +FVG L+ D+ +  +   F ++  
Sbjct: 6   SIQNLSFRELEQGILSPTASWHFEYKDQA------YIFVGGLHKDLTEGDILTIFSQYGI 59

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
            +   ++ D ++G S+G+ ++ + +Q     A+D + G  ++GR IR++
Sbjct: 60  PVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 47/74 (63%), Gaps = 3/74 (4%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQT 117
           ++VG L K +TE D+L  + Q G P+ ++K++ D ++ E   +A+++Y       +A+  
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPV-DLKLVRDRESGESKGFAYLKYEDQRSTVLAVDN 94

Query: 118 LNGVQLENKTLKIN 131
           LNGV++  ++++++
Sbjct: 95  LNGVKIAGRSIRVD 108

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV  +  DV DE L G F  F     A V+ D+   +SRG+GFVSF+ +E+ + A
Sbjct: 20  DMKTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNK-KSRGFGFVSFATEEDTKDA 78

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +   +   L+G  +R++ A +
Sbjct: 79  LGKARRSKLNGNVLRVDIAKR 99

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/196 (17%), Positives = 77/196 (39%), Gaps = 30/196 (15%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++   +T++ L  +F    P ++  +++D+  +   + FV +    D   AL  
Sbjct: 22  KTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNKKSRGFGFVSFATEEDTKDALGK 81

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTFNL-----FVGDLNVD-VDDETLAGTFREFPT 171
               +L    L+++ A    +  +N +   +      +GD  V+  DDE     F+  P 
Sbjct: 82  ARRSKLNGNVLRVDIAKRRDRNKKNGEEKAISLPLDTIGDKEVEQSDDEEEDSQFKGKPK 141

Query: 172 FIQAHVMWDMQT------------------------GRSRGYGFVSFSNQEEAQKAMDAM 207
            I  ++ W  +                         G+  G+ FV+       + A++  
Sbjct: 142 LIIRNMPWSCRDPNKLKKIFGRFGNVVEASIPRKRDGKLCGFAFVTMKKISNCRLALENT 201

Query: 208 QGKDLSGRQIRINWAT 223
           +   + GR + +++A 
Sbjct: 202 KDLKIDGRNVAVDFAV 217

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 146 FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQE 198
           +++FV ++  D   E+L   F +F     A  + D +TG ++G  FV+F N+E
Sbjct: 292 YSVFVRNVPYDATKESLVDHFSKFGPVKYALPVIDRETGLAKGTAFVAFRNEE 344

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLA-GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E DD   L +  LN + D+ T+       FP   +  V+ + +TGRSRG  +V+F+++++
Sbjct: 183 ERDDAMTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKD 242

Query: 200 AQKAMDAMQGKDLSGRQIRINWA 222
           A+ A+  + G+      ++++W+
Sbjct: 243 AETALRLLHGRGFMNLILQVDWS 265

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 18/106 (16%)

Query: 44  VPASATKGGRETSDRV------------LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIE 91
           VP S   GGR+ S  V            L +  L+++  E  +KQ   +  P  NV  + 
Sbjct: 162 VPPSRRAGGRDPSSDVYKDQRERDDAMTLKIMQLNENADEMTIKQKLLS--PFPNVPRVA 219

Query: 92  DMKNEYVN----YAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
            ++N+        A+V +    DA  AL+ L+G    N  L+++W+
Sbjct: 220 VVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWS 265

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 81/181 (44%), Gaps = 23/181 (12%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL    T + L+ +F   G +    II   +  +     VE+  + D N A+   +
Sbjct: 70  VFVGNLTYDCTPEDLRDHFSTIGEVVRADIITS-RGHHRGMGTVEFTNADDVNEAISQYD 128

Query: 120 GVQLENKTLKINWAFETQQAAE---------------NDDT------FNLFVGDLNVDVD 158
           G  L ++ + +       +A+                ND +      + +F+ +L   ++
Sbjct: 129 GSYLLDRQIFVRQDNPPPEASHESEPPRERRERRTLGNDGSLHSHIGYEVFIANLPYSIN 188

Query: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR 218
            + L   F+E  + I+A V  D + G SRG+G V   +QE+ ++A+    G +L GR + 
Sbjct: 189 WQALKDMFKECGSVIRADVELD-RNGYSRGFGTVILGSQEDMERAISMYNGYELEGRVLE 247

Query: 219 I 219
           +
Sbjct: 248 V 248

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 318 YIGNIPHYATEADLIPLLQNFGFI----LDFTHYPE-KGCCFIKYDTHEQAAVCIVALAN 372
           Y  N+P    ++DL  L +  G +    L F       G   ++Y+  + A VC+  L N
Sbjct: 301 YCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVDRLNN 360

Query: 373 FPFQGRNLRTGWGK 386
           + + G +L   +GK
Sbjct: 361 YNYGGCDLDISYGK 374

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 71/199 (35%), Gaps = 35/199 (17%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++ NL  SI    LK  F+  G +    +  D       +  V      D   A+   N
Sbjct: 178 VFIANLPYSINWQALKDMFKECGSVIRADVELDRNGYSRGFGTVILGSQEDMERAISMYN 237

Query: 120 GVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREF---------- 169
           G +LE + L++       Q  E   + ++ + D   D++DE  AGT  +F          
Sbjct: 238 GYELEGRVLEVREGRSNNQDEEMPISEDIEINDNGNDINDEN-AGTSDQFTDGVVGGGEK 296

Query: 170 ---------PTFIQAHVMWDM---------------QTGRSRGYGFVSFSNQEEAQKAMD 205
                    P       ++D+               Q G   G   V + N ++AQ  +D
Sbjct: 297 NELIYCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVD 356

Query: 206 AMQGKDLSGRQIRINWATK 224
            +   +  G  + I++  +
Sbjct: 357 RLNNYNYGGCDLDISYGKR 375

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 1/111 (0%)

Query: 24  SQEVE-GDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGG 82
           S+++E  DN +  ND++  +    +    G    + ++Y  NL  S  +  L   F+  G
Sbjct: 263 SEDIEINDNGNDINDENAGTSDQFTDGVVGGGEKNELIYCSNLPFSTAKSDLFDLFETIG 322

Query: 83  PIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
            ++N ++  D K      A VEY    DA V +  LN        L I++ 
Sbjct: 323 KLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVDRLNNYNYGGCDLDISYG 373

>Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W
           (REAL)
          Length = 670

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 68/134 (50%), Gaps = 11/134 (8%)

Query: 91  EDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNL-- 148
           E+MK+  +N+A    ++S + N   +  N  Q + +  +++    +++  E   T NL  
Sbjct: 67  ENMKS--MNFA----VKSGNDNRKHECRNATQEKKEQEQVSEKRVSKEGVEKRSTKNLKI 120

Query: 149 ---FVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMD 205
              F+G+L   V +E L   FR++ +F  A +  D  T +S GYG+++F N+ E + A  
Sbjct: 121 STLFIGNLKPTVTEEMLRKIFRKYQSFESAKICRDFLTKKSLGYGYLNFKNKNETEAARK 180

Query: 206 AMQGKDLSGRQIRI 219
                   G++++I
Sbjct: 181 EFNYTVFFGQEVKI 194

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 85/196 (43%), Gaps = 10/196 (5%)

Query: 28  EGDNASQENDDDKPSVVPASATKGGRETSDR-----VLYVGNLDKSITEDLLKQYFQAGG 82
           E  NA+QE  + +       + +G  + S +      L++GNL  ++TE++L++ F+   
Sbjct: 86  ECRNATQEKKEQEQVSEKRVSKEGVEKRSTKNLKISTLFIGNLKPTVTEEMLRKIFRKYQ 145

Query: 83  PIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAE 141
             ++ KI  D +  + + Y ++ +   ++   A +  N      + +KI  + +     +
Sbjct: 146 SFESAKICRDFLTKKSLGYGYLNFKNKNETEAARKEFNYTVFFGQEVKIMPSMKNTLFRK 205

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           N  T N+F  +L +D    T   T + +   I+   +      + +  GFV F N   A+
Sbjct: 206 NIGT-NVFFSNLPLDNPQLT---TRKFYLIMIEYGNVLSCLLEKRKNIGFVYFDNDISAR 261

Query: 202 KAMDAMQGKDLSGRQI 217
             +     ++  G  I
Sbjct: 262 NVIKKYNNQEFFGNII 277

>KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} similar
           to uniprot|P40565 YIR005W Saccharomyces cerevisiae IST3
           Component of the U2 snRNP required for the first
           catalytic step of splicing and for spliceosomal assembly
          Length = 134

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 60/109 (55%), Gaps = 8/109 (7%)

Query: 114 ALQTLNGVQLENKTL--KINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPT 171
           ++Q L+  +LEN  L  K +W  E +      D   +++G LN ++ +  +   F ++  
Sbjct: 6   SIQNLSLRELENGVLSPKASWHHEYR------DQAYVYIGGLNKELTEGDVLTVFSQYGV 59

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
            +  +++ D +TG S+G+ ++ F +Q  +  A+D + G  ++GR I+++
Sbjct: 60  PVDINLVRDRETGESKGFCYLKFEDQRSSILAVDNLNGAVVAGRAIKVD 108

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQT 117
           +Y+G L+K +TE D+L  + Q G P+ ++ ++ D +  E   + ++++     + +A+  
Sbjct: 36  VYIGGLNKELTEGDVLTVFSQYGVPV-DINLVRDRETGESKGFCYLKFEDQRSSILAVDN 94

Query: 118 LNGVQLENKTLKIN 131
           LNG  +  + +K++
Sbjct: 95  LNGAVVAGRAIKVD 108

>ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR005W (IST3)
          Length = 173

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 59/109 (54%), Gaps = 8/109 (7%)

Query: 114 ALQTLNGVQLENKTL--KINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPT 171
           ++Q L+  +LE+  L  + +W ++ +     D  +  F G LNV++ +  +   F +F  
Sbjct: 6   SIQKLSETELEHGILSEEASWHYQYK-----DQAYIHFSG-LNVELTEGDILTVFSQFGV 59

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
                ++ D +TG SRG+GF+ + +Q     A+D + G +L GR ++++
Sbjct: 60  PTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKVD 108

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQT 117
           ++   L+  +TE D+L  + Q G P  ++K++ D +  E   + F++Y       +A+  
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPT-DLKLVRDRETGESRGFGFLKYEDQRSTVLAVDN 94

Query: 118 LNGVQLENKTLKINWAF 134
           LNGV L  + LK++  F
Sbjct: 95  LNGVNLCGRVLKVDHCF 111

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 68/131 (51%), Gaps = 7/131 (5%)

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQA-----AENDDTFNLFVG 151
           Y+++  +E + S  A ++   LNG +L  K+   ++A    ++     ++N  +  LFVG
Sbjct: 181 YIDFKTLEQMESAIA-LSETELNGRKLLIKS-STDYAGRPDKSDLVSMSKNPPSRILFVG 238

Query: 152 DLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKD 211
           +L+ D  DE L   F+     ++  +     +G+ +G+ FV F N+E A KA+     + 
Sbjct: 239 NLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDKSCRK 298

Query: 212 LSGRQIRINWA 222
           ++GR +R+ + 
Sbjct: 299 IAGRPLRMEFG 309

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L+ D  D+ L   F+     I+  +     TG+ +G+ FV F N+E A KA+   
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 208 QGKDLSGRQIRINWA 222
             + ++GR +R+ + 
Sbjct: 284 SCRKIAGRPLRMEFG 298

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQ-------QAAENDDTFNLF 149
           YV++  +E + S    ++   LNG  L    +K +  FE +        A++N  +  LF
Sbjct: 162 YVDFKTIEQMESA-VKLSESQLNGRNL---LIKNSKNFEGRPDKDDLVAASKNPPSRILF 217

Query: 150 VGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQG 209
           VG+L+ D  D+ L   F+     I+  +     +G+ +G+ FV F  ++ A  A+     
Sbjct: 218 VGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDKSC 277

Query: 210 KDLSGRQIRINWA 222
           + ++GR IR+ + 
Sbjct: 278 RKIAGRSIRMEYG 290

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 52/97 (53%), Gaps = 8/97 (8%)

Query: 39  DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKI--IEDMKNE 96
           DK  +V AS     +    R+L+VGNL    ++DLL+++FQ  G I  V++   +D   +
Sbjct: 200 DKDDLVAAS-----KNPPSRILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDS-GK 253

Query: 97  YVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
              +AFV++     A  AL+  +  ++  +++++ + 
Sbjct: 254 CKGFAFVDFKEEQGATNALKDKSCRKIAGRSIRMEYG 290

>Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON}
           YCL011C (REAL)
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 77/170 (45%), Gaps = 12/170 (7%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL  + T + LK+ F   G I    II   K  +     VE+  +     A+   +
Sbjct: 126 IFVRNLTFNCTPEDLKELFGTVGEIVEADIITS-KGHHRGMGTVEFTNNESVQDAISKFD 184

Query: 120 GVQLENKTLKINWAFETQQAA----------ENDDTFNLFVGDLNVDVDDETLAGTFREF 169
           G    ++ L +       +AA          E D+ F +F+ +L   ++ ++L   F+E 
Sbjct: 185 GALFMDRKLMVRQDNPPPEAAKEFSKKATKEEIDNGFEVFIINLPYSINWQSLKDMFKEC 244

Query: 170 PTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
              ++A V  D   G SRG+G V +  ++E  +A+D   G ++ GR + +
Sbjct: 245 GHVLRADVEVDF-NGFSRGFGSVIYPTKDEMIRAIDTFNGMEVEGRVLEV 293

>SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 817

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 59/236 (25%)

Query: 42  SVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKII-EDMKNEYVNY 100
           SV P + T  G       LY+  + K +T D L   F   GP+ ++KII      + + Y
Sbjct: 187 SVNPHALTHPGN------LYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGY 240

Query: 101 AFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQ---------AAENDDT--FNLF 149
            F+ +     A + ++ LNG  + +  L IN+  E ++           +NDD     +F
Sbjct: 241 GFISFPLGSQAALCIKELNGNLMNSSPLFINYHVERKERERIHWDHVKEDNDDERFRGIF 300

Query: 150 VGDLNV-DVDDETLA--GTFREFPTFI-----------------------QAHVMW---- 179
           +G+L   D   E L   G   +F   +                       ++H+ +    
Sbjct: 301 IGNLPTNDASGELLTPEGVITKFKQELNDGEDGEQKEYEIVSYCFPKRNSKSHIEYKDED 360

Query: 180 ----DMQTGRS-------RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
               +++T  S       RGYGF+ FS  ++A KA++  +  + SG ++ +N A +
Sbjct: 361 DMRDNVETCESQYEESPLRGYGFIKFSTHDQALKAIEKCRELEWSGNKLIVNKAVQ 416

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L+ D  DE L   F+     ++        TG+ +G+ F+ F  +E A KA+   
Sbjct: 224 LFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDK 283

Query: 208 QGKDLSGRQIRINWA 222
             + ++GR IR+ + 
Sbjct: 284 SCRKIAGRPIRMEYG 298

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 90/205 (43%), Gaps = 32/205 (15%)

Query: 47  SATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAG---GPIQNVKIIE------------ 91
           +ATK  +E S   +++GNL    T+D L ++F A       +  ++I+            
Sbjct: 114 AATKKKKEESKYGVWIGNLSFDTTKDDLVRFFIAKTRDNEDEKSRVIQQDITRLSMPRVA 173

Query: 92  -----DMKNEYVNYAFVEYIRSHDANVALQT--LNGVQLENKTLKINWAFETQQAAE--- 141
                 M+N+   Y F + +    A + L    LNG    N  +K +  F  +   E   
Sbjct: 174 SKNSNSMQNKGFCYMFFKNVEQMKAVLELSESHLNG---RNMLIKDSENFSGRPDKEDFV 230

Query: 142 ----NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
               N  +  LFVG+L+ DV D+ L   F+     ++  +     +G+ +G+ F+ F N+
Sbjct: 231 AMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNE 290

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWA 222
           E +  A+     + ++GR +R+ + 
Sbjct: 291 EGSTNALKDKSCRKIAGRPLRMEYG 315

>NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa]
           {ON} Anc_4.33 YHL024W
          Length = 626

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 43  VVPASATKGGRETSDRVLYVGNLDKSITEDLL----KQYFQAGGPIQNVKIIEDMKNEYV 98
           + PA  TK  R      ++V +L  ++T+D L      YF+  G I  VK++ D  N   
Sbjct: 43  IPPAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQANR-- 100

Query: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLK 129
            YAFV+Y    DAN AL+T +G  L  + L+
Sbjct: 101 PYAFVQYTNDKDANNALKTAHGSLLNGRRLR 131

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 148 LFVGDLNVDVDDETLAGT----FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           +FV  L   + D+ L  +    F++F   ++  V+ D     +R Y FV ++N ++A  A
Sbjct: 60  VFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQA---NRPYAFVQYTNDKDANNA 116

Query: 204 MDAMQGKDLSGRQIR 218
           +    G  L+GR++R
Sbjct: 117 LKTAHGSLLNGRRLR 131

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + ++VG L +  T++ L+ +F   G I ++ +I    N +   AF++Y     A  AL+T
Sbjct: 277 KSIFVGQLPQETTKEDLETHFWKHGKILDLNLIHKPTNVF---AFIQYESEKSAAAALET 333

Query: 118 LNGVQLENKTLKINW 132
            N     +KT+ + +
Sbjct: 334 ENHSIFISKTIHVQY 348

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 316 TAYIGNIPHYATEADLIPLLQNFGFILDFT--HYPEKGCCFIKYDTHEQAAVCI 367
           + ++G +P   T+ DL       G ILD    H P     FI+Y++ + AA  +
Sbjct: 278 SIFVGQLPQETTKEDLETHFWKHGKILDLNLIHKPTNVFAFIQYESEKSAAAAL 331

>CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {ON}
           similar to uniprot|P40565 Saccharomyces cerevisiae
           YIR005w IST3
          Length = 169

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 4/107 (3%)

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFI 173
           A+Q +N  +LE   LK   ++      E  D   +F+G LN  + +  L   F ++   +
Sbjct: 6   AIQRINEKELEAGILKPEHSWH----QEYKDQAYIFIGGLNRQLTEGDLLTIFSQYGVPV 61

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
              ++ D +T  S+G+ F+ + +Q     A+D + G  ++GRQI+++
Sbjct: 62  DVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKVD 108

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L++ +TE DLL  + Q G P+  + + +   +E   +AF++Y       +A+  L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 119 NGVQLENKTLKINWAFET 136
           NG+ +  + +K++  F T
Sbjct: 96  NGITVAGRQIKVDHIFFT 113

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 6/71 (8%)

Query: 318 YIGNIPHYATEADLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           +IG +    TE DL+ +   +G       + D   +  KG  F+KY+      + +  L 
Sbjct: 37  FIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLN 96

Query: 372 NFPFQGRNLRT 382
                GR ++ 
Sbjct: 97  GITVAGRQIKV 107

>Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON}
           similar to Ashbya gossypii ADR189W
          Length = 270

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLA-GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E DD   L +  LN + D+ T+       F T  +  V+ + +TGRSRG  +V+FS++ E
Sbjct: 184 ERDDAMTLKITQLNENADEMTIKQKLLTPFQTIPRVAVVRNKETGRSRGIAYVTFSSEHE 243

Query: 200 AQKAMDAMQGKDLSGRQIRINWA 222
           A+ A+  + G+      +   W+
Sbjct: 244 AETALRLLDGRGFMNLILHAEWS 266

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 18/106 (16%)

Query: 44  VPASATKGGRETSD------------RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIE 91
           VP S   GGR+ S               L +  L+++  E  +KQ      P Q +  + 
Sbjct: 163 VPPSRRAGGRDPSSDAYKDQRERDDAMTLKITQLNENADEMTIKQKLLT--PFQTIPRVA 220

Query: 92  DMKNEYVN----YAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
            ++N+        A+V +   H+A  AL+ L+G    N  L   W+
Sbjct: 221 VVRNKETGRSRGIAYVTFSSEHEAETALRLLDGRGFMNLILHAEWS 266

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           + + E DD   L +  LN + D+ TL       F    +  V+ + +TGRSRG  FV+FS
Sbjct: 182 RDSRERDDMATLKITQLNENADETTLREELLFPFGNIPRVVVVRNRETGRSRGLAFVTFS 241

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           ++E A+KA   + G+      ++++W+
Sbjct: 242 SEEVAEKARRLLNGRGFMNLILQVDWS 268

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 88/195 (45%), Gaps = 45/195 (23%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VA 114
           +R +Y+GNL K +  + +    + GG +Q+VK++ D      +  FV +I    A    A
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVR-GGLLQSVKLLSDR-----HVCFVTFIDPTAAAQFYA 453

Query: 115 LQTLNGVQLENKTLKINWAFETQQ-------AAENDDTFNLFVGDLNVDVDDET------ 161
           + +L+G+ + NK  KI W   +         A  +  + N++VG+++ +  DET      
Sbjct: 454 MSSLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDETGETIFT 513

Query: 162 ---LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ---------- 208
              L  TF+EF    Q + + +      +   F++F+N   A  A+D ++          
Sbjct: 514 EQNLRETFQEFGEVEQINFLHE------KNCCFINFTNISNAILAIDKIKCNPYFKNLKV 567

Query: 209 --GKDLSG---RQIR 218
             GKD  G   RQ R
Sbjct: 568 NFGKDRCGNVPRQFR 582

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GNIP +     L+  +++ G I +    P++ C FI +   E +A+    
Sbjct: 158 APSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFHS 213

Query: 368 -VALANFPFQGRNLRTGWGK 386
              L     +GR+++ GWGK
Sbjct: 214 DAILKRLNIEGRDIKVGWGK 233

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 10/80 (12%)

Query: 318 YIGNIPHYA---------TEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 368
           Y+GNI   A         TE +L    Q FG +       EK CCFI +     A + I 
Sbjct: 495 YVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAID 554

Query: 369 ALANFPFQGRNLRTGWGKER 388
            +   P+  +NL+  +GK+R
Sbjct: 555 KIKCNPY-FKNLKVNFGKDR 573

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV  + +DV DE LA  F  F     A V+ D+   +SRG+GFVSF+ +++ ++A
Sbjct: 24  DMKTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEA 82

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +   +   L G  +R++ A +
Sbjct: 83  LKQARKAKLKGHLLRVDIAKR 103

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/196 (17%), Positives = 78/196 (39%), Gaps = 31/196 (15%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++   +T++ L  YF    P ++  +++D+  +   + FV +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 118 LNGVQLENKTLKINWAFETQQA--------AENDDTFNLFVGDLNVDVDDET-------- 161
               +L+   L+++ A    ++         E     +    D N +VD+E+        
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESLLKGKPKL 145

Query: 162 --------------LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
                         L   F  F T ++A +    + G+  G+ FV+         A++  
Sbjct: 146 IIRNMPWSCRDPNQLKKIFSRFGTVVEASI-PKKRDGKLCGFAFVTMKKLSNCTIALENT 204

Query: 208 QGKDLSGRQIRINWAT 223
           +   + GR + +++A 
Sbjct: 205 KDLKIDGRSVAVDFAV 220

>TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON}
           Anc_5.536 YDR429C
          Length = 278

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E DD   L +  LN + D+ TL       F    +  V+ + +TGRSRG  FV+F+++E 
Sbjct: 187 ERDDMATLKITQLNENADENTLREELLFPFAPIPKVVVVRNRETGRSRGLSFVTFASEEI 246

Query: 200 AQKAMDAMQGKDLSGRQIRINWA 222
           A++A+  + G+      +R+ W+
Sbjct: 247 AEQALHFLDGRGFMNLILRVEWS 269

>KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.536
           YDR429C
          Length = 279

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E DD+  L +  LN + D+ TL       F    +  V+ + +TGRSRG  FV+FS+++ 
Sbjct: 189 ERDDSCTLKILQLNENADENTLREELLFPFAPIQRVVVVRNRETGRSRGLAFVTFSSEQL 248

Query: 200 AQKAMDAMQGKDLSGRQIRINWA 222
           A+KA+  + G+      +++ W+
Sbjct: 249 AEKALQFLDGRGFMNLILKVEWS 271

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV  +  DV DE LA  F  F     A V+ D+   RSRG+GFVSF+ +++ ++A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNK-RSRGFGFVSFAVEDDTKEA 82

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +   +    +G  +R++ A +
Sbjct: 83  LAKARKTKFNGHSLRVDVAKR 103

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%)

Query: 136 TQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           T++     + F++FV ++  D  +E+LA  F +F +   A  + D  TG ++G  FV+F 
Sbjct: 282 TRKVQNKREDFSIFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFK 341

Query: 196 NQ 197
           +Q
Sbjct: 342 DQ 343

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/76 (19%), Positives = 37/76 (48%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++ + +T++ L  +F    PI++  +++D+      + FV +    D   AL  
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 118 LNGVQLENKTLKINWA 133
               +    +L+++ A
Sbjct: 86  ARKTKFNGHSLRVDVA 101

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+  LN     E +A  F  F   +   ++ D +TG S GYGF+ F  +E  ++A   M
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 208 QGKDLSGRQIRINWA 222
               +  R+I ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/91 (17%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 50  KGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRS 108
           K G + ++ VL++  L+     + +   F+  G + +V+I+ D K    + Y F+E+   
Sbjct: 233 KAGIKPAENVLFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETK 292

Query: 109 HDANVALQTLNGVQLENKTLKINWAFETQQA 139
                A   ++   ++++ + ++++    +A
Sbjct: 293 EACEQAYSKMDNTLIDDRRIHVDFSQSIAKA 323

>ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa]
           {ON} similar to uniprot|Q04067 YDR429C Saccharomyces
           cerevisiae TIF35 Subunit of the core complex of
           translation initiation factor 3(eIF3)
          Length = 273

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 139 AAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQ 197
           A E DD   L +  LN++ D+ TL       F    +  V+ + +TGRSRG  FV+F+++
Sbjct: 183 ARERDDMSTLKITQLNLNADENTLREELLFPFAPIPKVVVVRNRETGRSRGLSFVTFASE 242

Query: 198 EEAQKAMDAMQGKDLSGRQIRINWA 222
           E A++A+  + G+      + + W+
Sbjct: 243 EIAEQALHFLNGRGFMNLILHVEWS 267

>NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON}
           Anc_1.408 YCL011C
          Length = 359

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 73/174 (41%), Gaps = 13/174 (7%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQ 116
           D  ++VGNL    T + L  YF   G +    II   K  +     VE+  + DA  A++
Sbjct: 67  DNRVFVGNLSFDTTAEDLVDYFSQVGEVVTADIIT-FKGRHKGLGTVEFTNADDATEAIE 125

Query: 117 TLNGVQLENKTLKI-------NWAFETQQAAE----NDDTFNLFVGDLNVDVDDETLAGT 165
             +      + + +           +T + A     N   +  FV +L   +  + L   
Sbjct: 126 RCDNTHFMGRDIYVKDDQPPPGARQKTMRIAPIRDINRQGYEAFVINLPYSITWQNLKDL 185

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           FRE    ++A +  D   G SRG G V ++ ++   +A+D   G +L GR + +
Sbjct: 186 FRECGDILRADIELDYN-GFSRGLGSVLYATEDAMHRAIDTFNGYELEGRVLEV 238

>Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354)
           [417 nt, 139 aa]
          Length = 138

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 55/107 (51%), Gaps = 4/107 (3%)

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFI 173
           A+Q +N  +LEN  L  + ++         D   +++G LN D+ +  +   F +F   +
Sbjct: 6   AIQKINENELENGVLSPSLSWHDTYK----DQAYIYIGRLNKDLTEGDILTVFSQFGVPV 61

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
              ++ + +TG SRG+ ++ + +Q     A+D + G +++G  I ++
Sbjct: 62  DIKLVRENETGSSRGFAYLKYEDQRSTILAVDNLNGAEIAGNAIVVD 108

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           +Y+G L+K +TE D+L  + Q G P+    + E+       +A+++Y       +A+  L
Sbjct: 36  IYIGRLNKDLTEGDILTVFSQFGVPVDIKLVRENETGSSRGFAYLKYEDQRSTILAVDNL 95

Query: 119 NGVQLENKTLKIN 131
           NG ++    + ++
Sbjct: 96  NGAEIAGNAIVVD 108

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFI 173
           ++Q L+  +LE   LK     E+    E  D   +  G +++++ +  +   F ++   +
Sbjct: 6   SIQKLSERELECGILKP----ESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPV 61

Query: 174 QAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              ++ D  TG+S+G+GF+ + +Q     A+D + G  + GR IR++ A
Sbjct: 62  DIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHA 110

>ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar to
           uniprot|P25299 Saccharomyces cerevisiae YGL044C RNA15
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           interacts with the A-rich polyadenylation signal in
           complex with Rna14p and Hrp1p
          Length = 271

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 49  TKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIR 107
           T GG+    RV+Y+G++    TE+ +       GP+ N+K++ D    +   YAFVEY  
Sbjct: 4   TSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKD 63

Query: 108 SHDANVALQTLNGVQLENKTLKINWAFET 136
              +  A++ LNG Q  ++ LK  +A  T
Sbjct: 64  LESSASAVRNLNGYQFGSRLLKCGYATGT 92

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 311 PPRVTTAYIGNIPHYATEADLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAA 364
           P RV   Y+G+IP+  TE  ++ L  N G       + D      KG  F++Y   E +A
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSA 68

Query: 365 VCIVALANFPFQGRNLRTGWG 385
             +  L  + F  R L+ G+ 
Sbjct: 69  SAVRNLNGYQFGSRLLKCGYA 89

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +++G +  D  +E +              +M+D QTG+S+GY FV + + E +  A+  +
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSASAVRNL 74

Query: 208 QGKDLSGRQIRINWAT 223
            G     R ++  +AT
Sbjct: 75  NGYQFGSRLLKCGYAT 90

>YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON}
           Putative RNA binding protein; localizes to stress
           granules induced by glucose deprivation; interacts with
           Rbg1p in a two-hybrid
          Length = 781

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 90/222 (40%), Gaps = 57/222 (25%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           ++VG + KS++   L   F   GPI ++K+I D  K E   Y F+ Y     A++ ++ L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKEL 256

Query: 119 NGVQLENKTLKINWAFETQQAAE----------NDDTFN-LFVGDLN------------- 154
           NG  +   TL IN+  E ++             NDD F  LF+G+L              
Sbjct: 257 NGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLITP 316

Query: 155 ---VDVDDETLAGTFREFPTF-----------------------IQAHVMWDMQTGRS-- 186
              ++V  + L+  F +F                          ++++   +   G +  
Sbjct: 317 KEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNAQD 376

Query: 187 ----RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
               +GYGF+   N E+A  A++   G    G ++ +N A +
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQ 418

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF+S+    +A   +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 207 MQGKDLSGRQIRINW 221
           + G+ ++G  + IN+
Sbjct: 256 LNGRTVNGSTLFINY 270

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 19/90 (21%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW-------------------DMQTGRSR 187
           NL+V  + +   DE L   ++ F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSR 600

Query: 188 GYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           GYGFVSF +  +A KA+    G  +S  Q+
Sbjct: 601 GYGFVSFESPLDAAKAILNTDGYQVSKDQV 630

>Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 89/222 (40%), Gaps = 57/222 (25%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           ++VG + KS++   L   F   GP+ ++K+I D  K E   Y F  Y     A++ ++ L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIREL 256

Query: 119 NGVQLENKTLKINWAFETQQAAE----------NDDTFN-LFVGDLN------------- 154
           NG  +   TL IN+  E ++             NDD +  LF+G+L              
Sbjct: 257 NGKTVSGSTLFINYHVERKERERIHWDHVKENNNDDNYRCLFIGNLPYHNTEKEESLITP 316

Query: 155 ---VDVDDETLAGTFREFPTF-----------------------IQAHVMWDMQTGRS-- 186
              +DV    L+  F +F                          + ++ + ++  G +  
Sbjct: 317 KDVIDVIKRELSKRFSDFDIISYYFPKKSNARSSSSVSFQDDGSVDSNKISNITAGAAQE 376

Query: 187 ----RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
               +GYGF+   N E+A  A++   G    G ++ +N A +
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIEIFNGFMWHGNRLVVNKAVQ 418

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF S+    +A   +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIRE 255

Query: 207 MQGKDLSGRQIRINW 221
           + GK +SG  + IN+
Sbjct: 256 LNGKTVSGSTLFINY 270

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVM-------------------WDMQTGRSR 187
           NL+V  + +   DE L G ++ F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDSSSDSDLPVGSSR 600

Query: 188 GYGFVSFSNQEEAQKAMDAMQGKDLSGRQI-RINWATK 224
           GYGFVSF +  +A KA+    G  +S  Q+  +++A K
Sbjct: 601 GYGFVSFESPLDAAKAISNTDGYQVSKDQVLSVSFAQK 638

>TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa]
           {ON} Anc_1.408 YNL004W
          Length = 345

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 76/180 (42%), Gaps = 22/180 (12%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           +++GNL    T + LK +F   G +    II   +  +     VE+  S D + A++  +
Sbjct: 48  IFIGNLTYDCTPEDLKDHFSEVGEVVRADIITS-RGHHRGMGTVEFTNSDDVDEAIRRYD 106

Query: 120 GVQLENKTLKINW------------AFETQQAAENDD--------TFNLFVGDLNVDVDD 159
                ++ + +                E ++  +  D         + +FV +L   ++ 
Sbjct: 107 SSYFMDRQVFVRQDNPPPESARERPPREARERVKARDQYPQHQYPAYEVFVANLPYSINW 166

Query: 160 ETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + L   F+E    I+A V  D + G SRG+G   F   EE Q A++   G +L GR + +
Sbjct: 167 QALKDMFKEVGNVIRADVELD-RNGYSRGFGTAIFGTSEEMQAAIERYNGYELEGRVLDV 225

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           GG E ++ ++Y  NL  S     L   F+  G + N ++  D   + +  A VEY    D
Sbjct: 261 GGGERNN-LIYCTNLPLSTATSDLYDLFETIGKVNNAELKYDADGQPLGIAVVEYANIED 319

Query: 111 ANVALQTLNGVQLENKTLKINWA 133
           A+V ++ LN        L I++A
Sbjct: 320 ADVCMERLNNYNYGGCDLDISYA 342

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           ++F+G+L  D   E L   F E    ++A ++     G  RG G V F+N ++  +A+  
Sbjct: 47  SIFIGNLTYDCTPEDLKDHFSEVGEVVRADII--TSRGHHRGMGTVEFTNSDDVDEAIRR 104

Query: 207 MQGKDLSGRQI 217
                   RQ+
Sbjct: 105 YDSSYFMDRQV 115

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 139 AAENDDTFN---LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           + +NDD  +   LFV  +  DV DE LA  F  F     A V+ D    RSRG+GFVSF+
Sbjct: 16  SKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWATK 224
            +++ ++A+   +    +G  +R++ A +
Sbjct: 75  VEDDTKEALAKARKTKFNGHILRVDIAKR 103

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 135 ETQQAAEND-DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVS 193
           E+++ A+N  + F++FV ++  D  +E+LA  F +F +   A  + D  TG ++G  FV+
Sbjct: 278 ESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVA 337

Query: 194 FSNQ 197
           F +Q
Sbjct: 338 FKDQ 341

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/108 (20%), Positives = 44/108 (40%), Gaps = 15/108 (13%)

Query: 26  EVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQ 85
           EV   N S++NDD                   + L+V ++ + +T++ L  +F    PI+
Sbjct: 9   EVPSSNVSKQNDDG---------------LDMKTLFVRSIPQDVTDEQLADFFSNFAPIK 53

Query: 86  NVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA 133
           +  +++D       + FV +    D   AL      +     L+++ A
Sbjct: 54  HAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKARKTKFNGHILRVDIA 101

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHV 177
           +  V +E++ L   W+    + A      NL++  +  D+  + L   F  F   +   +
Sbjct: 202 IKNVLIESENLVQRWSISINKHALTHPG-NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKI 260

Query: 178 MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221
           + D+ TG S GYGF+SF    EA   ++ + G  ++G  + IN+
Sbjct: 261 ICDLITGESLGYGFISFKLGSEASNCINKLNGTAMNGSTLFINY 304

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 7/108 (6%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM-KNEYVNYAFVEYIRSHDANVALQTL 118
           LY+  + K +T D LK  F   G + ++KII D+   E + Y F+ +    +A+  +  L
Sbjct: 231 LYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINKL 290

Query: 119 NGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTF 166
           NG  +   TL IN+  E ++  +      +F  +   + DD    G F
Sbjct: 291 NGTAMNGSTLFINYHVERKEREK------VFWNNFKENNDDNKFKGIF 332

>Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 87/225 (38%), Gaps = 63/225 (28%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDANVALQTL 118
           ++VG + K ++   L   F   GP+ ++K+I D  K +   Y F  Y     A+V ++ L
Sbjct: 196 IFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKEL 255

Query: 119 NGVQLENKTLKINWAFETQQAAE----------NDDTFN-LFVGDLN------------- 154
           NG  +   TL IN+  E ++             NDD F  LF+G+L              
Sbjct: 256 NGSTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPDKEEALITP 315

Query: 155 ---VDVDDETLAGTFREFPTF-IQAHVMWDMQTGRS------------------------ 186
              +DV  + L+   R FP F I ++        RS                        
Sbjct: 316 KEVIDVIKKELS---RNFPDFDIISYYFPKRSNTRSSSSVSFNDEGSIDSSKFSLNANGP 372

Query: 187 -------RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
                  +GYGF+   N E+A  A++   G    G ++ +N A +
Sbjct: 373 AQDEDMLKGYGFIKLINHEQALAAIETFNGYMWHGNRLVVNKAVQ 417

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW-------------------DMQTGRSR 187
           NL+V  + +   DE L G ++ F   I   V+                    D+  G SR
Sbjct: 540 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDTSSDSDLPVGSSR 599

Query: 188 GYGFVSFSNQEEAQKAMDAMQGKDLSGRQI-RINWATK 224
           GYGFVSF +  +A KA+    G  +   Q+  +++A K
Sbjct: 600 GYGFVSFESPLDAAKAILNTDGYQVGKDQVLSVSFAQK 637

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           N+FVG +   +    L+  F ++       +++D   G + GYGF S+    +A   +  
Sbjct: 195 NIFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKE 254

Query: 207 MQGKDLSGRQIRINW 221
           + G  ++G  + IN+
Sbjct: 255 LNGSTVNGSTLFINY 269

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 68/148 (45%), Gaps = 20/148 (13%)

Query: 90  IEDMKNEY--VNYAFVEYIRSHDANVALQTLNGVQLEN---------------KTLKINW 132
           ++ +K+E+   NY  VE+    +A  AL TLNG+ L N                  ++NW
Sbjct: 89  VDSIKSEHKQANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRLNW 147

Query: 133 AFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGF 191
           A        + + + LFVG+L+    +  L   FR  + +     +M +   G+S  +GF
Sbjct: 148 AVWPTVNGLSPE-YPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDSFGF 206

Query: 192 VSFSNQEEAQKAMDAMQGKDLSGRQIRI 219
           + F+N EE + A + M G     + I++
Sbjct: 207 ICFANCEERRLAAEEMNGICFQDKYIKV 234

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 83  PIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL-NGVQLENKTLKINWAFETQQAAE 141
           P++N+  +    N+ +    +  ++   A +AL T+  G    N  ++       Q    
Sbjct: 252 PVKNIPPLIKTANDLLTNN-LNAVQEQTAQLALSTVVTGNLRSNGNIR-------QGLGS 303

Query: 142 NDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
           N     +FVG L+ DV ++ L   FR F       +M D++    +  GFV+F  + +A+
Sbjct: 304 NSKNSTIFVGGLSTDVSEQELNELFRPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAK 357

Query: 202 KAMDAMQGKDLSGRQIRINWA 222
            A+  + G  + G  IR++W 
Sbjct: 358 AAIKGLHGFLVRGCPIRLSWG 378

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDA 111
           G  + +  ++VG L   ++E  L + F+  G I +VKI    K       FV + R  DA
Sbjct: 302 GSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKK-----CGFVTFKRRIDA 356

Query: 112 NVALQTLNGVQLENKTLKINWA 133
             A++ L+G  +    ++++W 
Sbjct: 357 KAAIKGLHGFLVRGCPIRLSWG 378

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%)

Query: 315 TTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFP 374
           +T ++G +    +E +L  L + FG I+D      K C F+ +     A   I  L  F 
Sbjct: 308 STIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFL 367

Query: 375 FQGRNLRTGWGKERTN 390
            +G  +R  WGK   N
Sbjct: 368 VRGCPIRLSWGKTFNN 383

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L+ D  DE L   F+     ++  +     +G+ +G+ FV F N+E A  A+   
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 208 QGKDLSGRQIRINWA 222
             + ++GR +R+ + 
Sbjct: 285 SCRKIAGRPLRMEFG 299

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 83/177 (46%), Gaps = 30/177 (16%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           G     +R +Y+GNL K I  + +    + GG +Q+VK++ D    YV   FV +I    
Sbjct: 441 GPNNLGNRTVYLGNLPKDIKIEEICNVVR-GGLLQSVKLLSD---RYV--CFVTFIDPTA 494

Query: 111 AN--VALQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVDVD--- 158
           A    A+ +L+G+ ++ K  K+ W   +         A  N  + N+++G++N + D   
Sbjct: 495 AAQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIGNINFEKDAMR 554

Query: 159 ------DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQG 209
                 +++L   FR++    Q + + +      +   F++F+N   A  A+D ++ 
Sbjct: 555 DPRIFTEDSLRKLFRQYGEVEQINFLPE------KNCCFINFTNISNAILALDKIKS 605

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GNIP   T  +L+  +++ G + D    PEK C FI +   E +A+    
Sbjct: 211 APSR--TVYLGNIPSNLTVKELLDHVRS-GVVEDVKIIPEKLCAFISF-VDESSALLFHS 266

Query: 368 -VALANFPFQGRNLRTGWGKERT 389
              L      G++++ GWGK  T
Sbjct: 267 DAILKRLNIGGKDIKIGWGKPTT 289

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 10/82 (12%)

Query: 317 AYIGNI---------PHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI 367
            YIGNI         P   TE  L  L + +G +      PEK CCFI +     A + +
Sbjct: 541 VYIGNINFEKDAMRDPRIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILAL 600

Query: 368 VALANFPFQGRNLRTGWGKERT 389
             + + P    +L+  +GK+R 
Sbjct: 601 DKIKSNP-HFEDLKINFGKDRC 621

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 327 TEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 386
           TEA L   L++FG I      PEKG  F+ + +   A  C+  L +      N +  +GK
Sbjct: 326 TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPYYENKKIAYGK 385

Query: 387 ERTNF 391
           +R  F
Sbjct: 386 DRCAF 390

>Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {ON}
           [contig 116] FULL
          Length = 330

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+  LN     + LA  F  F T  +  ++ D +TG S  YGF+ F+N+   + A   M
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 208 QGKDLSGRQIRINWA 222
           +G  +  R+I +++ 
Sbjct: 309 EGVLIDDRRIHVDFC 323

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHD 110
           G + S++VL++  L+       L   F   G I+ V+I+ D +    ++Y F+E+     
Sbjct: 241 GIKPSEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSS 300

Query: 111 ANVALQTLNGVQLENKTLKINWAFETQQA 139
              A   + GV ++++ + +++   T++A
Sbjct: 301 CEAAYSKMEGVLIDDRRIHVDFCQSTRRA 329

>SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {ON}
           conserved hypothetical protein
          Length = 340

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFV  LN     + LA  F  F   +   ++ D  TG S GYGF+ FS Q+  + A   M
Sbjct: 246 LFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSKM 305

Query: 208 QGKDLSGRQIRINWA 222
            G  +  R+I ++++
Sbjct: 306 DGVLVDDRRIHVDFS 320

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM-KNEYVNYAFVEYIRSH 109
            G +  + VL+V  L+       L   F   G I +V+I+ D      + Y F+E+    
Sbjct: 237 AGVKPLENVLFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQK 296

Query: 110 DANVALQTLNGVQLENKTLKINWAFETQQAAEN 142
              +A   ++GV ++++ + ++++    + A++
Sbjct: 297 ACELAYSKMDGVLVDDRRIHVDFSQSVSRLADS 329

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+  LN     + +A  F+ F       ++ D  TG S GYGF+ F++++  ++A   M
Sbjct: 244 LFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKSCEQAYKKM 303

Query: 208 QGKDLSGRQIRINWA 222
           +G  +  R+I ++++
Sbjct: 304 EGVIIDDRRIHVDFS 318

>CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {ON}
           similar to uniprot|P38922 Saccharomyces cerevisiae
           YNL004w HRB1
          Length = 443

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 75/183 (40%), Gaps = 25/183 (13%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL    T + LK +F   G +    II   +  +     VE+    + + A++  +
Sbjct: 109 IFVGNLTYDCTPEDLKDFFSQVGKVVRADIITS-RGHHRGMGTVEFTSGEEVDEAIRKFD 167

Query: 120 GVQLENKTLKI-----------------------NWAFETQQAAENDDTFNLFVGDLNVD 156
           G  L N+ + +                       N     +        + L + +L   
Sbjct: 168 GAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYELMILNLPYS 227

Query: 157 VDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQ 216
           +  +TL   F+EF   ++A+V  D  TG S G G V F NQE+  KA +   G ++ G+ 
Sbjct: 228 ISWQTLKTMFKEFGDVLKANVEVD-STGMSIGVGNVIFKNQEDMVKAYEHFNGFEIEGKV 286

Query: 217 IRI 219
           + +
Sbjct: 287 LEV 289

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204
           T ++FVG+L  D   E L   F +    ++A ++     G  RG G V F++ EE  +A+
Sbjct: 106 TNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADII--TSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 205 DAMQGKDLSGRQI 217
               G  L  RQI
Sbjct: 164 RKFDGAYLMNRQI 176

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 78/170 (45%), Gaps = 30/170 (17%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VA 114
           +R +Y+GNL K +  + +    + GG +Q++K++ D      +  FV +I    A    A
Sbjct: 385 NRTIYLGNLPKDVKIEEICNVVR-GGLLQSIKLLTDR-----HVCFVTFIDPTAAAQLYA 438

Query: 115 LQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVDVDDET------ 161
           + +L+G+ + NK  KI W   +         A  +  + N+++G+++   D ET      
Sbjct: 439 MASLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEHPIFT 498

Query: 162 ---LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ 208
              L   F EF    Q + + +      R   FV+F+N   A  A+D ++
Sbjct: 499 EQNLRSIFEEFGEVEQINFLIE------RNCCFVNFTNISNAILAIDKIK 542

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GNIP       L+  +++ G + D     EK C FI +   E +A+    
Sbjct: 143 APSR--TVYLGNIPPNLEARQLLDHVRS-GVVEDIRILREKMCAFISF-LDESSALLFHS 198

Query: 368 -VALANFPFQGRNLRTGWGK 386
              L      GR+++ GWGK
Sbjct: 199 DAILKRLNIDGRDIKIGWGK 218

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 318 YIGNIPHYA---------TEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 368
           Y+GNI   A         TE +L  + + FG +       E+ CCF+ +     A + I 
Sbjct: 480 YLGNIDFKADSETEHPIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAID 539

Query: 369 ALANFPFQGRNLRTGWGKERT 389
            + N P Q  +L+  +GK+R 
Sbjct: 540 KIKNNP-QFSDLKINFGKDRC 559

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/106 (19%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           R +Y+GN+  ++    L  + ++G  +++++I+ +    ++++          ++  L+ 
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSG-VVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 118 LNGVQLENKTLKINWA-------FETQQAAENDDTFNLFVGDLNVD 156
           LN   ++ + +KI W          T   A +  T N+++G LN D
Sbjct: 205 LN---IDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTD 247

>ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {ON}
           similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 167

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 114 ALQTLNGVQLENKTL--KINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPT 171
           A++ +N  +L    L  + +W +E +  A       +F+G L+ ++ +  +   F ++  
Sbjct: 6   AIERINEAELSQGILTHEQSWHYEYRNQA------YIFIGGLHKELTEADVLTVFSQYGV 59

Query: 172 FIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
            +   ++ D + G SRG+ ++ + +Q     A+D + G  ++GR+IR++ A
Sbjct: 60  PVDLKLVRDRENGESRGFAYLKYEDQRSTVLAVDNLNGAIVAGRRIRVDHA 110

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQT 117
           +++G L K +TE D+L  + Q G P+ ++K++ D +N E   +A+++Y       +A+  
Sbjct: 36  IFIGGLHKELTEADVLTVFSQYGVPV-DLKLVRDRENGESRGFAYLKYEDQRSTVLAVDN 94

Query: 118 LNGVQLENKTLKINWAF 134
           LNG  +  + ++++ A 
Sbjct: 95  LNGAIVAGRRIRVDHAL 111

>KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.822
           YMR268C
          Length = 441

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 16/169 (9%)

Query: 47  SATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYI 106
           S T   RE S   + V NL KS  ++ +K++FQ  G I+ V +++D+K +    A VE+ 
Sbjct: 20  SNTTSNREVS--TVLVKNLPKSSNQNKVKKFFQDCGDIRYVDVLDDLK-KLSRLARVEF- 75

Query: 107 RSHDANVALQTLNGVQLENKTLKINWAFETQQAAEN-DDTFNLFVGDLNVDVDDETLAGT 165
            SHDA +   T    ++ N  ++++        A N   T+   + D+   +    L   
Sbjct: 76  ESHDAALTALTKTSKKVGNNEIEVSLLENCTLWATNFPPTYT--IKDIKALLKSVGLLAI 133

Query: 166 FREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSG 214
              FP+         ++   +R + ++   + E+ QKA+D ++GK+  G
Sbjct: 134 SVRFPS---------LRYNANRRFAYIDVPSNEDLQKAVDLLEGKEFEG 173

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 87/189 (46%), Gaps = 19/189 (10%)

Query: 54  ETSDRVLYVGNLDKSITEDLLKQYF-QAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN 112
           E S   L+  N   +  +  L Q F Q GG + +V++     +    +A+++     +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTF----NLFVGDLNVDVDDETLAGTFRE 168
           +AL+ L+GV++EN  + +  +  +  AA  D        + V +LN + ++  L+  F +
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 169 FPTFIQAHV-------------MWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGR 215
           F    Q ++               + +   + G+ F++FS+   A+ ++ ++ G ++  R
Sbjct: 233 FGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSL-SLNGTEIDNR 291

Query: 216 QIRINWATK 224
            + +  A +
Sbjct: 292 ILDVTLADR 300

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV  +  D  DE LA  F        A ++ D Q   SRG+GFVSF+ +++ + A
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDA 77

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +D  +     GR +R++ A +
Sbjct: 78  LDKARKTKFKGRLLRVDIAKR 98

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/193 (18%), Positives = 76/193 (39%), Gaps = 35/193 (18%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++    T++ L  YF    PI++  I++D +     + FV +    D   AL  
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNV----DVDDETLAGTFREFPTFI 173
               + + + L+++ A    +  ++    N   G  +     D +DE L G     P  I
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQ---NAAAGSEDTSGPQDKEDELLGGK----PKLI 133

Query: 174 QAHVMWDMQT------------------------GRSRGYGFVSFSNQEEAQKAMDAMQG 209
             ++ W ++                         G+  G+ FV+       + A++  + 
Sbjct: 134 VRNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKS 193

Query: 210 KDLSGRQIRINWA 222
             + GRQ+ +++A
Sbjct: 194 LKIGGRQVAVDFA 206

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQE 198
           +FV ++  D   E+L   F +F     A  + D +TG ++G  FV F  QE
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 42/75 (56%)

Query: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204
           T +LF+G+L   V +E L   F+ + +F  A V  D  T +S GYG+++F ++ +A+ A 
Sbjct: 110 TNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESAR 169

Query: 205 DAMQGKDLSGRQIRI 219
                    G++++I
Sbjct: 170 KEFNYTVFFGQEVKI 184

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 88/193 (45%), Gaps = 10/193 (5%)

Query: 31  NASQENDDDK----PSVVPASATKGGRETSD-RVLYVGNLDKSITEDLLKQYFQAGGPIQ 85
           NA+QE  + +     +V   S  K   +TS    L++GNL  ++TE++L++ F+     +
Sbjct: 79  NATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFE 138

Query: 86  NVKIIED-MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDD 144
           + K+  D +  + + Y ++ +   +DA  A +  N      + +KI  + +     +N  
Sbjct: 139 SAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIG 198

Query: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204
           T N+F  +L ++ + +    +F  +   I+   +      R +  GFV F N   A+  +
Sbjct: 199 T-NVFFSNLPLE-NPQLTTRSF--YLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVI 254

Query: 205 DAMQGKDLSGRQI 217
                ++  G +I
Sbjct: 255 KKYNNQEFFGNKI 267

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + + V NL    T++ +  YF   GPI++V I E   N   + AFV Y    ++  A + 
Sbjct: 313 KTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANT-PHKAFVTYKNEEESKKAQKC 371

Query: 118 LNGVQLENKTL 128
           LN    +N T+
Sbjct: 372 LNKTIFKNHTI 382

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 79/170 (46%), Gaps = 30/170 (17%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VA 114
           +R +Y+GNL K +  + +    + GG +Q++K++ D      +  FV +I    A    A
Sbjct: 341 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLSDR-----HVCFVTFIDPTAAAQFYA 394

Query: 115 LQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVDVDDET------ 161
           + +L+G+ + NK  KI W   +         A     + N+++G+++   D ++      
Sbjct: 395 MSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQHPIFT 454

Query: 162 ---LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ 208
              L   F+EF    Q + +++      R   F++F+N   A  A+D ++
Sbjct: 455 EAALRAVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIK 498

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GN+P Y T  +L+  +++ G + +    PEK C FI +   E +A+    
Sbjct: 100 APSR--TVYLGNVPPYITTKELLDHVRS-GVVEEVKILPEKMCAFISF-VEENSALLFHS 155

Query: 368 -VALANFPFQGRNLRTGWGK 386
              L       R+++ GWGK
Sbjct: 156 DAILKRLNIDDRDIKIGWGK 175

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 318 YIGNIPHYA---------TEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIV 368
           Y+GNI   A         TEA L  + Q FG +       E+ CCFI +     A + I 
Sbjct: 436 YLGNIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAID 495

Query: 369 ALANFPFQGRNLRTGWGKERT 389
            + + P   ++L+  +GK+R 
Sbjct: 496 KIKSIP-TFKDLKINFGKDRC 515

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L+ D  DE L   F+     I+  +     +G+ +G+ FV F N+E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 208 QGKDLSGRQIRINWA 222
             + ++GR +R+ + 
Sbjct: 300 TCRKIAGRPLRMEFG 314

>ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [1230
           bp, 409 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 409

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 76/195 (38%), Gaps = 32/195 (16%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++VGNL      + LK YF   G +    II   +  +     VE+  + D + A++  +
Sbjct: 105 VFVGNLTYDCAPEDLKDYFSQIGNVVRADIITS-RGHHRGMGTVEFTNTEDVDEAIRRFD 163

Query: 120 GVQLENKTL--------------------KINWAFETQQAAENDDT----------FNLF 149
           G    ++ +                    +    F    +  N+ T          + +F
Sbjct: 164 GAYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGPIYEVF 223

Query: 150 VGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQG 209
           V +L   ++ + L   F+E    I+A V    + G SRG+G V +   EE Q A+    G
Sbjct: 224 VANLPYSINWQALKDMFKECGNVIRADVEL-ARNGYSRGFGTVIYGTPEEMQDAIARFHG 282

Query: 210 KDLSGRQIRINWATK 224
            +L GR + +    K
Sbjct: 283 YELEGRILEVREGRK 297

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 7/83 (8%)

Query: 313 RVTTAYIGNIPHYATEADLIPLLQNFGFI------LDFTHYPEKGCCFIKYDTHEQAAVC 366
           R    Y  N+P     +DL  L +  G +       D    P  G   ++Y+  E A VC
Sbjct: 328 RNNLIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAP-TGVAIVEYENVEDADVC 386

Query: 367 IVALANFPFQGRNLRTGWGKERT 389
           I  L N+ + G +L   +GK  T
Sbjct: 387 IDRLNNYNYGGCDLEISYGKRET 409

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           ++FVG+L  D   E L   F +    ++A ++     G  RG G V F+N E+  +A+  
Sbjct: 104 SVFVGNLTYDCAPEDLKDYFSQIGNVVRADII--TSRGHHRGMGTVEFTNTEDVDEAIRR 161

Query: 207 MQGKDLSGRQI 217
             G     RQI
Sbjct: 162 FDGAYFMDRQI 172

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 2/85 (2%)

Query: 49  TKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRS 108
           T GG   +  ++Y  NL  S     L   F+  G + N ++  D K      A VEY   
Sbjct: 323 TDGGERNN--LIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAPTGVAIVEYENV 380

Query: 109 HDANVALQTLNGVQLENKTLKINWA 133
            DA+V +  LN        L+I++ 
Sbjct: 381 EDADVCIDRLNNYNYGGCDLEISYG 405

>Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}
           YIR001C (REAL)
          Length = 250

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D+ ++FVG++ +DV  E +   F++     +  +++D  TG  +GYG++ F +    +KA
Sbjct: 62  DSRSIFVGNITLDVTPEQIEELFQDCGIIKRITLLYDRNTGAPKGYGYIEFESPAFREKA 121

Query: 204 MDAMQGKDLSGRQIRI 219
           +  + G +L G++I +
Sbjct: 122 LQ-LNGAELKGKKIAV 136

>NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON}
           Anc_5.536 YDR429C
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 141 ENDDTFNLFVGDLNVDVDDETLAGTFR-EFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEE 199
           E DD   L +  LN + D+  L       F    +  V+ + +TGRS+G  FV+FS+++ 
Sbjct: 182 ERDDLCTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQM 241

Query: 200 AQKAMDAMQGKDLSGRQIRINWA 222
           A+KA+  + G+      +R+ W+
Sbjct: 242 AEKALHFLDGRGFMNLILRVEWS 264

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV  + +DV DE L   F  F     A V+ D+   +SRG+GFVSF+ +++ ++A
Sbjct: 24  DMKTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEA 82

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +   +   L G  +R++ A +
Sbjct: 83  LKKARQTKLKGHLLRVDIAKR 103

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V ++   +T++ L  YF    P ++  +++D+  +   + FV +    D   AL+ 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 118 LNGVQLENKTLKINWAFETQQAAENDD-------TFNLFV---GDLNVD----VDDETLA 163
               +L+   L+++ A    +++++DD       T  + V   GD N D    VD+E+L 
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESL- 144

Query: 164 GTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEA 200
              +  P  I  ++ W  +        F  F N  EA
Sbjct: 145 --LKGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEA 179

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 79/172 (45%), Gaps = 26/172 (15%)

Query: 51  GGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHD 110
           G     +R +Y+GNL K +  + +    + GG +QN+K++ D         F+ +I    
Sbjct: 349 GPNNLGNRTIYLGNLPKGVKIEEICNVVR-GGLLQNIKLLSDRF-----ACFITFIDPTA 402

Query: 111 AN--VALQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVD----- 156
           A    A+ +L+G+ ++    K+ W   +         A  N  + N+++G+++ +     
Sbjct: 403 AAQFYAMSSLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEY 462

Query: 157 VDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQ 208
            ++E L   F EF    Q + +      R +G  FV+F+N   A  A+D ++
Sbjct: 463 FNEEHLREIFEEFGEVEQINFL------REKGCCFVNFTNINHAILALDKIK 508

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 7/80 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GNIP   T  +L+  +++ G +      P K C FI +   E+ A+    
Sbjct: 125 APSR--TVYLGNIPQGLTIKELLDHVRS-GVVESVKILPTKLCAFISF-IDERGALLFHS 180

Query: 368 -VALANFPFQGRNLRTGWGK 386
              L     +G++++ GWGK
Sbjct: 181 DAILKRLNIRGKDIKIGWGK 200

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 318 YIGNIP-----HYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALAN 372
           YIGN+       Y  E  L  + + FG +       EKGCCF+ +     A + +  + +
Sbjct: 450 YIGNVDFEKKNEYFNEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIKS 509

Query: 373 FPFQGRNLRTGWGKERT 389
            P +  +L+  +GK+R 
Sbjct: 510 LP-EFEDLKINFGKDRC 525

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 3/78 (3%)

Query: 317 AYIGNI---PHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANF 373
            YIG +   P   TE +L   +Q FG I        KG  F+ + +   A   +  L+  
Sbjct: 221 VYIGQLNDDPTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKL 280

Query: 374 PFQGRNLRTGWGKERTNF 391
             + +N R  +GK+R  F
Sbjct: 281 NEKYKNKRIFYGKDRCAF 298

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 144 DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKA 203
           D   LFV ++  D  D  L   F +F     A ++ D   G SRG+GFVSF+ + + Q A
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFGFVSFAVESDTQAA 72

Query: 204 MDAMQGKDLSGRQIRINWATK 224
           +D  +     GR +R++ A +
Sbjct: 73  LDKGRKTQFKGRLLRVDVAKR 93

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/194 (18%), Positives = 75/194 (38%), Gaps = 32/194 (16%)

Query: 58  RVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT 117
           + L+V N+    T+  L  +F    PI++  I++D       + FV +    D   AL  
Sbjct: 16  KTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDK 75

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLA-----GTFREFPTF 172
               Q + + L+++ A   +++ + D+       +   D +  T A        R  P  
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAE---DAEKPTTAPEGDEALMRGKPKL 132

Query: 173 IQAHVMWDMQ------------------------TGRSRGYGFVSFSNQEEAQKAMDAMQ 208
           I  ++ W  +                         G+  G+ FV+       +KA++  +
Sbjct: 133 IIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECK 192

Query: 209 GKDLSGRQIRINWA 222
           G  + GR++ +++A
Sbjct: 193 GLKIDGREVAVDFA 206

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 137 QQAAEND-DTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
           Q+A  N  + F++FV ++  D   ETL   F +F     A  + D +TG  +G  FV+F 
Sbjct: 278 QEAPRNRRENFSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFK 337

Query: 196 NQ 197
           ++
Sbjct: 338 DE 339

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 67  KSITEDLL---KQYFQAGGPIQNVKIIEDMKNEYVN----YAFVEYIRSHDANVALQTLN 119
           +S+TE+ +   K+  +  G ++  KII+++K   V     Y F+EY     A + L+ LN
Sbjct: 513 RSMTEEEIEAQKKKDKKRGLVKQAKIIKEVKGSVVGRSKGYGFIEYRDHKAALMGLRWLN 572

Query: 120 GVQLENKTLKINWAFETQQAAEND 143
             Q+  + +      E ++AA++D
Sbjct: 573 AHQVTQEEILEGMTEEERKAADDD 596

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 96/223 (43%), Gaps = 40/223 (17%)

Query: 27  VEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGG---- 82
           V+GD +S+            +ATK  ++ +   +++GNL    T+D L ++F A      
Sbjct: 106 VKGDESSE------------TATKKKKDENKYGVWIGNLSFETTKDDLVRFFVAKTKNNE 153

Query: 83  ----------------PIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQT--LNGVQLE 124
                           P    K    MKN+   Y F + +    A + L    LNG  + 
Sbjct: 154 DERSRVTEQDITRLSMPRVAAKNSNSMKNKGFCYMFFKNVEQLKAVLELSESHLNGRNML 213

Query: 125 NKTLKINWAFETQQ-----AAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW 179
            K  + N++    +      ++N  +  LFVG+L+ DV D+ L   F+     I+  +  
Sbjct: 214 IKDSE-NYSGRPDKDDLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMAT 272

Query: 180 DMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWA 222
              +G+ +G+ F+ F N+E +  A+     + ++GR +R+ + 
Sbjct: 273 FEDSGKCKGFAFIDFKNEEGSTNALKDKGCRKIAGRPLRMEYG 315

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 93/207 (44%), Gaps = 41/207 (19%)

Query: 52  GRETSDRV------LYVGNLDKSIT-EDLLKQYFQAGGPIQNV---KIIED--------- 92
           G+E++D+       +++GNL    T EDL++  F  G   QN    K++E+         
Sbjct: 98  GKESADKPKEEKFGVWIGNLSFDTTREDLMR--FILGKTKQNEDSEKVVEEKDIVRFKLP 155

Query: 93  --------MKNEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWA--FETQ----- 137
                   +KN+   + ++++         L+ LN  QL  + L I  +  FE +     
Sbjct: 156 LANNDGKKIKNK--GFCYIDFSTEQKMKAVLE-LNENQLNGRNLLIKNSKNFEGRPDKND 212

Query: 138 --QAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFS 195
               ++N  +  LFVG+L+ D  DE L   F+     I+  +     +G+ +G+ FV F 
Sbjct: 213 LVSMSKNPPSRILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFK 272

Query: 196 NQEEAQKAMDAMQGKDLSGRQIRINWA 222
           ++E A  A+     + ++ R IR+ + 
Sbjct: 273 SEEGATNALKDKTCRRIASRPIRMEYG 299

>Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {ON}
           similar to Ashbya gossypii AEL217W
          Length = 871

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 86/215 (40%), Gaps = 50/215 (23%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDM-KNEYVNYAFVEYIRSHDANVALQTL 118
           LY+  + K +T D +   F   G + ++KII D+   E + Y F+ Y     A   ++ L
Sbjct: 253 LYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKEL 312

Query: 119 NGVQLENKTLKINWAFETQQ---------AAENDDT--FNLFVGDLNVDVDDETLA---- 163
           NG  +    L IN+  E ++           +NDD     +FVG+L  + +D TL     
Sbjct: 313 NGNLMNGSLLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLTTPEQ 372

Query: 164 --GTFRE-----------FPT--------------FIQAHVMWDMQTGRS-------RGY 189
               F+E           FP               +  A    + +T  S       +GY
Sbjct: 373 VFKKFKELLDPVEILSYYFPKRNSNTNIEYKDDYDYFHAASKENAETCDSQNEDSPLKGY 432

Query: 190 GFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           GF+ FS  E A KA++ +   +     + +N A +
Sbjct: 433 GFIKFSKHEMALKAIETLNNLNWLNHCLVVNKAVQ 467

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 41/75 (54%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206
           NL++  +  D+  + +   F +F T +   ++ D+ TG S GYGF+S+    +A + +  
Sbjct: 252 NLYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKE 311

Query: 207 MQGKDLSGRQIRINW 221
           + G  ++G  + IN+
Sbjct: 312 LNGNLMNGSLLFINY 326

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 30/77 (38%), Gaps = 6/77 (7%)

Query: 318 YIGNIPHYATEADLIPLLQNFG------FILDFTHYPEKGCCFIKYDTHEQAAVCIVALA 371
           YI  IP   T  D++PL   FG       I+D       G  FI Y    QAA CI  L 
Sbjct: 254 YIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKELN 313

Query: 372 NFPFQGRNLRTGWGKER 388
                G  L   +  ER
Sbjct: 314 GNLMNGSLLFINYHVER 330

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 15/75 (20%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMW---------------DMQTGRSRGYGF 191
           NL++  + +   D  L   + ++   I A ++                D+  G SRGYGF
Sbjct: 640 NLYIKHIPLSWRDRDLNEFYSQYGEIISAKIITVGGSKNGSGDKESLDDVPIGTSRGYGF 699

Query: 192 VSFSNQEEAQKAMDA 206
           V F N  +A +AM A
Sbjct: 700 VCFKNPLDASRAMMA 714

>KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {ON}
           Anc_1.357 YHR015W
          Length = 642

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LF+G L   V +  L   F +F +     + +D +T +S GYG+++FS  +E  + ++  
Sbjct: 97  LFIGGLGPHVTESMLKELFNKFSSLYSVKICYDSETKKSLGYGYLNFSGSDEIDRVIEEF 156

Query: 208 QGKDLSGRQIRI 219
              ++ G +I+I
Sbjct: 157 NYTEVFGSEIKI 168

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 81/187 (43%), Gaps = 5/187 (2%)

Query: 32  ASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIE 91
           + ++N   +    P  +T    +     L++G L   +TE +LK+ F     + +VKI  
Sbjct: 69  SGKKNTPKRSGTKPQLSTDFKSQKKVTPLFIGGLGPHVTESMLKELFNKFSSLYSVKICY 128

Query: 92  DMK-NEYVNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFV 150
           D +  + + Y ++ +  S + +  ++  N  ++    +KI  +       +N  T N+F 
Sbjct: 129 DSETKKSLGYGYLNFSGSDEIDRVIEEFNYTEVFGSEIKIMPSLRNSLYRKNIGT-NIFF 187

Query: 151 GDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGK 210
            +L ++ + E     F  + TF +   +   +    +  GFV + + + A++ ++     
Sbjct: 188 SNLPLE-NSELTTRVF--YDTFKKYGKILSCKLDHRKNIGFVYYEDDKVAREVIEKYNNT 244

Query: 211 DLSGRQI 217
              G +I
Sbjct: 245 TFFGAKI 251

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 76/187 (40%), Gaps = 33/187 (17%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119
           ++V NL    TED +  +F   GP+++V   + +K +   +AF+ Y +  D   A++ L+
Sbjct: 307 VFVKNLPIDTTEDEILDFFSVVGPVKSVFTSKVLKFK-SEWAFITYKKGSDTERAIEELD 365

Query: 120 GVQLENKTLKINWA------------------FETQQAAENDDTFNLFVGDLNVDVDDET 161
           G + +++ + +  A                      + A    T  L   +L+     E 
Sbjct: 366 GKKYKDRKISVTKAKARQQQHHHHQQQQQQQQQPIVKKASTKTTIQL--NNLSTICTKEF 423

Query: 162 LAGTFREFPTFIQAHVMWD------MQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGR 215
           L          IQ H+ +D       +       GF +F  +++A+K  + + GK + G 
Sbjct: 424 LV------ELCIQEHLKFDRLKITEYEPDSGTFKGFATFKTKDDAKKFYNYLNGKLVGGS 477

Query: 216 QIRINWA 222
            I   +A
Sbjct: 478 VINATFA 484

>KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFV  LN     + LA  F  F       ++ D +TG S GYGF+ F+ +E  + A   M
Sbjct: 249 LFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKESCEMAYSKM 308

Query: 208 QGKDLSGRQIRINWA 222
            G  +  R+I +++ 
Sbjct: 309 DGVLIDDRRIHVDFC 323

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 52  GRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHD 110
           G + S+RVL+V  L+       L   F   G I  ++I+ D +    + Y F+E+ +   
Sbjct: 241 GIKPSERVLFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKES 300

Query: 111 ANVALQTLNGVQLENKTLKINWA 133
             +A   ++GV ++++ + +++ 
Sbjct: 301 CEMAYSKMDGVLIDDRRIHVDFC 323

>NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {ON}
           Anc_5.76 YGR250C
          Length = 717

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/204 (19%), Positives = 86/204 (42%), Gaps = 39/204 (19%)

Query: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED----------MKNEYVNYAFVEYIRSH 109
           +++G ++  I E  ++  F+  G I ++K+  D            +  + Y F+ ++   
Sbjct: 183 IFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGS 242

Query: 110 DANVALQTLNGVQLENKTLKINWAFETQQAAE----------NDDTFN-LFVGDLNVDVD 158
            A+  +   NG  +E   L +N+  E ++             +D+ F  +F+G+L   + 
Sbjct: 243 QASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTTLT 302

Query: 159 DETLAGTFREFPT---------------FIQAHVMWDMQTGRS---RGYGFVSFSNQEEA 200
           D T+     +  T               F Q+  + +    +S   +GYGFV+  + E+A
Sbjct: 303 DLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQA 362

Query: 201 QKAMDAMQGKDLSGRQIRINWATK 224
            K +  + G +  G ++ +N A +
Sbjct: 363 LKVIQTLDGLEWKGNRLVVNKAVQ 386

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 9/84 (10%)

Query: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSR---------GYGFVSFSNQ 197
           N+F+G +N  +D+  +   F +F + +   +  D     +          GYGF+SF   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 198 EEAQKAMDAMQGKDLSGRQIRINW 221
            +A + ++   GK + G ++ +N+
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNY 265

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 180 DMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217
           ++  G SRGYGFV F N  +A +A+ A  G  +S   I
Sbjct: 606 NLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

>TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {ON}
           Anc_7.159 YIR005W
          Length = 140

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 55/89 (61%), Gaps = 3/89 (3%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMK-NEYVNYAFVEYIRSHDANVALQT 117
           +++GNL+K++TE D+L  + Q G PI ++K+I + + N  + +A+++Y  S    +A+  
Sbjct: 36  IFIGNLNKNLTEGDILTVFSQFGNPI-DLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDN 94

Query: 118 LNGVQLENKTLKINWAFETQQAAENDDTF 146
           LNG ++   TLKI+  +      +ND+ +
Sbjct: 95  LNGSKVAGNTLKIDHFWHDPNKNKNDEEY 123

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 52/106 (49%), Gaps = 4/106 (3%)

Query: 115 LQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQ 174
           +Q LN  +L+N  L I  ++         D   +F+G+LN ++ +  +   F +F   I 
Sbjct: 7   IQQLNDTELQNNILSIEKSWHYNYI----DYGYIFIGNLNKNLTEGDILTVFSQFGNPID 62

Query: 175 AHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRIN 220
             ++ + QT  S G+ ++ + +      A+D + G  ++G  ++I+
Sbjct: 63  LKLIRNKQTNHSMGFAYLKYEDSRSCILAIDNLNGSKVAGNTLKID 108

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           LFVG+L+ D  DE L   F+     ++  +     TG+ +G+ FV F N+E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDK 296

Query: 208 QGKDLSGRQIRINWA 222
             + ++GR +R+ + 
Sbjct: 297 TCRRIAGRPLRMEFG 311

>KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {ON}
           Anc_7.159 YIR005W
          Length = 154

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 42/75 (56%)

Query: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207
           +F+G LN D+ +  +   F ++   +  ++  D  +G S+G+ F+ + +Q     A+D +
Sbjct: 36  VFIGGLNKDLTEGDILTIFSQYGVPVDIYLARDKYSGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 208 QGKDLSGRQIRINWA 222
            G  ++GR I+++ A
Sbjct: 96  NGSKIAGRIIQVDHA 110

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 60  LYVGNLDKSITE-DLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTL 118
           +++G L+K +TE D+L  + Q G P+      +    E   +AF++Y       +A+  L
Sbjct: 36  VFIGGLNKDLTEGDILTIFSQYGVPVDIYLARDKYSGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 119 NGVQLENKTLKINWAF 134
           NG ++  + ++++ AF
Sbjct: 96  NGSKIAGRIIQVDHAF 111

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 90/202 (44%), Gaps = 26/202 (12%)

Query: 47  SATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYI 106
           S+TK       + L+V ++   +T++ + ++F    PI++  I++D + +   + FV + 
Sbjct: 15  SSTKSNDGLDMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQKKSRGFGFVSFA 74

Query: 107 RSHDANVALQTLNGVQLENKTLKINWAF----------ETQQAAEND-------DTFNLF 149
              D   AL+     +L+++ L+I+ A           E++  +E+        D  +L 
Sbjct: 75  VEDDTLAALKEARKTKLKDRLLRIDIAKRRDRNKKKGEESKPTSEDTESADGPIDEESLL 134

Query: 150 VGDLNVDV--------DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQ 201
            G   + +        D E L   F  F T ++A +    + G+  G+ FV+       +
Sbjct: 135 KGKPKIIIRNMPWSCRDPEKLKNIFSRFGTVVEAKI-PKKKDGKLCGFAFVTMKKLVNCK 193

Query: 202 KAMDAMQGKDLSGRQIRINWAT 223
            A++  +   + GR++ +++A 
Sbjct: 194 TAIENSKDLKIDGRKVAVDFAV 215

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%)

Query: 146 FNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQE 198
           F++FV ++  D  +E+L   F +F     A  + D +TG ++G  FV+FS+++
Sbjct: 295 FSVFVRNVPYDATEESLVEHFGKFGPVKYALPVIDRETGLAKGTAFVAFSSKQ 347

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 133 AFETQQAAENDDTFN--LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYG 190
           A + +Q    DD ++  ++V  L     ++ L+  F +F    +A +  + ++G SR YG
Sbjct: 76  AAKNKQGNTKDDEYSSIIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYG 135

Query: 191 FVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224
           FV F+N+E+A+ A + M    L G  +R+    K
Sbjct: 136 FVEFANKEDAKVAQETMDNYLLMGHLLRVRLMGK 169

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 59  VLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQT 117
           ++YV  L     E  L +YF   G ++  ++  + K+    +Y FVE+    DA VA +T
Sbjct: 92  IIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDAKVAQET 151

Query: 118 LNGVQLENKTLKI 130
           ++   L    L++
Sbjct: 152 MDNYLLMGHLLRV 164

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 83/180 (46%), Gaps = 38/180 (21%)

Query: 57  DRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VA 114
           +R +Y+GNL K +  + +    + GG +Q++K++ D      +  FV +I    A    A
Sbjct: 394 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLNDR-----HVCFVTFIDPTAAAQFYA 447

Query: 115 LQTLNGVQLENKTLKINWAFET-------QQAAENDDTFNLFVGDLNVDVDDE------- 160
           + +L+G+ + NK  KI W   +         A     + N+++G  N+D +D+       
Sbjct: 448 MSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLG--NIDFEDDRKLEQPI 505

Query: 161 ----TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQG----KDL 212
               +L   F+EF    Q + +++      R   F++F+N   A  A+D ++     KDL
Sbjct: 506 FTETSLRSVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIKSIPTFKDL 559

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 310 APPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCI-- 367
           AP R  T Y+GN+P Y T  +L+  +++ G + D    PEK C FI +   E +A+    
Sbjct: 153 APSR--TVYLGNVPPYITTRELLDHVRS-GVVEDVKILPEKMCAFISF-VDENSALLFHS 208

Query: 368 -VALANFPFQGRNLRTGWGK 386
              L       R+++ GWGK
Sbjct: 209 DAILKRLNIDDRDIKIGWGK 228

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 327 TEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 386
           TE  L  + Q FG +       E+ CCFI +     A + I  + + P   ++L+  +GK
Sbjct: 507 TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIP-TFKDLKINFGK 565

Query: 387 ERT 389
           +R 
Sbjct: 566 DRC 568

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,620,805
Number of extensions: 1394788
Number of successful extensions: 6836
Number of sequences better than 10.0: 641
Number of HSP's gapped: 6341
Number of HSP's successfully gapped: 1385
Length of query: 416
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 304
Effective length of database: 40,638,807
Effective search space: 12354197328
Effective search space used: 12354197328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)