Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H09108g7.125ON53253225190.0
NCAS0E021307.125ON52650017750.0
Suva_16.447.125ON54951017450.0
Smik_6.4677.125ON54851117380.0
YPL260W7.125ON55151117290.0
Skud_16.187.125ON55051117180.0
SAKL0F05390g7.125ON59550816720.0
TDEL0H028707.125ON58750816700.0
NDAI0E036707.125ON52249916570.0
KLLA0D14355g7.125ON58851016220.0
KNAG0L009407.125ON54952216110.0
KLTH0F12540g7.125ON59549115840.0
ZYRO0C05192g7.125ON58851315670.0
Kwal_55.208327.125ON57549315650.0
Ecym_83527.125ON57949715220.0
TBLA0A009307.125ON58651914980.0
KAFR0L004607.125ON51149314330.0
Kpol_322.77.125ON53448514170.0
TPHA0C016107.125ON55149113221e-178
ADL019W7.125ON52545112591e-169
Kpol_1062.587.125ON4914203321e-32
TBLA0E043708.254ON67647724.0
NDAI0J019404.196ON1029109705.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H09108g
         (532 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   974   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   688   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   676   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   674   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   670   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   666   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   648   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   647   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   642   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   629   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   625   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   614   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   608   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   607   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   590   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   581   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   556   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   550   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   513   e-178
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   489   e-169
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   132   1e-32
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    32   4.0  
NDAI0J01940 Chr10 (482424..485513) [3090 bp, 1029 aa] {ON} Anc_4...    32   5.7  

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/532 (90%), Positives = 484/532 (90%)

Query: 1   MSGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLT 60
           MSGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLT
Sbjct: 1   MSGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLT 60

Query: 61  RVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAP 120
           RVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAP
Sbjct: 61  RVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAP 120

Query: 121 ATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAEFKEID 180
           ATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAEFKEID
Sbjct: 121 ATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAEFKEID 180

Query: 181 TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASS 240
           TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASS
Sbjct: 181 TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASS 240

Query: 241 KKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAE 300
           KKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAE
Sbjct: 241 KKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAE 300

Query: 301 QRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTL 360
           QRGQ                 SHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTL
Sbjct: 301 QRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTL 360

Query: 361 RETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXX 420
           RETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK          
Sbjct: 361 RETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLLESSEPVSE 420

Query: 421 XXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEG 480
             QPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEG
Sbjct: 421 SLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEG 480

Query: 481 QGILNALLAGCFDILHELKVXXXXXXXXXXXXXXXXXXXNVSHDRNHDEEYL 532
           QGILNALLAGCFDILHELKV                   NVSHDRNHDEEYL
Sbjct: 481 QGILNALLAGCFDILHELKVEAEEREDEEDEDEEEDEDDNVSHDRNHDEEYL 532

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/500 (69%), Positives = 395/500 (79%), Gaps = 8/500 (1%)

Query: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65
           M  S T HPQ+VPKEEE ILNYLL+VRSFLSKLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 3   MYPSNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVREL 62

Query: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125
           D IRK+S D   +   ATTLIH  ++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 63  DEIRKNSHDTPSK--SATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 120

Query: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPE-----DEVAEFKEID 180
           LSTVQ LLEHL ESN+FTHHDL PIK+RL+EISKIVEKS    P+     DE    K+ID
Sbjct: 121 LSTVQSLLEHLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDDEEQNLKDID 180

Query: 181 TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASS 240
           TERNKN+IEQDLLL+AKLQHC+DEY ++ESKLEEI P L+  ME+LF++RRGLLSLAAS+
Sbjct: 181 TERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAAST 240

Query: 241 KKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAE 300
           KKN+   +     +L++ KH++SQEY++  L   + EV  +EA RDE+G+F S  T +  
Sbjct: 241 KKNMNQGSLTSEKELEN-KHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLETNEVA 299

Query: 301 QRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTL 360
           + GQ                 SHQTNG L LDP LQPIYE LIDIKTTLENLMITRRWTL
Sbjct: 300 ENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITRRWTL 359

Query: 361 RETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXX 420
           RETDLFTYQKQL EIDNMRV G+FPTK  DSKGQ I+LYLLRRCYAIIYK          
Sbjct: 360 RETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESSEPVSE 419

Query: 421 XXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEG 480
             QP+HNQLSTVRRCL+ELKRMGGV+N+RELYPYQMKLASLDNLR DGKFYDS+GNIPEG
Sbjct: 420 SLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGNIPEG 479

Query: 481 QGILNALLAGCFDILHELKV 500
           QG LNALLA CFDI+HELKV
Sbjct: 480 QGTLNALLAACFDIMHELKV 499

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/510 (68%), Positives = 393/510 (77%), Gaps = 17/510 (3%)

Query: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65
            S +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 2   FSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61

Query: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125
           D IRK+S D   +   A TLIH T++HNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYAS
Sbjct: 62  DDIRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYAS 119

Query: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA--EFKEIDTER 183
           LSTV+ LLEHL ESNVFTHHDL PIKERL+EI KIVEK+     +++    + +EID ER
Sbjct: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNER 179

Query: 184 NKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKN 243
           NKNRIE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LFK+RRGLLSL AS+KK 
Sbjct: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239

Query: 244 IPDENYKEPAKLD-------------DSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQ 290
           +   N    + L              D KH++SQEY++  L   K E+ ++E+ RDE+G+
Sbjct: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299

Query: 291 FVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLE 350
           F S  + K  + GQ                 SHQTNGGLTLDP LQPIYE+LIDIKTTLE
Sbjct: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359

Query: 351 NLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK 410
           NLMITRRWTLRETDLF+YQK+L EID+ RV GKFPTK+ DSKGQSI+LYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419

Query: 411 XXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKF 470
                       QPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR DG F
Sbjct: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479

Query: 471 YDSDGNIPEGQGILNALLAGCFDILHELKV 500
           YDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKV 509

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/511 (67%), Positives = 393/511 (76%), Gaps = 18/511 (3%)

Query: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65
            + +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 2   FASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61

Query: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125
           D IRK+S +   +   A TLIH+T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 62  DDIRKNSHETPAK--SAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 119

Query: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAE---FKEIDTE 182
           LSTV+ LLEHL ESNVFTHHDL PIKERLDEISKIVE+   S   +E       +EID E
Sbjct: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNE 179

Query: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKK 242
           R KN+IE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LF++RRGLLSL AS+KK
Sbjct: 180 RKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKK 239

Query: 243 NIP-------------DENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289
            +              +++      L D KH++SQEY+   L   K E+ ++E+ RD++G
Sbjct: 240 TMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSG 299

Query: 290 QFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349
           +F S  T +    GQ                 SHQTNGGL+LDPYLQPIYE+LIDIKTTL
Sbjct: 300 KFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTL 359

Query: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409
           ENLMITRRWTLRETDLF+YQK+L EIDN R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 360 ENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 419

Query: 410 KXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469
           K            QP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR DG 
Sbjct: 420 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 479

Query: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           FYDSDGNIPEGQGILNALLA CFDILHELKV
Sbjct: 480 FYDSDGNIPEGQGILNALLAECFDILHELKV 510

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/511 (66%), Positives = 392/511 (76%), Gaps = 18/511 (3%)

Query: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65
            + +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 2   FASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61

Query: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125
           D IRK+S +   +   A TLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 62  DDIRKNSHETPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 119

Query: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAE---FKEIDTE 182
           LSTV+ LLEHL ESNVFTHHDL PIKERL+EISKIVE+   S   DE       +EID E
Sbjct: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNE 179

Query: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKK 242
           R KN+IE+DLLL+AKL+HC DEY+ LE KLEEI P LS +ME+LF++RRGLLSL AS+KK
Sbjct: 180 RKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK 239

Query: 243 NIPDENYKEPA-------------KLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289
            +   +    +              L D KH++SQEY+   L   K E++++E+ RD++G
Sbjct: 240 TMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 299

Query: 290 QFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349
           +F S  + +  ++GQ                 SHQ NGGLTLDPYLQPIYE+LIDIKTTL
Sbjct: 300 KFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTL 359

Query: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409
           ENLMITRRWTLRETDLF+YQK+L EIDN R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 360 ENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 419

Query: 410 KXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469
           K            QP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR +G 
Sbjct: 420 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGI 479

Query: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           FYDSDGNIPEGQGILNALLA CFDILHELKV
Sbjct: 480 FYDSDGNIPEGQGILNALLAECFDILHELKV 510

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/511 (66%), Positives = 392/511 (76%), Gaps = 18/511 (3%)

Query: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65
           M  S   HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 1   MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 60

Query: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125
           D IRK+S D   +   A TLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 61  DDIRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 118

Query: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVAE---FKEIDTE 182
           LSTV+ LLEHL ESNVFTHHDL PIKERLDEISKIVE+   S   +E A     +EID E
Sbjct: 119 LSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNE 178

Query: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKK 242
           R +N+IE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LF++RRGLLSL AS+KK
Sbjct: 179 RKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK 238

Query: 243 NIPDENYKEPAKLD-------------DSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289
            +   +    + L              D KH++SQEY+   L   K E++++E+ RD++G
Sbjct: 239 TMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 298

Query: 290 QFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349
           +F S  T +  ++GQ                 SHQTNGGL LDP+LQP YE+LIDIKTTL
Sbjct: 299 KFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTL 358

Query: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409
           ENLMITRRWTLRETDLF+YQK+L EID+ R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 418

Query: 410 KXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469
           K            QP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR +G 
Sbjct: 419 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGI 478

Query: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           FYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKV 509

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/508 (64%), Positives = 395/508 (77%), Gaps = 24/508 (4%)

Query: 10  GTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIR 69
            +NHPQ+VPKEEE ILNY L+VRSFLSKLK+NR+Q+LNSKDV+ TYQ+VLT+VRELD  R
Sbjct: 2   SSNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTR 61

Query: 70  KSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 129
           KSS +     + ATTLIH  D+HNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV
Sbjct: 62  KSSHNTP--ASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTV 119

Query: 130 QCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSV---------------ESRPEDEVA 174
           Q LLEHL ESNVFTHHDLRPIKERLDE+S+IVEK+                E++ +++  
Sbjct: 120 QRLLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDI 179

Query: 175 EFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLL 234
           E K+ D E++KN++E+DLLL+AKL+HC+ EY  +ESKLEEI P L  IME+LF++RRGLL
Sbjct: 180 ELKKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLL 239

Query: 235 SLAASSKKNIPDENYKEPAKLDDSK--HVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFV 292
           SLAAS+K+N      +    L+D K  H +S  ++++ L + + E++++E+ RD +G+F 
Sbjct: 240 SLAASTKRNA-----RSKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDPSGKFK 294

Query: 293 SKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENL 352
           S  T K E+RGQ                 SHQT+ G++LD  LQPIY+ LIDIKTTLENL
Sbjct: 295 SLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENL 354

Query: 353 MITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXX 412
           ++TRRWTLRETDLFTYQK+L EIDN+RVHGKFPT+S DSKGQSI+LYLLRRCYAIIYK  
Sbjct: 355 LVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLL 414

Query: 413 XXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYD 472
                     Q +HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLDN+R DGKFYD
Sbjct: 415 ESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYD 474

Query: 473 SDGNIPEGQGILNALLAGCFDILHELKV 500
           +DGNIPEGQG LNALLA CFDILHELK+
Sbjct: 475 ADGNIPEGQGTLNALLAECFDILHELKI 502

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/508 (65%), Positives = 388/508 (76%), Gaps = 22/508 (4%)

Query: 3   GVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRV 62
            +P++ S + HPQDVPKEEE ILNYLL VR+ L +LK+NR QYLNSK+V N YQ+VLT+V
Sbjct: 4   SLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKV 63

Query: 63  RELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT 122
           RELD IRKS+ D       ATTLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT
Sbjct: 64  RELDQIRKSNHDTP--SNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAT 121

Query: 123 YASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRP------EDEVAEF 176
           YASLSTVQ LLEHL ESNVFT HDLRPI+ERL EISKIVE S           ED   + 
Sbjct: 122 YASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKL 181

Query: 177 KEID----TERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRG 232
            E D     ERNKN+IE+DLLL+AKLQHC+DEY+  ESK+EEI P L+ IME+LF++RRG
Sbjct: 182 PEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRG 241

Query: 233 LLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFV 292
           LLSLAASSK++ P    K P         LSQE++   +EK + ++ ++E+ RDENG+F 
Sbjct: 242 LLSLAASSKRSNPSLE-KSP---------LSQEHVHEQVEKLESQLTELESHRDENGKFK 291

Query: 293 SKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENL 352
           S  T K E +GQ                 SHQ NGG+ LD  LQPIYE+LIDIKT+LENL
Sbjct: 292 SLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENL 351

Query: 353 MITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXX 412
           ++TRRWTLRETDLFT+QKQL+EID++RVHGKFPT S  SKGQSI+LYLLRRC+AIIYK  
Sbjct: 352 LVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLL 411

Query: 413 XXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYD 472
                     QP+HNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR DGKFYD
Sbjct: 412 ESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYD 471

Query: 473 SDGNIPEGQGILNALLAGCFDILHELKV 500
           SDGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 472 SDGNIPEGQGTLNALLAECFDIVHELKI 499

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/499 (66%), Positives = 392/499 (78%), Gaps = 14/499 (2%)

Query: 9   SGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGI 68
           S + HPQ VPKEEEGIL YLL+VR++L  LK+NRTQYLNS+ V  TYQEVLT+VRELD I
Sbjct: 10  SNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEI 69

Query: 69  RKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 128
           RK++         ATTLIH  ++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 70  RKNNHATP--SNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127

Query: 129 VQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKS------VESRPEDEVAEF-KEIDT 181
           VQ LLEHL ESN+FTHHDL PIKERLD+ISKIVE+S      +++  +D+  ++  E + 
Sbjct: 128 VQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETEL 187

Query: 182 ERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSK 241
           E+N+N+IEQDLLL+AKLQHC+DEY+++ESKLEEI P L+ I+E+LF++RRGLLSL AS+K
Sbjct: 188 EQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAK 247

Query: 242 KNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQ 301
           KN    +     +LD+ KH++S EYL+  L + +KE   +E+ RDE G+F S  TG+  +
Sbjct: 248 KN----SLLSQKELDE-KHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSLETGEIPE 302

Query: 302 RGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLR 361
            GQ                 SHQTNG LTLDP LQP+YE+LI+IKTTLE LMITRRWTLR
Sbjct: 303 NGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMITRRWTLR 362

Query: 362 ETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXX 421
           ETDLFTYQK+L EIDN+RV GKFP+KS DSKGQ IILYLLRRCYAIIYK           
Sbjct: 363 ETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLECSEPVSES 422

Query: 422 XQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQ 481
            QP+HNQLSTVRRCLL++KR+GGV+NERELYPYQMKLASLDNLRKDG FYDSDGNIPEGQ
Sbjct: 423 LQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQ 482

Query: 482 GILNALLAGCFDILHELKV 500
           G LNALLA CFDI+HE+KV
Sbjct: 483 GTLNALLAACFDIVHEMKV 501

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/510 (62%), Positives = 391/510 (76%), Gaps = 20/510 (3%)

Query: 8   VSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDG 67
           +S  +HP  VP EEE IL Y L+VRSFLSK+K+NR+Q+LNSKDV++TYQ+VLT+VRELD 
Sbjct: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60

Query: 68  IRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 127
           +RK+S         ATTLIH +++HNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLS
Sbjct: 61  LRKNSH--ATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLS 118

Query: 128 TVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEK----------SVESRPEDEVAEFK 177
           TVQ LLEHL ESNV+THHDLRPIKERL+E+S IVE+          SV +  +D + EF 
Sbjct: 119 TVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADD-IGEFA 177

Query: 178 -EIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSL 236
            + D E NKN+IE+DLLL+AKL+HCIDEYN +ESKLEEI PDL   ME LF++RRGLLSL
Sbjct: 178 LQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSL 237

Query: 237 AASSKKNIPDENYKEPAKLD------DSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQ 290
           A+S+K+    +   +PA L       + K+VL  + +   L++ ++++ K+E+ RD NG+
Sbjct: 238 ASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGK 297

Query: 291 FVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLE 350
           F S  T K E++GQ                 SHQ +GG++LD  LQPIY++L+DIKTTLE
Sbjct: 298 FKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLE 357

Query: 351 NLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK 410
           NL++TRRWTLRETDLFTYQK+L EIDN+RV+GKFPT  PDSKGQSI+LYLLRRCYAIIYK
Sbjct: 358 NLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK 417

Query: 411 XXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKF 470
                       Q VHNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DGKF
Sbjct: 418 LLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKF 477

Query: 471 YDSDGNIPEGQGILNALLAGCFDILHELKV 500
           YD+DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 478 YDTDGNIPEGQGTLNALLAECFDIIHELKI 507

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/522 (60%), Positives = 387/522 (74%), Gaps = 32/522 (6%)

Query: 9   SGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGI 68
           + T   Q+VPKEEEGILNY L+VR+ LS+LKKNRTQYLNS +V  TYQEVLT+VRELD I
Sbjct: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66

Query: 69  RKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 128
           RK + D     T   TLIH+ D+HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 67  RKKNHDAV--ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 124

Query: 129 VQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSV-------ESRPEDEVAEFKEIDT 181
           V+ LL+HL E+ ++THHDL+PIK+RL+EISKIVE+S        ++   DE    K+ID 
Sbjct: 125 VESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDA 184

Query: 182 ERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSK 241
           ER +N++EQ+LLLKAKL+HC+D YN++ESKLE+I P L+ +ME+LF++RRGLLSL ASS+
Sbjct: 185 ERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSR 244

Query: 242 ---KNIPDENYKEPAKL----------------DDSKHVLSQEYLSNSLEKYKKEVAKME 282
                I +E+    ++                 +  K+ +S + +    E  + ++  +E
Sbjct: 245 NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLE 304

Query: 283 AMRDENGQFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGG----LTLDPYLQPI 338
           A RDE+G+F S  T K  + GQ                 SHQ   G    L++DP LQP+
Sbjct: 305 AHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPV 364

Query: 339 YEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIIL 398
           YE+L++IKTTLENLMITRRWTLRETDLF+YQK+L EIDN+RV+G+FPT++ DS+GQSI+L
Sbjct: 365 YERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILL 424

Query: 399 YLLRRCYAIIYKXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 458
           YLLRRCYAIIYK            QP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKL
Sbjct: 425 YLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 484

Query: 459 ASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           ASLDNLR+DG FYDSDGNIPEGQGILNALLAGCFDI+HELKV
Sbjct: 485 ASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/491 (64%), Positives = 377/491 (76%), Gaps = 10/491 (2%)

Query: 13  HPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSS 72
           HPQ+VP EEE  L Y LEVR+FLS+LK+NR+QYLNSKDV++TYQ+VLT+VRELD IRKSS
Sbjct: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63

Query: 73  TDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCL 132
               R    ATTLIH+ ++HNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQ L
Sbjct: 64  HH--RPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 133 LEHLCESNVFTHHDLRPIKERLDEISKIVEKSV---ESRPEDEVAEFKEIDTERNKNRIE 189
           LEHL ESNVFTHHDLRPIKERLDEIS+IV +S     +   D   +F +I  E+++N+IE
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRIDFAKIQDEKDRNKIE 181

Query: 190 QDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENY 249
           +DLLL+AKLQHC+ EY  +ESKLEEI P L   ME+LF++RRGLLSLAAS+K+N      
Sbjct: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMS--- 238

Query: 250 KEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQXXXXX 309
           K+  K  DS  +L QE +   L + + E+ ++E+ RD +G+FVS  TG+   +GQ     
Sbjct: 239 KQGVKTPDS--LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNVLNG 296

Query: 310 XXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQ 369
                       SH  N  ++LD  LQPIY+ LIDIKTTLENL++TRRWTLRETDLF+YQ
Sbjct: 297 LLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQ 356

Query: 370 KQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHNQL 429
           K+L+EID +RV GKFPT++ D+KGQ+I+LYLLRRCYAIIYK            Q +HNQL
Sbjct: 357 KRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQL 416

Query: 430 STVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLA 489
           STVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DGKFYD DGNIPEGQG LNALLA
Sbjct: 417 STVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLA 476

Query: 490 GCFDILHELKV 500
            CFDILHELK+
Sbjct: 477 ECFDILHELKI 487

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/513 (59%), Positives = 386/513 (75%), Gaps = 20/513 (3%)

Query: 2   SGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTR 61
           S +   ++ + HPQ VP+EEEG+LNY LE+R+ LS+LK+NRT+YL+SK V  TY++VLTR
Sbjct: 4   STLSQDITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTR 63

Query: 62  VRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 121
           VRELD +RKS+ +     + ATTLIH+ ++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPA
Sbjct: 64  VRELDDVRKSNHETP--SSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA 121

Query: 122 TYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKS--------------VES 167
            Y+SLSTVQ LLEHL ESNVFT HDLRPIKERL EI KIVEKS              +++
Sbjct: 122 AYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKN 181

Query: 168 RPEDEVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLF 227
            P+ + A+ + +  E  +N+IE+DLLL+AKLQHC+DEY   E+K+E + P LS+IM++LF
Sbjct: 182 APDLDEAD-RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLF 240

Query: 228 KVRRGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDE 287
           ++RR LLSLAAS+KK     + ++     ++KHVL+ E ++  +E  +KE+ ++E+ RDE
Sbjct: 241 QIRRELLSLAASAKKTTSSASAEKEL---ENKHVLAPESVNTRVELLQKELNEIESYRDE 297

Query: 288 NGQFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKT 347
            G+F S  + ++ ++GQ                 SHQ NGG+ LDP LQPIY KLIDIKT
Sbjct: 298 TGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKT 357

Query: 348 TLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAI 407
           TLENL+ITRRWTLRETDLFTYQK+L EID++RV+ KFPT S D+KGQ+I+LYLLRRCYAI
Sbjct: 358 TLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAI 417

Query: 408 IYKXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKD 467
           IYK            QP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR D
Sbjct: 418 IYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVD 477

Query: 468 GKFYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           GKFYD DGNIPEGQ  LNALLA CFDI+HE+K+
Sbjct: 478 GKFYDLDGNIPEGQATLNALLAECFDIIHEMKI 510

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/493 (62%), Positives = 375/493 (76%), Gaps = 13/493 (2%)

Query: 13  HPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSS 72
           HPQ+VP EEE  L Y LEVR++LS+LK+NR+QYLNSK+V++ YQ+VLT+VRELD IRK S
Sbjct: 4   HPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKRS 63

Query: 73  TDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCL 132
               R    ATTLIH+ ++HNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTVQ L
Sbjct: 64  HSAPR--NSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 133 LEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEV----AEFKEIDTERNKNRI 188
           LEHL ESNVFTHHDLRPIKERLDEIS+IV +S   +   E+     +F +I  E+++N+I
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFTKISDEKDRNKI 181

Query: 189 EQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKN-IPDE 247
           E+DLLL+AKL+HC+ EY  +ESKLEEI P L   ME+LF++RRGLLSLAAS+K+N +  +
Sbjct: 182 EEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKRNAMLKD 241

Query: 248 NYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQXXX 307
            +K P      +  LSQE +   L   + ++ ++E+ R+ +G FVS  TG+  +RGQ   
Sbjct: 242 GHKAP------ESPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSADTGEIVERGQSVL 295

Query: 308 XXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFT 367
                         SH  N  +TLD  LQPIY+ LI+IKTTLENL++TRRWTLRETDLF 
Sbjct: 296 NGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFA 355

Query: 368 YQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHN 427
           YQK+L+EID +RV GKFPT+S D+KGQ+I+LYLLRRCYAIIYK            Q +HN
Sbjct: 356 YQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHN 415

Query: 428 QLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNAL 487
           QLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DGKFYD DGNIPEGQG LNAL
Sbjct: 416 QLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNAL 475

Query: 488 LAGCFDILHELKV 500
           LA CFDILHELK+
Sbjct: 476 LAECFDILHELKI 488

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/497 (60%), Positives = 376/497 (75%), Gaps = 8/497 (1%)

Query: 9   SGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGI 68
           S     Q +PKEEE IL+Y LE+R++LS+LK+NR Q+L SKDV+ TYQEVLT+VRELD I
Sbjct: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62

Query: 69  RKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 128
           RK++ + +      TTLIH  D+HNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122

Query: 129 VQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKS----VESRPEDEVAEFKEIDTERN 184
           VQ LL+HL ESNV+TH+DL+PIKERLDEIS+IVEK+    + +   D  A   +++ +R 
Sbjct: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRK 182

Query: 185 KNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNI 244
           +N IE++LLL+AKL++C+  YN++E+KLE IP DL   MERLF++RRGLLSLAAS+K  +
Sbjct: 183 ENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRV 242

Query: 245 PDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVS-KSTGKAEQRG 303
             E   E    DD   +LS E ++  L+  + E+A + + R+E+G+FVS        ++G
Sbjct: 243 EQEEQDEN---DDELCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKG 299

Query: 304 QXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRET 363
           Q                 SHQT+ GL LDP++QPIY+ L+ IKT LENL++TRRWTLRET
Sbjct: 300 QFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRET 359

Query: 364 DLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQ 423
           DLFTYQK+L E+D++RV+GKFP++S DSKGQ+I+LYLLRRCYAIIYK            +
Sbjct: 360 DLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLLESSEPVSESLE 419

Query: 424 PVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGI 483
            +HNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DGKFYD DGNIPEGQG 
Sbjct: 420 RIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGT 479

Query: 484 LNALLAGCFDILHELKV 500
           LNALLA CFDILHE+K+
Sbjct: 480 LNALLAECFDILHEMKI 496

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/519 (58%), Positives = 369/519 (71%), Gaps = 48/519 (9%)

Query: 8   VSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDG 67
            S  NHPQ VP EEE ILN+LLEVR+ L+KLK+NRTQ+LN+K V  TYQ VLT+VRELD 
Sbjct: 9   ASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDE 68

Query: 68  IRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 127
           IRK+S  +T     ATTLIHD+ +HNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLS
Sbjct: 69  IRKNS--LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLS 126

Query: 128 TVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA------------E 175
           TVQCLLEHL ES +FT HDLRPIKERLDEI +IVEKS  S   DE              E
Sbjct: 127 TVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKS--SYRNDEFNDSALVGLSKQEHE 184

Query: 176 FKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLS 235
             EI+ ER +NRIE+DLL++AKLQ CI+++N++ES+LE+I P+LS I+++L+ +RRGLLS
Sbjct: 185 LIEIENERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLS 244

Query: 236 LA---------------ASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAK 280
           LA               AS+  N+ D+++KE   L                 K KK++ +
Sbjct: 245 LASPTNDTLSKSDNNHIASTNHNVSDKSHKELVLL-----------------KMKKQLVE 287

Query: 281 MEAMRDENGQFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYE 340
           +E+ RDENG + S  T K E  GQ                 SH  NG +  DPYLQ IY+
Sbjct: 288 IESQRDENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYK 347

Query: 341 KLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYL 400
            LIDIKT L NLM+TRRWTLRETDLF+YQK+L EID++RV+GKF + + D+KGQSIILYL
Sbjct: 348 NLIDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYL 407

Query: 401 LRRCYAIIYKXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLAS 460
           LRRCYAIIYK            Q +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLAS
Sbjct: 408 LRRCYAIIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLAS 467

Query: 461 LDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELK 499
           LD LR DGKFYD++G+IPEGQGILNA+LA CFD++HELK
Sbjct: 468 LDELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/493 (58%), Positives = 353/493 (71%), Gaps = 27/493 (5%)

Query: 15  QDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSSTD 74
           Q VPKEEE  L+YLL+VR  LS LK+NR+Q+LNSKD+  TYQ VLT+VRELD IR+    
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 75  VTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCLLE 134
            ++  T   T +H  ++HNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLSTVQ LLE
Sbjct: 70  NSQE-TEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLE 128

Query: 135 HLCESNVFTHHDLRPIKERLDEISKIVEKSVESRP-------EDEVAEFKEIDTERNKNR 187
           HL ES ++THHDL+PIKERLDEI+KIV+++ ES         +D+  E   ID ERNKN+
Sbjct: 129 HLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNKNK 188

Query: 188 IEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDE 247
           IEQ+LLL+AKL HC+ EYN +ES+LEE+ P  + ++E+LF++RR L+SL   SK N    
Sbjct: 189 IEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISKSNTG-- 246

Query: 248 NYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQXXX 307
                           Q+ +   L+  + ++ ++E  RD +G FVS  +G    +G    
Sbjct: 247 ---------------VQDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPIIKGSNVL 291

Query: 308 XXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFT 367
                         +H T     LDP LQ +Y+ LID+K +LENLM+TRRWTLRETDLF+
Sbjct: 292 NGLSDDCHDLISDLTHHTKT--FLDPDLQNVYDNLIDVKGSLENLMVTRRWTLRETDLFS 349

Query: 368 YQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHN 427
           Y K+L EIDN+RV GKFPTKS  +KGQ+I+LYLLRRCY +IYK            QP+HN
Sbjct: 350 YLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHN 409

Query: 428 QLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNAL 487
           QLSTVRRCLL+LKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDS GNIPEGQGILNAL
Sbjct: 410 QLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNAL 469

Query: 488 LAGCFDILHELKV 500
           LAGCFDILHELK+
Sbjct: 470 LAGCFDILHELKI 482

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 362/485 (74%), Gaps = 12/485 (2%)

Query: 17  VPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSSTDVT 76
           VPKEEE IL YLL+VR+ L+KLK NR+Q+LNSK+V N +QEVLT+VRELD IRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQ--AG 77

Query: 77  RRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCLLEHL 136
                + T+IH+  +HN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LLEHL
Sbjct: 78  EDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHL 137

Query: 137 CESNVFTHHDLRPIKERLDEISKIVEK-SVESRPEDEVAEFKEIDTERNKNRIEQDLLLK 195
            ESN+FT+HDLRPIK+RLDEIS IVE  S  +   D      E + +RNKN+IE+DLLL+
Sbjct: 138 DESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEEKRNKNKIEEDLLLR 197

Query: 196 AKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENYKEPAKL 255
           AKL+HC+DEYNK+ SKLEEI P+LS IME+L+ +RR LLSLA+ S+K    E++   ++ 
Sbjct: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTREDF---SQF 254

Query: 256 DDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQXXXXXXXXXXX 315
           + SK   SQE    +L   ++E+ ++E+ RDENG F S  TG+   +GQ           
Sbjct: 255 NSSKE--SQE----ALSSLEQELEELESHRDENGNFKSLETGEVVLKGQNVLAGLVDNCH 308

Query: 316 XXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEI 375
                 ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+TDLF YQK+L  I
Sbjct: 309 DLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQAI 368

Query: 376 DNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHNQLSTVRRC 435
           DN RV+GKFPTKS D+KGQ+I+LYLLRRCYAIIYK            Q +HNQLST RRC
Sbjct: 369 DNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQSIHNQLSTARRC 428

Query: 436 LLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDIL 495
           LL LKRMGGVN+ERELYPYQ+KLASLD LR DGKF+D++G IPEGQG LNALLA CFDI+
Sbjct: 429 LLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFDIM 488

Query: 496 HELKV 500
           HEL++
Sbjct: 489 HELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  513 bits (1322), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 278/491 (56%), Positives = 347/491 (70%), Gaps = 16/491 (3%)

Query: 17  VPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKS----S 72
           VP+ E  IL YL++VR  L++LK NR++YLNSK+V   +QEVLT+VRELD IRKS     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 73  TDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCL 132
                +    TTL+ +  +HN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTVQ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 133 LEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESR---PEDEVAEFKEIDTERNKNRIE 189
           LEHL ESN+FT+HDLRPIKERLDEISKIV+ +        EDE+   +  D E  +N IE
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINPNQVDDDEIKQNLIE 196

Query: 190 QDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENY 249
           +DLLL+AKL+ C DE+ ++ SKLEEI P+L+ IME+L+ +RR LLSLA+ + K    EN 
Sbjct: 197 EDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTTENI 256

Query: 250 KEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQXXXXX 309
                 ++S+ +L  ++LS+       E+ ++E  RDE+G F S  T + + +GQ     
Sbjct: 257 SIFNNNEESRKML--KHLSD-------ELTELETHRDEDGNFKSLETNEVKLKGQNALAG 307

Query: 310 XXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQ 369
                       ++ +     LD  LQPIY  LI+IKT L NLMITRRWTLRETDLF YQ
Sbjct: 308 LVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTLRETDLFQYQ 367

Query: 370 KQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHNQL 429
           K+L EID+ RV+GKFP++S ++KGQSI+LYLLRRCYAIIYK            QP+HNQL
Sbjct: 368 KRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQL 427

Query: 430 STVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLA 489
           ST RRCLL LKRMGGVN+ RELYPYQ+KLASLD LR DGKFYDS G IPEGQG LNALLA
Sbjct: 428 STTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTLNALLA 487

Query: 490 GCFDILHELKV 500
            CFD+LHEL++
Sbjct: 488 ECFDMLHELEI 498

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  489 bits (1259), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 261/451 (57%), Positives = 323/451 (71%), Gaps = 8/451 (1%)

Query: 52  LNTYQEVLTRVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFL 111
           + TYQ VLT+VR LD +RK         T   TLIH   +HNRVDSVLDDVFQLLSL FL
Sbjct: 1   MATYQAVLTKVRLLDQVRKQRHGA-EDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFL 59

Query: 112 TVGLKNSAPATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEK-SVESRPE 170
           TVGLKN+APATYASLSTVQ LLEH+ E+NV+T+ DLRPIKERLDEI +IVEK S  S  E
Sbjct: 60  TVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVE 119

Query: 171 DEVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVR 230
           DE A   E+  E+  N++E+DLL++AKLQHC+D Y K++SK   IPP+L  + ++LF +R
Sbjct: 120 DE-APLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178

Query: 231 RGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQ 290
           R LLSLAAS+K +            + S    S   L++ L+  +  + ++E+ RD++G+
Sbjct: 179 RELLSLAASAKTD----RAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGK 234

Query: 291 FVSKS-TGKAEQRGQXXXXXXXXXXXXXXXXXSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349
           F+S        Q+GQ                 SHQT+G L LDP LQPIYE+L++IKTTL
Sbjct: 235 FISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTL 294

Query: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409
           ENL++TRRWTLRETDLF YQK+L E+DN+RV+ K P+ S  SKGQ++ILYLLRRCYA IY
Sbjct: 295 ENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIY 354

Query: 410 KXXXXXXXXXXXXQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469
           K            Q +HNQLSTVRRCL ELKRMGGV++ER+LYPYQMKLASLDN+R DGK
Sbjct: 355 KLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGK 414

Query: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500
           FYD+DGNIPEGQG LNALLA CFDILHE+K+
Sbjct: 415 FYDADGNIPEGQGTLNALLAECFDILHEMKI 445

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  132 bits (332), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 197/420 (46%), Gaps = 53/420 (12%)

Query: 121 ATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPE---------- 170
           + Y+S+  ++ LL  L +SN+FT +DL P+K RLDEI  I+E       E          
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 171 ------DEVAEFKEI--------------DTERNKNRIEQDLLLKA----KLQHCIDEYN 206
                 + +    EI              D E  K +   D  LK     +L  C   +N
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 207 KLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEY 266
            +E K + I  +LS +++++  VR+ LL +  S  K++    + +   L D  H      
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSV----FPQCFVLKDPNH------ 242

Query: 267 LSNS-LEKYKKEVAK-MEAMRDENGQFVSKSTGKAEQRGQXXXXXXXXXXXXXXXXXSHQ 324
           +SNS  +K   E+ + ++ ++++N ++    + + +  G                   H 
Sbjct: 243 MSNSTFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHD 302

Query: 325 TNGGLTLDPY----LQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRV 380
               L +D         ++EK + +K  LE +++T R +L+  DLF   K+L++++   +
Sbjct: 303 VKL-LAIDKIDDEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTI 361

Query: 381 HGKFPTKSPDSKGQSIILYLLRRCYAIIYKXXXXXXXXXXXXQPVHNQLSTVRRCLLELK 440
                  S  +K  SII++ LRRC+ IIYK            +P++NQLST+ R LL+LK
Sbjct: 362 RHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLK 419

Query: 441 RMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELKV 500
             GGV    +L P ++KL ++ + R +  F D  GNIP GQ  LNALL  C ++L  L++
Sbjct: 420 IAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEI 479

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 106 LSLCFLTVGLKNS------APATYASLSTVQCLLEHLCESNVFTHHD 146
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>NDAI0J01940 Chr10 (482424..485513) [3090 bp, 1029 aa] {ON}
           Anc_4.196 YGR056W
          Length = 1029

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 9/109 (8%)

Query: 184 NKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLF----KVRRGLLSLAAS 239
           NKNRI+++   K ++++ +   +K++SK+++ P DL+  +  L     K   G + L+A 
Sbjct: 762 NKNRIQKEQQRKEQIKYRL---HKVKSKIKQTPTDLTTAINALTTHTSKSTNGQIVLSAP 818

Query: 240 SKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKE--VAKMEAMRD 286
           S   +P E       L      L    L N L +Y KE  + K  + RD
Sbjct: 819 SAYVLPTEISLNNEPLSTITTTLQCSDLENQLRRYTKEELMIKKRSQRD 867

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,223,003
Number of extensions: 2262453
Number of successful extensions: 10664
Number of sequences better than 10.0: 220
Number of HSP's gapped: 11069
Number of HSP's successfully gapped: 238
Length of query: 532
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 418
Effective length of database: 40,409,475
Effective search space: 16891160550
Effective search space used: 16891160550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)