Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H07755g3.565ON1721728791e-122
Skud_7.253.565ON1811756312e-84
Smik_7.193.565ON1811756304e-84
Suva_7.193.565ON1811726226e-83
YGL242C3.565ON1811676201e-82
NDAI0B062703.565ON1821535941e-78
TPHA0A059903.565ON1761535773e-76
Kpol_507.113.565ON1891535612e-73
KAFR0J001803.565ON1821535592e-73
TDEL0D063303.565ON1791525583e-73
ZYRO0E09482g3.565ON1751655504e-72
Kwal_47.192623.565ON1711655487e-72
KNAG0D029503.565ON1741655392e-70
SAKL0F00858g3.565ON1731645322e-69
KLTH0G00770g3.565ON1711655183e-67
Ecym_25953.565ON1701645159e-67
NCAS0F039603.565ON1861525107e-66
KLLA0A00781g3.565ON1711705011e-64
TBLA0I034903.565ON1751724898e-63
AFR268C3.565ON1681684592e-58
YGR232W (NAS6)5.97ON2281121245e-08
KNAG0A015705.97ON2321101193e-07
Skud_7.5665.97ON2281121131e-06
NDAI0I005106.319ON2121011122e-06
Smik_16.745.97ON2281121096e-06
Ecym_20996.319ON2071051078e-06
Suva_3.896.319ON2231201071e-05
Skud_3.1296.319ON2221181052e-05
YCR051W6.319ON2221191052e-05
AAR063C6.319ON2201031034e-05
NDAI0D025405.97ON2361201025e-05
Suva_7.5245.97ON2281121025e-05
Kpol_1028.586.319ON208641017e-05
TDEL0A073406.319ON215461007e-05
Smik_3.1536.319ON2461181009e-05
CAGL0C03003g6.319ON20650991e-04
CAGL0L06600g5.97ON231133963e-04
NCAS0F005905.97ON235110963e-04
KAFR0B042605.97ON23085946e-04
ZYRO0B15114g5.97ON226120936e-04
ZYRO0D08690g6.319ON20845937e-04
TBLA0F040206.319ON219103910.001
KNAG0I025906.319ON21450910.001
SAKL0A01870g6.319ON206110900.002
Skud_9.592.257ON107777910.002
YIL112W (HOS4)2.257ON108378910.002
Suva_9.822.257ON114176900.003
KAFR0J025006.319ON21250880.003
KLTH0A06248g6.319ON202100880.003
KAFR0J015402.257ON106863880.005
TDEL0G012005.97ON22794870.005
Smik_9.572.257ON108576880.005
NCAS0D044306.319ON23046870.005
TPHA0D037906.319ON21346840.012
KNAG0E018802.257ON992130850.013
KLLA0C09108g6.319ON20877830.015
Kwal_23.62186.319ON202104820.017
KLLA0E15709g5.97ON23087830.017
TBLA0A007802.639ON72697840.018
CAGL0H00935g6.265ON193133800.034
Kpol_1045.523.175ON125588810.038
Kpol_1050.625.97ON230108790.047
Kwal_27.127505.97ON23394780.064
KNAG0M025102.639ON41187790.065
CAGL0F06831g2.662ON109299790.069
Suva_13.2432.639ON416108790.073
TPHA0A051005.97ON228108770.099
KLTH0C01650g5.97ON23294770.10
TPHA0I015808.599ON1246115780.11
CAGL0C01309g2.257ON111076770.12
Skud_13.2242.639ON422108770.12
YMR068W (AVO2)2.639ON426108760.14
ZYRO0E00924g2.639ON40852760.14
NCAS0C051602.639ON40884760.15
SAKL0G19646g2.662ON1118109770.15
NCAS0B064102.257ON105476770.15
KLTH0C00638g2.662ON1085100760.17
Smik_13.2472.639ON430100760.17
TDEL0A067806.265ON20087740.19
TPHA0F012202.257ON107845760.20
ADL244W2.257ON1089138760.20
Skud_1.913.175ON116555740.32
Suva_1.1103.175ON115954740.33
TBLA0B074005.97ON22887730.34
KLLA0F03619g2.257ON96045740.36
Smik_1.1073.175ON117954730.38
ZYRO0A05258g3.175ON154854730.41
Ecym_30246.20ON107977720.53
Ecym_20825.97ON23375710.54
KAFR0A001702.662ON105484720.60
AER388C5.626ON72480720.63
NDAI0A064303.175ON131272720.65
NDAI0G030203.175ON149579720.67
NCAS0B086601.60ON75159710.68
TDEL0B073302.639ON37546710.68
Kwal_33.132591.60ON66461710.69
KNAG0M024102.662ON1150104710.75
Kpol_1039.262.257ON120445710.76
TBLA0G025002.257ON125972710.77
KLTH0F01826g1.60ON66380710.82
Ecym_30636.122ON60994710.84
NCAS0C036803.175ON120854710.87
YAR042W (SWH1)3.175ON118854710.88
NDAI0G045402.639ON45682700.88
TDEL0C040402.257ON1007130710.89
TDEL0D044803.175ON126854701.1
Kwal_14.8892.662ON1094123701.1
Sklu_YGOB_Anc_6.20singletonOFF84977701.2
SAKL0G15532g5.97ON23394681.3
Sklu_YGOB_Anc_6.20b6.20ON108877691.3
NDAI0B037002.257ON114176691.3
KNAG0K012303.175ON122854691.3
SAKL0E08382g2.257ON108576691.3
KLLA0F26004g2.639ON336111681.6
Kwal_14.9822.639ON41628681.8
KAFR0A002802.639ON38727681.8
ACR006C6.20ON1071111681.9
Kpol_1018.1057.409ON104890672.2
ZYRO0D02332g2.257ON88145672.6
Ecym_34092.639ON43650662.8
ZYRO0F03850g8.69ON214335672.8
ZYRO0C11132g5.626ON75996662.9
TBLA0E035702.201ON136852663.1
TPHA0P005803.175ON125753663.2
KLTH0G09724g2.257ON107345663.2
TPHA0H007703.175ON124553663.3
KNAG0C006501.60ON74859663.4
KLTH0C01232g2.639ON42039653.5
NDAI0D044304.232ON80371663.5
ADR151W2.639ON42051653.7
CAGL0D01012g4.232ON80252663.8
Smik_5.2567.409ON108672654.1
NCAS0C018208.599ON113342654.2
Kwal_23.49142.257ON104345654.4
KAFR0G031704.232ON78081654.7
SAKL0G15554g5.96ON109058654.9
KLLA0B08327g8.753ON153486646.1
Kpol_1002.186.265ON20647636.1
CAGL0M00374g4.370ON140242646.3
KLLA0E20791g7.409ON93333646.6
Kpol_1037.53.175ON121253646.8
ACR165W2.662ON1139107646.8
KAFR0C009403.175ON112090646.9
CAGL0F06655g2.639ON40827637.9
TBLA0D016705.525ON101847638.4
CAGL0C05049g3.175ON118154629.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H07755g
         (172 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {O...   343   e-122
Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON} YG...   247   2e-84
Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON} YG...   247   4e-84
Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON} YG...   244   6e-83
YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON} Puta...   243   1e-82
NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3....   233   1e-78
TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3....   226   3e-76
Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON} ...   220   2e-73
KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}...   219   2e-73
TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3....   219   3e-73
ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly ...   216   4e-72
Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL24...   215   7e-72
KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.56...   212   2e-70
SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}...   209   2e-69
KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}...   204   3e-67
Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...   202   9e-67
NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.56...   201   7e-66
KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...   197   1e-64
TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.56...   192   8e-63
AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON} Sy...   181   2e-58
YGR232W Chr7 (953960..954646) [687 bp, 228 aa] {ON}  NAS6Proteas...    52   5e-08
KNAG0A01570 Chr1 complement(78024..78722) [699 bp, 232 aa] {ON} ...    50   3e-07
Skud_7.566 Chr7 (928849..929535) [687 bp, 228 aa] {ON} YGR232W (...    48   1e-06
NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON...    48   2e-06
Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON...    47   6e-06
Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON} ...    46   8e-06
Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W (R...    46   1e-05
Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W (...    45   2e-05
YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative pro...    45   2e-05
AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON} Sy...    44   4e-05
NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97       44   5e-05
Suva_7.524 Chr7 (908440..909126) [687 bp, 228 aa] {ON} YGR232W (...    44   5e-05
Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {...    44   7e-05
TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6....    43   7e-05
Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W (...    43   9e-05
CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar...    43   1e-04
CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} simila...    42   3e-04
NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON...    42   3e-04
KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97...    41   6e-04
ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa] ...    40   6e-04
ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {O...    40   7e-04
TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.31...    40   0.001
KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON...    40   0.001
SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {O...    39   0.002
Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W ...    40   0.002
YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subun...    40   0.002
Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W ...    39   0.003
KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.3...    39   0.003
KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar...    39   0.003
KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa] ...    39   0.005
TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON...    38   0.005
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    39   0.005
NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319      38   0.005
TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.31...    37   0.012
KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.2...    37   0.013
KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {O...    37   0.015
Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051...    36   0.017
KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa] ...    37   0.017
TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {O...    37   0.018
CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly si...    35   0.034
Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]...    36   0.038
Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON} (13721...    35   0.047
Kwal_27.12750 s27 (1360301..1361002) [702 bp, 233 aa] {ON} YGR23...    35   0.064
KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {...    35   0.065
CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} simil...    35   0.069
Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 ...    35   0.073
TPHA0A05100 Chr1 (1148395..1149081) [687 bp, 228 aa] {ON} Anc_5....    34   0.099
KLTH0C01650g Chr3 complement(146654..147352) [699 bp, 232 aa] {O...    34   0.10 
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    35   0.11 
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    34   0.12 
Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068...    34   0.12 
YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}  AVO2Compo...    34   0.14 
ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON...    34   0.14 
NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] ...    34   0.15 
SAKL0G19646g Chr7 (1690766..1694122) [3357 bp, 1118 aa] {ON} sim...    34   0.15 
NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]...    34   0.15 
KLTH0C00638g Chr3 complement(63995..67252) [3258 bp, 1085 aa] {O...    34   0.17 
Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068...    34   0.17 
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    33   0.19 
TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {...    34   0.20 
ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic h...    34   0.20 
Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W ...    33   0.32 
Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W...    33   0.33 
TBLA0B07400 Chr2 complement(1762348..1763034) [687 bp, 228 aa] {...    33   0.34 
KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} simila...    33   0.36 
Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W...    33   0.38 
ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some ...    33   0.41 
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...    32   0.53 
Ecym_2082 Chr2 (140585..141286) [702 bp, 233 aa] {ON} similar to...    32   0.54 
KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON...    32   0.60 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    32   0.63 
NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON} Anc_...    32   0.65 
NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {...    32   0.67 
NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1...    32   0.68 
TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON} Anc_2...    32   0.68 
Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182...    32   0.69 
KNAG0M02410 Chr13 complement(443330..446782) [3453 bp, 1150 aa] ...    32   0.75 
Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON} (82489...    32   0.76 
TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {...    32   0.77 
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    32   0.82 
Ecym_3063 Chr3 complement(120315..122144) [1830 bp, 609 aa] {ON}...    32   0.84 
NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {...    32   0.87 
YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Prote...    32   0.88 
NDAI0G04540 Chr7 (1085981..1087351) [1371 bp, 456 aa] {ON} Anc_2...    32   0.88 
TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {...    32   0.89 
TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3....    32   1.1  
Kwal_14.889 s14 complement(96498..99782) [3285 bp, 1094 aa] {ON}...    32   1.1  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...    32   1.2  
SAKL0G15532g Chr7 (1336097..1336798) [702 bp, 233 aa] {ON} simil...    31   1.3  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...    31   1.3  
NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {...    31   1.3  
KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa] ...    31   1.3  
SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa] ...    31   1.3  
KLLA0F26004g Chr6 complement(2411261..2412271) [1011 bp, 336 aa]...    31   1.6  
Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON...    31   1.8  
KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}...    31   1.8  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...    31   1.9  
Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa...    30   2.2  
ZYRO0D02332g Chr4 (180577..183222) [2646 bp, 881 aa] {ON} simila...    30   2.6  
Ecym_3409 Chr3 complement(771477..772787) [1311 bp, 436 aa] {ON}...    30   2.8  
ZYRO0F03850g Chr6 (322303..328734) [6432 bp, 2143 aa] {ON} simil...    30   2.8  
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    30   2.9  
TBLA0E03570 Chr5 (892332..896438) [4107 bp, 1368 aa] {ON} Anc_2....    30   3.1  
TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON} Anc_3...    30   3.2  
KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} simil...    30   3.2  
TPHA0H00770 Chr8 (156886..160623) [3738 bp, 1245 aa] {ON} Anc_3....    30   3.3  
KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.6...    30   3.4  
KLTH0C01232g Chr3 complement(112021..113283) [1263 bp, 420 aa] {...    30   3.5  
NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON} Anc_4...    30   3.5  
ADR151W Chr4 (971058..972320) [1263 bp, 420 aa] {ON} Syntenic ho...    30   3.7  
CAGL0D01012g Chr4 (118878..121286) [2409 bp, 802 aa] {ON} simila...    30   3.8  
Smik_5.256 Chr5 complement(391451..394711) [3261 bp, 1086 aa] {O...    30   4.1  
NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {...    30   4.2  
Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112...    30   4.4  
KAFR0G03170 Chr7 complement(658032..660374) [2343 bp, 780 aa] {O...    30   4.7  
SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa...    30   4.9  
KLLA0B08327g Chr2 (742205..746809) [4605 bp, 1534 aa] {ON} simil...    29   6.1  
Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON} (48873.....    29   6.1  
CAGL0M00374g Chr13 (49330..53538) [4209 bp, 1402 aa] {ON} simila...    29   6.3  
KLLA0E20791g Chr5 complement(1852522..1855323) [2802 bp, 933 aa]...    29   6.6  
Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON...    29   6.8  
ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic h...    29   6.8  
KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3....    29   6.9  
CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} simila...    29   7.9  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...    29   8.4  
CAGL0C05049g Chr3 (475910..479455) [3546 bp, 1181 aa] {ON} simil...    28   9.6  

>CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242c
          Length = 172

 Score =  343 bits (879), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/172 (100%), Positives = 172/172 (100%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY
Sbjct: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIK 120
           GSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIK
Sbjct: 61  GSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIK 120

Query: 121 NINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDDDDGEED 172
           NINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDDDDGEED
Sbjct: 121 NINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDDDDGEED 172

>Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  247 bits (631), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 3/175 (1%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M +EGAS  EQLLDA+RRNN DLL ++F+ L  D+EKIA+LIN SK+PLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQ+GGI+IDPQN VDGDTPLHVTVRY  EEPEHG FIARNLIEVGADPR+
Sbjct: 61  GSWEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDG--DEGDEPELIDDDDGEED 172
           +N NNQ P+DLVHGD+ DELIDLLQGA LA D+ +G  D  ++ E+IDD   ++D
Sbjct: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDSTNGLADNNEDEEMIDDSPSDDD 175

>Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  247 bits (630), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 146/175 (83%), Gaps = 3/175 (1%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M +EGAS  EQLLDA+RRNN DLL ++F +L ++ EKIA+LIN S++PLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD +LDQEG I+IDPQN VDGDTPLHVTVRY  EEPEHG FIARNLIEVGADPR+
Sbjct: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDG--DEGDEPELIDDDDGEED 172
           +N NNQ P+DLVHGD+ DELIDLLQGA LA DN +G  D  ++ E+IDD   ++D
Sbjct: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNNEDEEMIDDGSSDDD 175

>Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  244 bits (622), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 143/172 (83%), Gaps = 8/172 (4%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M +EGAS  EQLLDA+RRNN DL+ ++F++L +D EKIA+LIN S++PLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQ+GGI+IDPQN VDGDTPLHVTV+Y  EEPEHG FIARNLIEVGADPRI
Sbjct: 61  GSWEVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPRI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDDDDGEE 171
           KN NNQ P+DLVHGD+ DELIDLLQGA LA D+ +G       L D D+ EE
Sbjct: 121 KNYNNQKPIDLVHGDELDELIDLLQGAELAIDSNNG-------LADKDESEE 165

>YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON}
           Putative protein of unknown function; deletion mutant is
           viable
          Length = 181

 Score =  243 bits (620), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 123/167 (73%), Positives = 142/167 (85%), Gaps = 3/167 (1%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M++EGAS  EQLLDA+RRNN DLL ++F++L +D EKIA+LIN SK+PLGNTALHLCCKY
Sbjct: 1   MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQ+G I+IDPQN VDGDTPLHVTVRY  EEPEHG FIARNLIEVGADPR+
Sbjct: 61  GSWEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAAD--NYDGDEGDEPELI 164
           +N NNQ P+DLVHGD+ DELIDLLQGA LA D  N  GD  ++ E+I
Sbjct: 121 RNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNEDGEMI 167

>NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3.565
           YGL242C
          Length = 182

 Score =  233 bits (594), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (84%), Gaps = 1/153 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MS EGAS  EQLLDASRRNN DLL  IF TL +D EKIA+LINT+KDPLGNTALHL CKY
Sbjct: 1   MSVEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQEG I+IDP+N +DGDTPLH  VRY  +EPEHG FIA+NLIEVGADPRI
Sbjct: 61  GSWEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPRI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADN 152
           +N +NQ P+DL+HGDD D LIDLLQGA LAADN
Sbjct: 121 RNNHNQKPIDLIHGDDFDSLIDLLQGAELAADN 153

>TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3.565
           YGL242C
          Length = 176

 Score =  226 bits (577), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 110/153 (71%), Positives = 128/153 (83%), Gaps = 1/153 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MSSEGAS  EQLLD +RRNN DL +SI E+LG+D   I+ELINTS+DP GNTALHL C+Y
Sbjct: 1   MSSEGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQEG I+IDPQN  DGDTPLHVTV+Y   EPEHG FIA+NLIEVGADPRI
Sbjct: 61  GSWEVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPRI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADN 152
           +N  N+ P+D +HGD+ +ELIDLLQGA ++ADN
Sbjct: 121 RNNRNERPIDCIHGDELEELIDLLQGAEISADN 153

>Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON}
           complement(58716..59285) [570 nt, 190 aa]
          Length = 189

 Score =  220 bits (561), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (85%), Gaps = 1/153 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MS+EGAS  EQLLD SRRNN DLL +I ETL +D EKIA LINTSKDP GNTALHLCCKY
Sbjct: 1   MSTEGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQEG I+IDP+N  DGDTPLHVTVRY  EEPEHG FIA NLIEVG+DPRI
Sbjct: 61  GSWEVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPRI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADN 152
           KN +NQ P+DL+HGD+ D+LIDLLQGA +AAD+
Sbjct: 121 KNNSNQKPIDLIHGDELDDLIDLLQGAEIAADS 153

>KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}
           Anc_3.565 YGL242C
          Length = 182

 Score =  219 bits (559), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 107/153 (69%), Positives = 127/153 (83%), Gaps = 1/153 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M +EGAS GEQLLDASRRNN DLL ++F  L +D +KIA+LIN+SKDP GNTALHL CKY
Sbjct: 1   METEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQ-NVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILD EG I+IDP+ N+DG+TPLH  V+Y   EPEHG FIA NLI+VGADPR+
Sbjct: 61  GSWEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPRL 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADN 152
           KN NNQ P+DL+H ++ D+LIDLLQGA LAAD+
Sbjct: 121 KNNNNQRPIDLIHSEELDDLIDLLQGAELAADH 153

>TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3.565
           YGL242C
          Length = 179

 Score =  219 bits (558), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 127/152 (83%), Gaps = 2/152 (1%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MSSEGAS GEQLL+ASRRNN DLL+ I E++ +D  KIAE++N SKDP GNTALHLCCK 
Sbjct: 1   MSSEGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCKS 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD +LDQ G I+IDPQN +DGDTPLH TVRY  +EPEHG FIARNLIEVGADPR+
Sbjct: 61  GSWEVLDILLDQ-GDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPRL 119

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAAD 151
           +N +NQ P+DL+H +D DEL DLLQGA LA D
Sbjct: 120 RNKHNQKPIDLIHSEDLDELTDLLQGAELAID 151

>ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 175

 Score =  216 bits (550), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (83%), Gaps = 2/165 (1%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           M  EGAS GEQLLDASRRNN DLL  +FE LG D E+I+ELIN S+DPLG+TALHLCC+Y
Sbjct: 1   MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCRY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQNV-DGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQ+G I+IDPQN  + DTPLHVTVRY  +EPEHG FIARNL+EVGADPRI
Sbjct: 61  GSWEVLDEILDQDG-IEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPRI 119

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELI 164
           KN+N   P+DL+HGDD DELIDLLQGA LAADN   D+G+E E+I
Sbjct: 120 KNMNGDKPVDLIHGDDLDELIDLLQGAELAADNDRVDDGEEGEII 164

>Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL242C
           - Hypothetical ORF [contig 344] FULL
          Length = 171

 Score =  215 bits (548), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 118/165 (71%), Positives = 137/165 (83%), Gaps = 1/165 (0%)

Query: 3   SEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGS 62
           S+GAS  EQLLDASRRNN DLL ++F+ L +D +KIAELINT+ DP+GN++LHLCCK GS
Sbjct: 2   SQGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCKSGS 61

Query: 63  WEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
           WEVLD ILDQEGGI+ID +N V+GDTPLHVTVRY  EEPEHG FIARNLIEVGADPRI N
Sbjct: 62  WEVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPRIIN 121

Query: 122 INNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDD 166
              Q PLDLVHG+D D+L+DLLQGA LAA+N+     D+ ELIDD
Sbjct: 122 KAGQKPLDLVHGNDLDDLVDLLQGAELAAENHGVVNEDDAELIDD 166

>KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.565
           YGL242C
          Length = 174

 Score =  212 bits (539), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 115/165 (69%), Positives = 133/165 (80%), Gaps = 1/165 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MS +GAS  EQLLDASRRNN DLL  +F+ L +D  KIAELINT++DP+GNTALHLCCKY
Sbjct: 1   MSVKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILDQEG I+IDP+N +DGDTPLH+ VRY  +EPEHG FIA NL+EVGAD RI
Sbjct: 61  GSWEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADARI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELI 164
           KN NNQ P+DL+HGD+ D+L DLLQGA LA D+      DE ELI
Sbjct: 121 KNNNNQKPVDLIHGDELDDLFDLLQGAELARDHPGAINEDEVELI 165

>SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 173

 Score =  209 bits (532), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (83%), Gaps = 1/164 (0%)

Query: 4   EGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSW 63
           +GAS  EQLLDASRRNN+DLL +I E+L ++ +KIA+LIN++ DPLGNT LHLCCKYGSW
Sbjct: 5   QGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCKYGSW 64

Query: 64  EVLDTILDQEGGIDIDPQ-NVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNI 122
           EVLD ILDQ+GGI+IDP+ NVDGDTPLHVTVRY  EEPEHG FIA+NLIEVGADPRI+N 
Sbjct: 65  EVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPRIRNK 124

Query: 123 NNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDD 166
             Q P+DL+HGD  D+L+DLLQGA LAADN      ++ E+IDD
Sbjct: 125 AGQKPVDLIHGDGLDDLLDLLQGAELAADNEGVINEEDAEIIDD 168

>KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242C Hypothetical ORF
          Length = 171

 Score =  204 bits (518), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (80%), Gaps = 1/165 (0%)

Query: 3   SEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGS 62
           S+GAS  EQLLDASRRNN DLL ++F+ LG++  +IA+LINT+ DP+GN+ LHLCC YGS
Sbjct: 2   SDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCMYGS 61

Query: 63  WEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
           W+VLD ILDQEGGI+ID +N V+GDTPLH  VRY  EEPEHG FIARNLIEVGADPRI N
Sbjct: 62  WDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPRIVN 121

Query: 122 INNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDD 166
              Q P+DLVHGD+ D+LIDLLQGA LAA+N      ++ E+IDD
Sbjct: 122 QAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAVNEEDAEVIDD 166

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score =  202 bits (515), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 125/164 (76%), Gaps = 4/164 (2%)

Query: 4   EGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSW 63
           EGA+ GEQLLDASRRNN DLL  I E    D+  +A+LIN +KDP GNT LH+CCKYGSW
Sbjct: 5   EGATYGEQLLDASRRNNVDLLEFILE---QDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61

Query: 64  EVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNIN 123
           +VLDTILD +  I+IDPQNV+GDTPLH  V+Y +EEPEHG FIA NLI+VGADPRIKN +
Sbjct: 62  DVLDTILDVDCPIEIDPQNVEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNNS 121

Query: 124 NQLPLDLVHGDDKDELIDLLQGAALAADNY-DGDEGDEPELIDD 166
            + P++L+H D   +LIDLLQ A LAADN       +E E+IDD
Sbjct: 122 GRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEAEVIDD 165

>NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.565
           YGL242C
          Length = 186

 Score =  201 bits (510), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 124/152 (81%), Gaps = 1/152 (0%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MS EGAS  EQLLDASRRNN DLL   F  L +D +KIA+LINT+KDPLGNTALHL  KY
Sbjct: 1   MSVEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASKY 60

Query: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           GSWEVLD ILD +G I+IDPQN +DGDTPLH  VRY  EEPEHG FIA+NLIEVGAD RI
Sbjct: 61  GSWEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADARI 120

Query: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAAD 151
            N +NQ P+DL+HGD+ D+L+DLLQGA LAAD
Sbjct: 121 ANKHNQKPVDLIHGDELDDLVDLLQGAELAAD 152

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score =  197 bits (501), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 130/170 (76%), Gaps = 9/170 (5%)

Query: 3   SEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGS 62
           +EGAS  EQLLDASRRNN+DLL+++ ETL  D + I  LIN SKDPLGNTA+HLC KYGS
Sbjct: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61

Query: 63  WEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
           W+VLD +LDQE G+D++ QN +DGDT LH+ V Y  +EPE+G FIA NLIEVGADPRI+N
Sbjct: 62  WDVLDVLLDQE-GVDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120

Query: 122 INNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELIDDDDGEE 171
              Q PL LVH D+ + L++LLQGA +AADN       + ++I+++D EE
Sbjct: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN-------KGKIINEEDAEE 163

>TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.565
           YGL242C
          Length = 175

 Score =  192 bits (489), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 98/172 (56%), Positives = 127/172 (73%), Gaps = 5/172 (2%)

Query: 2   SSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYG 61
           +++GAS  EQLL+A+RRNN DLL++I   L +D  KIA L+N SKD  GNTALHLC K+G
Sbjct: 3   TTQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAKHG 62

Query: 62  SWEVLDTILDQEGGIDIDPQNV-DGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIK 120
           SW+VLD +LDQEG I++DPQN+ DGDTPLH  VR   +EPE G FIA+NLI VGADPRI+
Sbjct: 63  SWDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPRIR 122

Query: 121 NINNQLPLDLVHGDDKDELIDLLQGAALA----ADNYDGDEGDEPELIDDDD 168
           N  NQ P+DL+HG+    L+D LQGA LA    A     D+ ++ E++++DD
Sbjct: 123 NKQNQKPVDLIHGNSLTALVDTLQGAELAVATGAHGVAADDDEDGEIVEEDD 174

>AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL242C
          Length = 168

 Score =  181 bits (459), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 118/168 (70%), Gaps = 4/168 (2%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           MS +GAS GEQLL+A+RRNN +LL ++    G    +I +LIN S+DPLGNT LHLCC +
Sbjct: 1   MSVDGASLGEQLLEAARRNNVELLEAVVRDAG---PEIEDLINGSRDPLGNTCLHLCCTH 57

Query: 61  GSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIK 120
           GSWE LD ILD +  I++DPQN  GDTPLH   RY  EEPEH  F+A NL++VGADPR++
Sbjct: 58  GSWEALDMILDLDCAIEVDPQNTAGDTPLHAAARYAAEEPEHATFLASNLVQVGADPRVR 117

Query: 121 NINNQLPLDLVHGDDKDELIDLLQGAALAADNY-DGDEGDEPELIDDD 167
           N     P++LVHG + + L+D+LQG  LA D + +    DE E IDD+
Sbjct: 118 NKAGLRPVELVHGSELEPLVDVLQGGELAYDTHGEAVNADEIEEIDDE 165

>YGR232W Chr7 (953960..954646) [687 bp, 228 aa] {ON}
           NAS6Proteasome-interacting protein involved in the
           assembly of the base subcomplex of the 19S proteasomal
           regulatory particle (RP); ortholog of human oncoprotein
           gankyrin, which interacts with the Rb tumor suppressor
           and CDK4/6
          Length = 228

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G+ EV+ ++ D+    D++     G T LH+ V       +    +++ 
Sbjct: 72  GWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVG------KKWFEVSQF 125

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           LIE GA  RIK+  NQ+PL         +LI+LL G   +A N+   +G  P
Sbjct: 126 LIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTP 177

>KNAG0A01570 Chr1 complement(78024..78722) [699 bp, 232 aa] {ON}
           Anc_5.97 YGR232W
          Length = 232

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 6/110 (5%)

Query: 52  TALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLI 111
           T  H+ C  GS  ++  + +++   D++ Q   G T LH+ V     E      + R L+
Sbjct: 78  TPFHIACAVGSLTLVKKLYERDTKPDLNLQTGQGTTALHLAVAKGHYE------VVRFLV 131

Query: 112 EVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           E GA  RIK+ N Q+PL         +L++ L  A  +  N+    G  P
Sbjct: 132 ENGASTRIKDKNQQIPLHRAASVGSMKLVEFLCTAGKSPINWTDRSGWTP 181

>Skud_7.566 Chr7 (928849..929535) [687 bp, 228 aa] {ON} YGR232W
           (REAL)
          Length = 228

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G   V+ ++ D+    D++     G T LH+TV       +    +++ 
Sbjct: 72  GWTPFHIACSVGDLGVVKSLYDRPVKPDLNKVTNQGITCLHLTVG------KKWFEVSQF 125

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           LI  GA  RIK+  NQ+PL         +LI LL GA  +  N+   +G  P
Sbjct: 126 LINNGASVRIKDKFNQIPLHRAASVGSLKLIALLCGAGKSPVNWQDKQGWTP 177

>NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON}
           Anc_6.319 YCR051W
          Length = 212

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 55/101 (54%), Gaps = 10/101 (9%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKDP G T +H    YG  ++L ++  + GG DI+ ++ DGDTPLH    +C++     +
Sbjct: 30  SKDPNGYTPIHAAAAYGHIDLLRSLCSEFGG-DINIRDNDGDTPLH----HCEDYATGKV 84

Query: 105 FIARNLIEVGADPRIKNINNQLPLDLVHGD-DKDELIDLLQ 144
            +     E+G +  + N   + PL++V  D +  ELI  L+
Sbjct: 85  IVE----ELGGNFTLTNNEGKTPLEVVEEDGESTELIQYLK 121

>Smik_16.74 Chr16 complement(142064..142750) [687 bp, 228 aa] {ON}
           YGR232W (REAL)
          Length = 228

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 6/112 (5%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G+ +V+ ++ D+    D++     G T LH+ V       +    +++ 
Sbjct: 72  GWTPFHIACSVGNLDVVKSLYDRPIKPDLNKVTNQGVTCLHLAVG------KKWFEVSQF 125

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           LI  GA  RIK+  NQ+PL         +LI+LL G   +  N+   +G  P
Sbjct: 126 LITNGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSPVNWPDTQGWTP 177

>Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON}
           similar to Ashbya gossypii AAR063C
          Length = 207

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 13/105 (12%)

Query: 41  LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEP 100
           L   SKDP G TA+H    YG  ++L  ++++  G DI+ ++ DGDTPLH T        
Sbjct: 25  LTANSKDPNGYTAVHGAASYGHVDLLRLLVNKYHG-DINVRDNDGDTPLHHT-------- 75

Query: 101 EHGLFIARNLI-EVGADPRIKNINNQLPLDLVHGDDKDELIDLLQ 144
              +  A+ +I E+ AD +  N   + PLD+   D   E I+L+Q
Sbjct: 76  -EDVATAKVIIEELNADFQATNNEGKTPLDVFEED--QESIELIQ 117

>Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W
           (REAL)
          Length = 223

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKD  G T +H    YG  ++L  +     G DI+  + DGDTPLH             +
Sbjct: 32  SKDVNGYTPMHAAAAYGHADLLKKLCSVYNG-DINVLDNDGDTPLHHV---------EDV 81

Query: 105 FIARNLI-EVGADPRIKNINNQLPLD-LVHGDDKDELIDLLQ---GAALAADNYDGDEGD 159
             AR ++ E+G +  I+N   Q P D  V   +  ELI+ ++   G A AA + DG +G+
Sbjct: 82  ATARLIVEELGGNVTIRNAEGQTPYDSFVENGEDGELIEYMRIKSGVADAASSVDGSQGE 141

>Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W
           (REAL)
          Length = 222

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 12/118 (10%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKD  G T +H    YG  ++L  +  +  G DI+  + DGDTPLH    + ++     L
Sbjct: 32  SKDINGYTPMHAAAAYGHTDLLKKMCSEYNG-DINVLDNDGDTPLH----HVEDVATAKL 86

Query: 105 FIARNLIEVGADPRIKNINNQLPLDL-VHGDDKDELIDLLQGAALAAD--NYDGDEGD 159
            +     E+G D  ++N   Q P DL V   +  ELI+ ++  +  AD    DG +GD
Sbjct: 87  IVE----ELGGDFTVRNAEGQTPYDLFVENGEDGELIEYMRIKSGVADAQGVDGSQGD 140

>YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and
           nucleus; contains ankyrin (Ank) repeats; YCR051W is not
           an essential gene
          Length = 222

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 60/119 (50%), Gaps = 14/119 (11%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKD  G T +H    YG  ++L  + ++  G DI+  + DGDTPLH             +
Sbjct: 32  SKDINGYTPMHAAAAYGHLDLLKKMCNEYNG-DINVLDNDGDTPLHHV---------EDV 81

Query: 105 FIARNLI-EVGADPRIKNINNQLPLD-LVHGDDKDELIDLLQGAALAADNY--DGDEGD 159
             AR ++ E+G D  I+N+  Q P D  V   +  ELI+ ++  +  AD +  DG +G+
Sbjct: 82  ATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIEYMRIKSGVADVHGVDGVQGE 140

>AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR051W
          Length = 220

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 14/103 (13%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           KDP G T +H    YG  ++L  ++    G D++ ++ DGDTPLH             L 
Sbjct: 29  KDPNGYTPMHAAAAYGHIDLLRLLIANYRG-DVNVRDNDGDTPLHHA---------EDLQ 78

Query: 106 IARNLI-EVGADPRIKNINNQLPLDLVHGDDKD--ELIDLLQG 145
             R L+ E+GADP + N +   PL  V+ DD +  ELI+ ++ 
Sbjct: 79  TVRVLVEELGADPSLLNADGNTPL-AVYEDDAENAELIEYMRA 120

>NDAI0D02540 Chr4 (584626..585336) [711 bp, 236 aa] {ON} Anc_5.97
          Length = 236

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 7/120 (5%)

Query: 42  INTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPE 101
           ++T KD    T +H+    G+  +L  +++    +D++ Q V G TP+H+ V       +
Sbjct: 71  VDTLKDDSLWTPIHIASSVGNSNILKQLIEGRN-VDLNLQTVQGTTPIHLAV------SK 123

Query: 102 HGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
             L I + L+E GA  RIK+   QLPL          L+++L     +  N    +G  P
Sbjct: 124 KHLQICKFLLENGASVRIKDKQGQLPLHRAASIGSMGLVEMLCKEGRSPVNVKDKQGWTP 183

>Suva_7.524 Chr7 (908440..909126) [687 bp, 228 aa] {ON} YGR232W
           (REAL)
          Length = 228

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G  EV+ ++ D+    D++     G T LH+ V     E      +++ 
Sbjct: 72  GWTPFHIACSVGDLEVVKSLYDRPIKPDLNKVTNQGITCLHLAVGKKWYE------VSKF 125

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           LI+ GA  RIK+  NQ+PL          LI+LL     +  N+   +G  P
Sbjct: 126 LIDNGASVRIKDKLNQIPLHRAASVGSLRLIELLCDVGKSPVNWADRQGWTP 177

>Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa]
          {ON} complement(133357..133983) [627 nt, 209 aa]
          Length = 208

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 6/64 (9%)

Query: 41 LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH-----VTVRY 95
          L   SKDP G T +H    YG   +L+ +  + GG DI+ ++ DGDTPLH      T R+
Sbjct: 25 LTANSKDPNGYTPVHAAAAYGHIGLLEKLCKEYGG-DINVRDSDGDTPLHHVEDANTARF 83

Query: 96 CDEE 99
            EE
Sbjct: 84 IVEE 87

>TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON}
          Anc_6.319 YCR051W
          Length = 215

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 45 SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          SKDP G T++H    YG  E+L  +  Q  G DI+ ++ DGDTPLH
Sbjct: 29 SKDPNGYTSVHAAAAYGHIELLKKLCKQYNG-DINIRDNDGDTPLH 73

>Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W
           (REAL)
          Length = 246

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 12/118 (10%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           +KD  G T +H    YG  ++L  +  +  G DI+  + DGDTPLH    + ++     L
Sbjct: 56  TKDINGYTPMHAAAAYGHTDLLKKMCSEYNG-DINVLDNDGDTPLH----HVEDVGTAKL 110

Query: 105 FIARNLIEVGADPRIKNINNQLPLD-LVHGDDKDELIDLLQGAALAADNY--DGDEGD 159
            +     E+G D  I+N   Q P D  V   +  ELI+ ++  +  AD++  DG +G+
Sbjct: 111 IVE----ELGGDFTIRNAEGQTPYDSFVENGEDGELIEYMRIKSGVADSHGADGSQGE 164

>CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar
          to uniprot|P25631 Saccharomyces cerevisiae YCR051w
          Length = 206

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 41 LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          L   SKDP G T +H    YG  ++L  +  + GG DI+ ++ DGDTPLH
Sbjct: 23 LSANSKDPNGYTPVHAAAAYGHLDLLRKLCQEHGG-DINVRDSDGDTPLH 71

>CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} similar
           to uniprot|P50086 Saccharomyces cerevisiae YGR232w
          Length = 231

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 57/133 (42%), Gaps = 8/133 (6%)

Query: 42  INTSKDPLGNTALHLCCKYGSWEVLDTILDQ--EGGIDIDPQNVDGDTPLHVTVRYCDEE 99
           I+T  D  G T  H+ C  G  +++D + +   +   ++D Q   G T LH+ V      
Sbjct: 65  IDTLTDEAGWTPFHISCSIGHLDIVDQLYNNNPDARPNLDLQTSQGVTALHLAVA----- 119

Query: 100 PEHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGD 159
            +  L + + LI++GA  RIK+   Q+ L          +++ L   A +  N+    G 
Sbjct: 120 -KKHLEVCKYLIKLGASVRIKDKKGQIALHRAAAVGSIGVVEFLCSTAKSPVNWKDASGW 178

Query: 160 EPELIDDDDGEED 172
            P      +G  D
Sbjct: 179 TPLFHAIAEGHAD 191

>NCAS0F00590 Chr6 complement(117069..117776) [708 bp, 235 aa] {ON}
           Anc_5.97 YGR232W
          Length = 235

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 6/110 (5%)

Query: 52  TALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLI 111
           T +H+    G+  +L  + D+E   D++ Q   G T LH++V       +  L + + LI
Sbjct: 80  TPVHIAASVGNLFILTQLYDREIKPDLNLQTKQGTTALHLSV------AKKHLSVCKFLI 133

Query: 112 EVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           + GA  R+K+   QLPL          L++LL     +  N    +G  P
Sbjct: 134 DNGASVRLKDQKGQLPLHRAASIGSMTLVELLCTQGKSPVNVRDKQGWTP 183

>KAFR0B04260 Chr2 (884243..884935) [693 bp, 230 aa] {ON} Anc_5.97
           YGR232W
          Length = 230

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 10/85 (11%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTV--RYCDEEPEHG 103
           KD  G T  H+ C  G+  +++ + +++   D++     G TPLH+ V  +Y D      
Sbjct: 71  KDDAGWTVFHIACSIGNLSIVEALYNRDIKPDLNLATSQGVTPLHLAVAKKYND------ 124

Query: 104 LFIARNLIEVGADPRIKNINNQLPL 128
             + + LI+ GA  RIK+   Q+ L
Sbjct: 125 --VVKFLIDNGASVRIKDKKGQIAL 147

>ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 226

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 7/120 (5%)

Query: 42  INTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPE 101
           IN  KD  G T  H+ C  G+ +++  +       D++     G T LH+ V       +
Sbjct: 63  INELKDESGWTPFHIACAVGNLDIVKQLYALHTKPDLNMPTNQGITALHLAV-----SKK 117

Query: 102 HGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEP 161
           H   I   L+  GA  R+K+  +QLPL          ++D+L  A    +  DG EG  P
Sbjct: 118 HAR-ICEFLLNNGASVRVKDKRSQLPLHRAAAIGSMGMVDMLCRAGSPLNRNDG-EGWTP 175

>ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa]
          {ON} highly similar to gnl|GLV|CAGL0C03003g Candida
          glabrata CAGL0C03003g and similar to YCR051W
          uniprot|P25631 Saccharomyces cerevisiae YCR051W
          Hypothetical ORF
          Length = 208

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 46 KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          KDP G T +H    YG  E+L  +  + GG +I+ ++ DGDTPLH
Sbjct: 30 KDPNGYTPVHAAAAYGHIELLRKLCQEYGG-NINVKDSDGDTPLH 73

>TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.319
           YCR051W
          Length = 219

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 11/103 (10%)

Query: 41  LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEP 100
           LI  SKDP G T +H    YG  ++L  +  +  G DI+  + DGDTPLH    +C++  
Sbjct: 25  LIANSKDPNGYTPIHAAAAYGHVDLLRLLCQKYNG-DINILDNDGDTPLH----HCEDVE 79

Query: 101 EHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL 143
              + I     E+G    +KN   +  L++   D   E  DL+
Sbjct: 80  TAKVIIE----ELGGGYNLKNNEGKTALEVFEED--SEFPDLI 116

>KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON}
          Anc_6.319 YCR051W
          Length = 214

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 41 LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          L   S DP G T +H    YG  ++L T+  +  G DI+ ++ DGDTPLH
Sbjct: 25 LTANSADPNGYTPIHAAAAYGHIDMLRTLCREYDG-DINIRDADGDTPLH 73

>SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 206

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 9/110 (8%)

Query: 41  LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEP 100
           L   S+DP G T +H    Y   E+L  +  +    DI+ ++ DGDTPLH    +C++  
Sbjct: 23  LSANSRDPNGYTPIHAAASYAHTELLRKLCSEPYNGDINVRDNDGDTPLH----HCEDVN 78

Query: 101 EHGLFIARNLIEVGADPRIKNINNQLPLDLVHGD-DKDELIDLLQGAALA 149
              + I     E+G D ++ N   +  L+    D +  ELI  ++  + A
Sbjct: 79  AAKVIIE----ELGGDYKLTNDEGKTALEAFEEDGEFPELIQYMRQVSGA 124

>Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W
           (REAL)
          Length = 1077

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  G T L + C  G ++V+  +L +EGG DI+ Q+  G+T LH        E      
Sbjct: 315 RDSGGRTRLQIACDKGKFDVVKKML-EEGGYDINDQDNAGNTALHEAALQGHIE------ 367

Query: 106 IARNLIEVGADPRIKNI 122
           I   LIE GAD  IK+I
Sbjct: 368 IVELLIENGADVNIKSI 384

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 14/100 (14%)

Query: 22  DLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQ 81
           D++  + E  G+D       IN  +D  GNTALH     G  E+++ +++    ++I   
Sbjct: 333 DVVKKMLEEGGYD-------IN-DQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSI 384

Query: 82  NVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
            + GDTPL       D      L + + L++  ADP I+N
Sbjct: 385 EMFGDTPL------IDASANGHLDVVKYLLKNDADPTIRN 418

>YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subunit
           of the Set3 complex, which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity; potential Cdc28p substrate
          Length = 1083

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHG-L 104
           +D  G T L + C  G ++V+  ++ +EGG DI+ Q+  G+T LH       E    G +
Sbjct: 326 RDSGGRTRLQIACDKGKYDVVKKMI-EEGGYDINDQDNAGNTALH-------EAALQGHI 377

Query: 105 FIARNLIEVGADPRIKNI 122
            I   LIE GAD  IK+I
Sbjct: 378 EIVELLIENGADVNIKSI 395

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 22  DLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQ 81
           D++  + E  G+D       IN  +D  GNTALH     G  E+++ +++    ++I   
Sbjct: 344 DVVKKMIEEGGYD-------IN-DQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSI 395

Query: 82  NVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
            + GDTPL       D      L + + L++ GADP I+N
Sbjct: 396 EMFGDTPL------IDASANGHLDVVKYLLKNGADPTIRN 429

>Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W
           (REAL)
          Length = 1141

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GNTALH     G  E+++ +++    ++I    + GDTPL       D      L 
Sbjct: 417 QDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPL------IDASANGHLD 470

Query: 106 IARNLIEVGADPRIKN 121
           + + L++ GADP I+N
Sbjct: 471 VVKYLLKQGADPTIRN 486

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  G T L + C  G ++V+  ++ ++GG DI+ Q+  G+T LH        E      
Sbjct: 383 RDSGGRTRLQIACDKGKFDVVQKMI-EDGGYDINDQDNAGNTALHEAALQGHIE------ 435

Query: 106 IARNLIEVGADPRIKNI 122
           I   LIE GAD  IK+I
Sbjct: 436 IVELLIENGADVNIKSI 452

>KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON}
          Anc_6.319 YCR051W
          Length = 212

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 41 LINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          L   +KDP G T +H    YG  ++L  +  +  G D++ ++ DGDTPLH
Sbjct: 25 LSANTKDPNGYTPVHAAAAYGHHDLLRKLCSEYNG-DVNIRDADGDTPLH 73

>KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051W
           Hypothetical ORF
          Length = 202

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 10/100 (10%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKDP G T +H    YG  ++L  +        ++ ++ DGDTPLH    +C++     +
Sbjct: 27  SKDPNGYTPIHAAASYGHIDLLRELCSAPYSGSVNVRDNDGDTPLH----HCEDANTARV 82

Query: 105 FIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQ 144
                L E+G D ++ N   +  L +   D   E  DL+Q
Sbjct: 83  I----LEELGGDAKLTNNEGKTALAVCEED--GEFTDLIQ 116

>KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa]
           {ON} Anc_2.257 YIL112W
          Length = 1068

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 28  FETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDT 87
           F    H      +     K+  G+T LH  C  G ++++  IL+ +  IDI  ++  G+T
Sbjct: 314 FSMKSHRKSTSKQRKTVHKNAFGSTKLHTACNKGKYDIVKQILE-DDEIDIHDRDNAGNT 372

Query: 88  PLH 90
           PLH
Sbjct: 373 PLH 375

>TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON}
           Anc_5.97 YGR232W
          Length = 227

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G  +++  + D+    D++ Q   G T LH+ V       +  + +   
Sbjct: 71  GWTPFHIACAVGDIDIVGELYDRMVKPDLNLQTNQGVTALHLAV------SKRHINVCEF 124

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL 143
           L+  GA  RIK+   QLPL          L++LL
Sbjct: 125 LLRHGASVRIKDKKLQLPLHRAAASGSPVLVELL 158

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
           (REAL)
          Length = 1085

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GNTALH     G  E+++ ++     ++I    + GDTPL       D      L 
Sbjct: 356 QDNAGNTALHEAALQGHIEIVELLIKNGADVNIKSIEMFGDTPL------IDASANGHLD 409

Query: 106 IARNLIEVGADPRIKN 121
           + + L++ GADP I+N
Sbjct: 410 VVKYLLKNGADPTIRN 425

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHG-L 104
           +D  G T L + C  G ++V+  ++ +EG  DI+ Q+  G+T LH       E    G +
Sbjct: 322 RDSGGRTRLQIACDKGKFDVVKNMI-EEGSYDINDQDNAGNTALH-------EAALQGHI 373

Query: 105 FIARNLIEVGADPRIKNI 122
            I   LI+ GAD  IK+I
Sbjct: 374 EIVELLIKNGADVNIKSI 391

>NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319
          Length = 230

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 45 SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          SKDP G T +H    YG  ++L  +     G D++ ++ DGDTPLH
Sbjct: 44 SKDPNGYTPIHAAAAYGHKDLLRLLCSTYNG-DVNVRDSDGDTPLH 88

>TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.319
          YCR051W
          Length = 213

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 45 SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
          SKD  G T +H    YG  ++L  + ++  G DI+ ++ DGDTPLH
Sbjct: 29 SKDENGYTPVHAAAAYGHNDLLRKLCNEYNG-DINIRDFDGDTPLH 73

>KNAG0E01880 Chr5 (389045..392023) [2979 bp, 992 aa] {ON} Anc_2.257
           YIL112W
          Length = 992

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 29/130 (22%)

Query: 14  DASRRNNSDLLSSIF---ETLGHDAEKIAELINTSKDPL-----------------GNTA 53
           D SR +  +L+SS F   E      ++ A+ + T++ P                  G T 
Sbjct: 191 DFSRNSTRNLVSSSFLNEEFPSSPVKQPAKKLRTARRPKEPVNPKTNKKSVYRDSGGRTK 250

Query: 54  LHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHG-LFIARNLIE 112
           L + C  G    + ++L  EG +DID Q+  G+TPLH       E   +G L I + L+E
Sbjct: 251 LQIACDKGKIAQVRSLL-AEGDVDIDDQDNAGNTPLH-------EAALNGHLDIVKLLVE 302

Query: 113 VGADPRIKNI 122
            GA+  I++ 
Sbjct: 303 TGANVNIQSF 312

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GNT LH     G  +++  +++    ++I    + GDTPL       D      L 
Sbjct: 277 QDNAGNTPLHEAALNGHLDIVKLLVETGANVNIQSFAMFGDTPL------IDASANGHLD 330

Query: 106 IARNLIEVGADPRIKN 121
           + + L+  G+DP I N
Sbjct: 331 VVQYLVAHGSDPTITN 346

>KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {ON}
           similar to uniprot|P25631 Saccharomyces cerevisiae
           YCR051W Hypothetical ORF
          Length = 208

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 11/77 (14%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           KD  G T +H    YG  ++L  ++ +  G D++ ++ D DTPLH    +C++       
Sbjct: 28  KDENGYTPIHAAAAYGHIDLLKKLVQEHNG-DVNIKDSDNDTPLH----HCEDAT----- 77

Query: 106 IARNLIE-VGADPRIKN 121
            AR+LIE +GAD  + N
Sbjct: 78  TARSLIEQLGADRELLN 94

>Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051W -
           Hypothetical ORF [contig 15] FULL
          Length = 202

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 9/104 (8%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGL 104
           SKDP G T +H    Y   ++L  +       +I+ ++ DGDTPLH    +C++     +
Sbjct: 27  SKDPNGYTPIHAAASYAHIDLLKKLCSDPYNGNINVKDNDGDTPLH----HCEDATTARV 82

Query: 105 FIARNLIEVGADPRIKNINNQLPLDLVHGDDKD-ELIDLLQGAA 147
                L E+G D  + N   +  L +   D ++ ELI  L+  +
Sbjct: 83  I----LEELGGDATLTNNEGKTALAVCEEDAENAELITYLRTVS 122

>KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 230

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 42  INTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPE 101
           ++T  D  G + +H+    GS  +L+ +L+     ++D Q  +G T LH+    C ++  
Sbjct: 65  LDTILDESGWSPVHIASSIGSVTILEKLLNHTVEPNLDLQANNGITALHLA---CSKKH- 120

Query: 102 HGLFIARNLIEVGADPRIKNINNQLPL 128
             L + + L+E GA  RIK+   QLPL
Sbjct: 121 --LNVVQLLVERGASVRIKDGLGQLPL 145

>TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {ON}
           Anc_2.639 YMR068W
          Length = 726

 Score = 37.0 bits (84), Expect = 0.018,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 11/97 (11%)

Query: 36  EKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           +   + IN   D  G T  H+ C +  ++ L  ++    G D+   N +GDTPLHV + Y
Sbjct: 96  QHFPQFINYKGDR-GQTPTHIACMHDYYQCLSLLVGV--GADLSIVNDEGDTPLHVCLEY 152

Query: 96  CDEEPEHGLFIARNLIEVG--ADPRIKNINNQLPLDL 130
                   +   + LI+ G   D  I+N NN  P D+
Sbjct: 153 ------GSVNCMKMLIQEGNMTDDTIRNRNNWRPSDV 183

>CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly
           similar to uniprot|P46683 Saccharomyces cerevisiae
           YPL239w YAR1 ankyrin repeat-containing protein
          Length = 193

 Score = 35.4 bits (80), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 32/133 (24%)

Query: 12  LLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILD 71
           +LDA R  + + L  IF TL H  + +A  +++     G+TALH+    G  EV+  I++
Sbjct: 17  ILDA-RAGDLESLQEIFTTLIH-PKLLATCVSSDN---GSTALHMAAANGHLEVVKYIME 71

Query: 72  QEG--------GIDIDPQNVDGDTPLHV--------TVRY----CDEEPEHGLFIARNLI 111
           Q          G  ++ QN  G+T LH          V+Y    CD +P    F+     
Sbjct: 72  QVKQSADAGAVGRYVNLQNKTGNTALHWATLNGKLDVVQYLCDECDADP----FVKN--- 124

Query: 112 EVGADPRIKNINN 124
           E G DP  +  NN
Sbjct: 125 EFGHDPIFEAENN 137

>Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]
           {ON} complement(122765..126532) [3768 nt, 1256 aa]
          Length = 1255

 Score = 35.8 bits (81), Expect = 0.038,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 14/88 (15%)

Query: 11  QLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTIL 70
           +LLD+ R +N + L  + +T  +D +K       SKD L N  LH   +  + ++++ I+
Sbjct: 22  KLLDSLRGSNFEELKKLLDTDFNDFDK------DSKD-LKNLVLHYAVQVANLDLIEQIV 74

Query: 71  DQEGG-------IDIDPQNVDGDTPLHV 91
               G        DI+ Q+ DG+TPLH+
Sbjct: 75  SSRNGEGSSKIITDINLQDKDGNTPLHL 102

>Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON}
           (137219..137911) [693 nt, 231 aa]
          Length = 230

 Score = 35.0 bits (79), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 8/108 (7%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  G+  ++  + +++   D+      G T LH+ V     +      + + 
Sbjct: 75  GWTPFHIACSVGNLNIVKMLYERDVAPDLGLPTAQGVTALHLAVSKKHND------VVKF 128

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL--QGAALAADNYDG 155
           L++ GA  R+K+   QLPL          L++LL  + + + A ++ G
Sbjct: 129 LLDNGASVRVKDKKLQLPLHRAVSVGSMALVELLCDKNSPVNAKDFQG 176

>Kwal_27.12750 s27 (1360301..1361002) [702 bp, 233 aa] {ON} YGR232W
           (NAS6) -  [contig 260] FULL
          Length = 233

 Score = 34.7 bits (78), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 6/94 (6%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G + LH+    G+  ++ ++L      D+D     G T LH+    C ++    L +A  
Sbjct: 76  GWSPLHIASSVGNLNIVKSLLSLSIKPDLDLATSQGVTALHLA---CSKQ---HLPVASL 129

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL 143
           LIE GA  R K+  NQL L          L+ LL
Sbjct: 130 LIEEGASVRKKDTRNQLALHRAASVGNIPLVKLL 163

>KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {ON}
           Anc_2.639 YMR068W
          Length = 411

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 9/87 (10%)

Query: 11  QLLDASRRNNSDLLSSIFETLGHDAEKIAELINTS------KDPLGNTALHLCCKYGSWE 64
           + +DA   N S   + I     HD  + A L+ +       +D  G T LH+C +YGS E
Sbjct: 100 RFIDAKGENGS---APIHVACMHDYFRCASLLISVGADLSLQDGQGETPLHICLEYGSTE 156

Query: 65  VLDTILDQEGGIDIDPQNVDGDTPLHV 91
            L  +L +   +D++  N     P+ V
Sbjct: 157 CLKLLLQERPKVDVNAVNFLEWKPVQV 183

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G+  +H+ C +  +     ++    G D+  Q+  G+TPLH+ + Y   E    L   R 
Sbjct: 109 GSAPIHVACMHDYFRCASLLISV--GADLSLQDGQGETPLHICLEYGSTECLKLLLQERP 166

Query: 110 LIEVGA 115
            ++V A
Sbjct: 167 KVDVNA 172

>CAGL0F06831g Chr6 (668173..671451) [3279 bp, 1092 aa] {ON} similar
           to uniprot|P40578 Saccharomyces cerevisiae YIR033w MGA2
           or uniprot|P35210 Saccharomyces cerevisiae YKL020c SPT23
          Length = 1092

 Score = 35.0 bits (79), Expect = 0.069,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 13/99 (13%)

Query: 37  KIAELINTSK-----DPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           K+ + +NT+      D LG T LHL    G ++++ T++ +  G  ID ++    TPLH 
Sbjct: 713 KVVKNLNTTSNLSMCDNLGRTLLHLASLKGYFKLVSTLIKK--GARIDDKDSFDFTPLHF 770

Query: 92  TVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL 130
                D +      I R L++ GAD   K  +  LPL+L
Sbjct: 771 ACVSGDVK------IIRILLDCGADKNRKTKHGLLPLEL 803

>Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 aa]
           {ON} YMR068W (REAL)
          Length = 416

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 23  LLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQN 82
           L+      LGHD     ELI T K   GNT +HL    G  + L  +L Q     I+ + 
Sbjct: 54  LICVYLIQLGHDKH---ELIKTFK---GNTCVHLALMKGHEQTLHLLLQQFPQF-INHRG 106

Query: 83  VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL 130
            +G  P+H+    C +     L +   LI VGAD  + + N   PL +
Sbjct: 107 ENGRAPIHIA---CMKNYYQCLSL---LIGVGADLWVMDTNGDTPLHV 148

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           G   +H+ C    ++ L  ++    G D+   + +GDTPLHV + Y
Sbjct: 109 GRAPIHIACMKNYYQCLSLLIGV--GADLWVMDTNGDTPLHVCLEY 152

>TPHA0A05100 Chr1 (1148395..1149081) [687 bp, 228 aa] {ON} Anc_5.97
           YGR232W
          Length = 228

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T  H+ C  GS   +  + + +   ++D   + G + LH+ V       +  L I   
Sbjct: 71  GWTPFHIACSVGSLNTVKKLYEGDLKPNLDLLTLQGVSALHLAVS------KKHLPIVEF 124

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL--QGAALAADNYDG 155
           L+  GA  R+K+   QLP+          ++D+L  + + + A ++ G
Sbjct: 125 LLNKGASVRVKDKKLQLPIHRAAAIGSMAMVDILCQKNSPVNAKDFQG 172

>KLTH0C01650g Chr3 complement(146654..147352) [699 bp, 232 aa] {ON}
           similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 232

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 6/94 (6%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G + LH+    G+ ++   +L      D D     G T LH+    C ++    L IAR 
Sbjct: 74  GWSPLHIASSVGNLDIFTELLHHAIKPDADLGTSQGVTALHLA---CSKQ---HLAIARL 127

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL 143
           L++ GA  R K++  QL L          L+ LL
Sbjct: 128 LVKEGASVRKKDVRGQLALHRAASVGSIPLVKLL 161

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 34.7 bits (78), Expect = 0.11,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 42  INTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPE 101
           I+ + D  G TAL+L  K  ++E+   +L Q G     P+ +   TPL +         E
Sbjct: 532 IDVTNDESGETALYLASKLNNFEIAKVLL-QNGASTEVPEKLFSWTPLFIAA------VE 584

Query: 102 HGLFIARNLIEVGADPRIKNINNQLPLD--LVHGDDKDELIDLLQGAALAADNYD 154
           + L IA+ LIE GA   + + +   PL+  ++HG+   EL D L+      D YD
Sbjct: 585 NNLEIAKLLIEYGAHVYVFDESGWTPLEQAVLHGN--LELADYLK-----LDGYD 632

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GN+ALH     G   ++  ++     ++I    +  DTPL       D      L 
Sbjct: 391 QDNAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTPL------VDASANGHLD 444

Query: 106 IARNLIEVGADPRIKN 121
           I R L+  GADP I N
Sbjct: 445 IVRYLLRHGADPTIPN 460

>Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068W
           (REAL)
          Length = 422

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 23  LLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQN 82
           L+      LGHD     ELI T K   GNT +HL    G  + L  +L Q     I+ + 
Sbjct: 54  LICVYLIQLGHDKH---ELIKTFK---GNTCVHLALMRGHEQTLHLLLQQFPPF-INHRG 106

Query: 83  VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL 130
            +G  P+H+    C  +    L +   LI VGAD  + + N   PL +
Sbjct: 107 ENGRAPIHIA---CMNDYYQCLSL---LIGVGADLWVMDTNGDTPLHV 148

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           G   +H+ C    ++ L  ++    G D+   + +GDTPLHV + Y
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGV--GADLWVMDTNGDTPLHVCLEY 152

>YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}
           AVO2Component of a complex containing the Tor2p kinase
           and other proteins, which may have a role in regulation
           of cell growth
          Length = 426

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 23  LLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQN 82
           L+      LGHD     ELI T K   GNT +HL    G  + L  +L Q     I+ + 
Sbjct: 54  LICVYLIQLGHDKH---ELIKTFK---GNTCVHLALMKGHEQTLHLLLQQFPRF-INHRG 106

Query: 83  VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL 130
            +G  P+H+    C  +    L +   LI VGAD  + + N   PL +
Sbjct: 107 ENGRAPIHIA---CMNDYYQCLSL---LIGVGADLWVMDTNGDTPLHV 148

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           G   +H+ C    ++ L  ++    G D+   + +GDTPLHV + Y
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGV--GADLWVMDTNGDTPLHVCLEY 152

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDID 79
           G+T LH+C +YGS   +  +L+ EG + +D
Sbjct: 142 GDTPLHVCLEYGSISCMKMLLN-EGEVSLD 170

>ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON}
           similar to uniprot|Q04749 Saccharomyces cerevisiae
           YMR068W AVO2 Component of a complex containing the Tor2p
           kinase and other proteins which may have a role in
           regulation of cell growth
          Length = 408

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 44  TSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           T KD  G+T LH+C +YGS   +  ++ Q G +D   +N  G  P  V   Y
Sbjct: 136 TIKDDYGDTPLHVCLEYGSINCMKMLILQGGIVDDHVKNKKGWKPSDVASTY 187

>NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa]
           {ON} Anc_2.639
          Length = 408

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 10/84 (11%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T +H  C Y  ++ L  ++     + I  ++ DG+TPLH+ + Y        +   + 
Sbjct: 109 GRTPVHFACMYDHFQCLSLLIGVGANLTI--KDEDGETPLHICLEYSS------IHCMKI 160

Query: 110 LIEVGA--DPRIKNINNQLPLDLV 131
           L+  G      IK+ NN  P+D++
Sbjct: 161 LLSEGQLDSANIKDGNNFKPIDVI 184

>SAKL0G19646g Chr7 (1690766..1694122) [3357 bp, 1118 aa] {ON}
           similar to uniprot|P40578 MGA2 and to YKL020C
           uniprot|P35210 SPT23, Saccharomyces cerevisiae ER
           membrane proteins involved in regulation of OLE1
           transcription
          Length = 1118

 Score = 34.3 bits (77), Expect = 0.15,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 14/109 (12%)

Query: 37  KIAELINTSKD-----PLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           ++ +L+N S +       G T LHL C  G +++  T++ +  G  +D ++  G TPLH 
Sbjct: 741 RVVKLLNPSSNLSMCTEEGQTMLHLACLKGYFQLASTLVKK--GTRVDAKDSFGFTPLHF 798

Query: 92  TVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL-VHGDDKDEL 139
                D        I R L +  AD   K  N   P DL V   D D++
Sbjct: 799 ACVNGDPR------IIRLLAQCKADVTTKATNGVAPRDLFVTNHDTDDV 841

>NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]
           {ON} Anc_2.257
          Length = 1054

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GN+ALH     G   ++  ++D    ++I    +  DTPL       D      L 
Sbjct: 334 QDNAGNSALHEAALNGHISIVKLLIDNGANVNIQSYEMFQDTPL------VDASANGHLD 387

Query: 106 IARNLIEVGADPRIKN 121
           + + L+E GADP I N
Sbjct: 388 VVQLLLENGADPTITN 403

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 43  NTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           N  +D  G   L + C  G ++V   ++++E G D++ Q+  G++ LH
Sbjct: 297 NVYRDSGGRNRLQIACDKGKYDVAKRLIEEE-GYDVNDQDNAGNSALH 343

>KLTH0C00638g Chr3 complement(63995..67252) [3258 bp, 1085 aa] {ON}
           similar to uniprot|P40578 Saccharomyces cerevisiae
           YIR033W MGA2 or to uniprot|P35210 Saccharomyces
           cerevisiae YKL020C SPT23, ER membrane proteins involved
           in regulation of OLE1 transcription
          Length = 1085

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 13/100 (13%)

Query: 37  KIAELINTSK-----DPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           K+ +L+N+S      D  G T LHL C  G + +   ++ +  G  +D ++  G  PLH 
Sbjct: 706 KVIKLLNSSSNLSMCDEEGQTMLHLACLKGYYHLASALVRK--GARVDAKDSFGFLPLHF 763

Query: 92  TVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
                D        I R L++  A    + IN   P  L 
Sbjct: 764 ACLNGDAR------IIRLLVQCKATVHAETINGSSPRALF 797

>Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068W
           (REAL)
          Length = 430

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 31  LGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           LGHD     ELI T K   GNT +HL    G  + L  +L Q     I+ +  +G  P+H
Sbjct: 62  LGHDKH---ELIKTFK---GNTCVHLALMKGHEQTLHLLLQQFPRF-INHRGENGRAPIH 114

Query: 91  VTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDL 130
           +    C  +    L +   LI VGAD  + + N   PL +
Sbjct: 115 IA---CMNDYYQCLSL---LIGVGADLWVVDANGDTPLHV 148

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           G   +H+ C    ++ L  ++    G D+   + +GDTPLHV + Y
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGV--GADLWVVDANGDTPLHVCLEY 152

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDID 79
           G+T LH+C +YGS   +  +L+ EG + +D
Sbjct: 142 GDTPLHVCLEYGSISCMKMLLN-EGEVSLD 170

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa]
          {ON} Anc_6.265 YPL239W
          Length = 200

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 43/87 (49%), Gaps = 13/87 (14%)

Query: 12 LLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILD 71
          +LDA R  + + L  IF TL H   K+  LI  S+    +TALH+ C  G  +V+  +L 
Sbjct: 17 ILDA-RAGDLESLKEIFTTLIHP--KL--LITCSESETKSTALHMACANGHTDVVKYLLT 71

Query: 72 --QEGGID------IDPQNVDGDTPLH 90
            +E          ++ QN  G+T LH
Sbjct: 72 LVKENATSEELKDYVNKQNETGNTALH 98

>TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1078

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G + L + C  G +E++  +L+ EG ID++ Q+  G++ LH
Sbjct: 324 RDAGGRSKLQIACDKGKFEIVKRLLE-EGEIDVNDQDNAGNSSLH 367

>ADL244W Chr4 (273377..276646) [3270 bp, 1089 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL112W
          Length = 1089

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 55/138 (39%), Gaps = 17/138 (12%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GN+ LH     G  EV+  ++     ++I    +  DTPL       D      L 
Sbjct: 370 QDNAGNSPLHEAALNGHLEVVKLLIRHGANVNIQSYEMFKDTPL------IDASANGHLD 423

Query: 106 IARNLIEVGADPRIKNINNQLPLDLVHGDDKD---------ELIDLLQGAALAADNYDGD 156
           I R L++ GADP I N      ++ +  D            E+  LL+ +A      DGD
Sbjct: 424 ILRELLQNGADPTIVNAKGLTAIESIEDDSDLDEEEVQIVREIKALLRKSARKHKKEDGD 483

Query: 157 EGDEPELIDDDDG--EED 172
               P+     +G  EED
Sbjct: 484 VKSLPQRSKAKEGHSEED 501

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G +++   ++++  G D++ Q+  G++PLH
Sbjct: 337 RDAGGRTRLQVACDKGKYDLARKLIEE--GYDVNDQDNAGNSPLH 379

>Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W
           (REAL)
          Length = 1165

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 8/55 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLVH 132
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV 
Sbjct: 191 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDRKGKLPIDLVR 237

>Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W
           (REAL)
          Length = 1159

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV
Sbjct: 191 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>TBLA0B07400 Chr2 complement(1762348..1763034) [687 bp, 228 aa] {ON}
           Anc_5.97 YGR232W
          Length = 228

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTI--LDQEGG--IDIDPQNVDGDTPLHVTVRYCDEEPE 101
           KD  G T  H+C   GS E+L  +   D E G  +D D Q   G T LH+ +    +   
Sbjct: 72  KDEGGWTPYHICSSIGSVEILKKLEAFDVENGHKVDWDIQTKQGMTCLHLAISKKHDA-- 129

Query: 102 HGLFIARNLIEVGADPRIKNINNQLPL 128
               +   L+  G   RI +   +LPL
Sbjct: 130 ----VVTYLLRNGESVRIPDKTGKLPL 152

>KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 960

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G +++   +++ E G D++ Q+  G+TPLH
Sbjct: 255 RDAGGRTKLQIACDKGKYDLAKKLIE-EDGYDVNDQDNAGNTPLH 298

>Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W
           (REAL)
          Length = 1179

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV
Sbjct: 191 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some
           similarities with uniprot|Q12451 Saccharomyces
           cerevisiae YDL019C OSH2 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 1548

 Score = 32.7 bits (73), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV
Sbjct: 224 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFNRDRQGRLPVDLV 269

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score = 32.3 bits (72), Expect = 0.53,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 21  SDLLSSIFETLGHDAEKIAELINTS--KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDI 78
           S++LS  FE +     +  E  + +  +DP+GN+ LH+  K G    + +IL Q   I++
Sbjct: 592 SEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHI-MKGG----IQSILSQP-NINV 645

Query: 79  DPQNVDGDTPLHVTVRY 95
           +  N+ G TPL +  +Y
Sbjct: 646 NKSNIKGMTPLMLYAKY 662

>Ecym_2082 Chr2 (140585..141286) [702 bp, 233 aa] {ON} similar to
           Ashbya gossypii ADL142C
          Length = 233

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 54  LHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEV 113
           +H+    G +E+   +L+ +    +D     G TPLH+    C ++ +    I  +LIE 
Sbjct: 80  MHVASAVGDYEIFVMLLNHDIKPLLDESTSQGTTPLHLA---CSKKHQK---IVSSLIER 133

Query: 114 GADPRIKNINNQLPL 128
           GA  R K+   ++ L
Sbjct: 134 GASVRTKDKYQRMAL 148

>KAFR0A00170 Chr1 complement(27115..30279) [3165 bp, 1054 aa] {ON}
           Anc_2.662 YIR033W
          Length = 1054

 Score = 32.3 bits (72), Expect = 0.60,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 47  DPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFI 106
           D +G T LHL    G +++  T++  + G  ID ++  G TPLH        +      +
Sbjct: 688 DSVGRTLLHLASLKGYYDLTSTLI--QSGARIDDKDSFGFTPLHFACINGSYQ------V 739

Query: 107 ARNLIEVGADPRIKNINNQLPLDL 130
            R L+   ++P +K+ N+  P DL
Sbjct: 740 IRLLLNCQSNPNVKSSNHLSPKDL 763

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 32.3 bits (72), Expect = 0.63,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVD--GDTPLH-VTVRYCDEEPE 101
           S DP G TALH     G    ++ +L      D D + VD  G TPLH  TV+     P 
Sbjct: 187 SPDPTGKTALHWAAYQGDPNTVEALLK----FDADVRVVDTGGFTPLHWATVK---GHPH 239

Query: 102 HGLFIARNLIEVGADPRIKN 121
               + + LIE G+D  +KN
Sbjct: 240 ----VLKALIEHGSDVFLKN 255

>NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1312

 Score = 32.3 bits (72), Expect = 0.65,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 64  EVLDTILDQEGGIDIDPQNV----DGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           + L+TIL+    +D+   N      GD+ LH  VR      +  + +   L++ GADP  
Sbjct: 183 KTLETILNTPRNVDVLDINYFDQKSGDSLLHTFVR------KRNIEMCSWLLKHGADPHR 236

Query: 120 KNINNQLPLDLV 131
           KN + + PLDL+
Sbjct: 237 KNFDGKTPLDLL 248

>NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {ON}
           Anc_3.175
          Length = 1495

 Score = 32.3 bits (72), Expect = 0.67,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 14/79 (17%)

Query: 66  LDTILDQEGG---IDI---DPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119
           L+TIL+ +     +DI   DP+   GDT LH  V+  D      + + R L+E GADP  
Sbjct: 347 LETILNNDRNAQLLDINGMDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFK 398

Query: 120 KNINNQLPLDLVHGDDKDE 138
           +++  +LP++L+   +++E
Sbjct: 399 RDVKGKLPINLIPKINENE 417

>NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1.60
          Length = 751

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDK 136
           ++ Q+V+GDT L++  R  +      + I   L+E GADP I N +   PLD   G  K
Sbjct: 403 LNAQDVNGDTCLNIAARLGN------VGIVDALLEYGADPYIANKSGLRPLDFGAGTSK 455

>TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON}
           Anc_2.639 YMR068W
          Length = 375

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           G   +H+ C +  ++ L  ++     +DI   + DGDTPLHV + Y
Sbjct: 109 GRAPIHIACMHDHFQCLSLLMGVGAKLDIT--DDDGDTPLHVCLEY 152

>Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182W
           (SWI6) - transcription factor [contig 119] FULL
          Length = 664

 Score = 32.0 bits (71), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 6/61 (9%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKD 137
           ++ ++++GDT L++  R  +      + I   L++ GADPRI N +   P+D   G +K 
Sbjct: 351 LNARDINGDTCLNIASRLGN------VSIVEALLDYGADPRISNNSGLRPMDFGAGANKL 404

Query: 138 E 138
           E
Sbjct: 405 E 405

>KNAG0M02410 Chr13 complement(443330..446782) [3453 bp, 1150 aa]
           {ON} Anc_2.662 YIR033W
          Length = 1150

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 47  DPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF- 105
           D LG T LHL    G + +  T++    G++I  ++  G TPLH            G F 
Sbjct: 744 DSLGRTLLHLASLKGYFNLASTLV--RSGVNIALKDSFGFTPLHFAAI-------SGSFK 794

Query: 106 IARNLIEVGADPRIKNINNQLPLDLVHGDDK------DELIDLL 143
           I R L+   A   +K  N   P +L   + K      D+++DL 
Sbjct: 795 IIRLLLSCKAGVSLKACNGMTPKELYINNHKLQNNIQDDVLDLF 838

>Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON}
           (82489..86103) [3615 nt, 1205 aa]
          Length = 1204

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G ++ +  +++ EG ID++ Q+  G++ LH
Sbjct: 388 RDSGGRTKLQIACDKGKYDTVKKLIE-EGEIDVNDQDNAGNSSLH 431

>TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1259

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  G T L + C  G +++   +L  E   D++ Q+  G+T LH       E   +G  
Sbjct: 508 RDSAGRTKLQIACDKGKYDLAKKLL--EENYDVNYQDNAGNTALH-------EAALNGYL 558

Query: 106 -IARNLIEVGAD 116
            I + LIE GAD
Sbjct: 559 DIVKLLIEYGAD 570

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GNTALH     G  +++  +++    I++    +  DTPL       D      L 
Sbjct: 541 QDNAGNTALHEAALNGYLDIVKLLIEYGADINLQSYELFKDTPL------IDASSNGHLD 594

Query: 106 IARNLIEVGADPRIKN 121
           + + L+  GADP I N
Sbjct: 595 VVKFLLNSGADPLIAN 610

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 61  GSWEVLDTILDQEGGID--IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPR 118
           G  +++ T +D +  I   ++ ++++GDT L++  R  +      + I   L++ GADPR
Sbjct: 331 GDADIIMTTVDLKWFISHVLNARDINGDTCLNIASRLGN------VSIVEALLDYGADPR 384

Query: 119 IKNINNQLPLDLVHGDDKDE 138
           I N +   P+D   G  K E
Sbjct: 385 ISNNSGLRPVDFGAGASKIE 404

>Ecym_3063 Chr3 complement(120315..122144) [1830 bp, 609 aa] {ON}
           similar to Ashbya gossypii AAR170W
          Length = 609

 Score = 32.0 bits (71), Expect = 0.84,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 2   SSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLG-NTALHLCCKY 60
           +++G      L+D   ++  + ++  +   G  ++   EL++TS+  LG  T +HL C  
Sbjct: 35  TAQGVQNLYDLMDKMYQSQPEFINITWNAGGRKSQLTTELVSTSQSVLGLETCMHLTCTN 94

Query: 61  GSWEVLDTILDQ--EGGIDIDPQNV---DGDTPL 89
              E++D  L Q  E G     QN+    GD P+
Sbjct: 95  MPCELIDEALKQAYESGC----QNILALRGDPPI 124

>NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {ON}
           Anc_3.175
          Length = 1208

 Score = 32.0 bits (71), Expect = 0.87,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV
Sbjct: 200 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDSKGKLPIDLV 245

>YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Protein
           similar to mammalian oxysterol-binding protein; contains
           ankyrin repeats; localizes to the Golgi and the
           nucleus-vacuole junction
          Length = 1188

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP++LV
Sbjct: 192 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDRKGKLPIELV 237

>NDAI0G04540 Chr7 (1085981..1087351) [1371 bp, 456 aa] {ON}
           Anc_2.639 YMR068W
          Length = 456

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G T +H+ C +  ++ L  ++    G D+   + +G+TPLH+ + Y   +    L    N
Sbjct: 109 GWTPVHIACMHDHYQCLSLLIGV--GADVLLTDDNGETPLHICLEYGSVQCMRLLVKETN 166

Query: 110 LIEVGADPRIKNINNQLPLDLV 131
           LI    +  +K++NN  P D+V
Sbjct: 167 LI----NDNVKDMNNFKPSDVV 184

>TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1007

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 16/130 (12%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVD--GDTPLHVTVRYCDEEPEHG 103
           +D  GNTALH     G  +++  ++  E G D++ Q+ +   DTPL       D      
Sbjct: 349 QDNAGNTALHEAALNGHLDIVKLLI--ENGADVNMQSFEMFKDTPL------IDASANGH 400

Query: 104 LFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDE-----LIDLLQGAALAADNYDGDEG 158
           L + + L+  GADP I N       + +   D DE     + ++ +    AA N+  DE 
Sbjct: 401 LDVVKYLLSHGADPTICNAKGLTAFESIEDSDLDEQERDIVHEIKRNLRSAARNW-KDEK 459

Query: 159 DEPELIDDDD 168
             P +++  D
Sbjct: 460 AVPGVLNKKD 469

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHG-L 104
           +D  G T L + C  G++E    ++++E G D++ Q+  G+T LH       E   +G L
Sbjct: 315 RDAGGRTRLQISCDKGNYEQAKKLIEEE-GYDVNDQDNAGNTALH-------EAALNGHL 366

Query: 105 FIARNLIEVGAD 116
            I + LIE GAD
Sbjct: 367 DIVKLLIENGAD 378

>TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3.175
           YAR042W
          Length = 1268

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LP+DLV
Sbjct: 220 MDPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDRQGKLPIDLV 265

>Kwal_14.889 s14 complement(96498..99782) [3285 bp, 1094 aa] {ON}
           YKL020C (SPT23) - suppressor protein [contig 245] FULL
          Length = 1094

 Score = 31.6 bits (70), Expect = 1.1,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 50/123 (40%), Gaps = 16/123 (13%)

Query: 37  KIAELINTSK-----DPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           K+ +L+N+S      D  G T LHL C  G + ++  ++ +  G  +D ++  G  PLH 
Sbjct: 716 KVIKLLNSSSNLSMCDEDGQTMLHLACLKGYYNLVSALVRK--GARVDAKDSFGFLPLHF 773

Query: 92  TVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV---HGDDKDELIDLLQGAAL 148
                D        I   L++  A    + IN   P DL    H  D +   D L     
Sbjct: 774 ACLNGDAR------IISLLVQCKATIHAETINGSTPRDLFVANHDTDDERYEDYLNEVFD 827

Query: 149 AAD 151
           A D
Sbjct: 828 ALD 830

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 21  SDLLSSIFETLGHDAEKIAELINTS--KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDI 78
           + ++++ F T     E   E  N S  KD  GNT LH+         ++ +L+QE  ID+
Sbjct: 600 AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN-----IEILLEQEN-IDV 653

Query: 79  DPQNVDGDTPLHVTVRY 95
           +  N  G TPL V V+Y
Sbjct: 654 NEVNKKGLTPLMVYVKY 670

>SAKL0G15532g Chr7 (1336097..1336798) [702 bp, 233 aa] {ON} similar
           to uniprot|P50086 Saccharomyces cerevisiae YGR232W NAS6
           Regulatory non-ATPase subunit of the 26S proteasome
           homolog of the human oncoprotein gankyrin which
           interacts with the retinoblastoma tumor suppressor (Rb)
           and cyclin-dependent kinase 4/6
          Length = 233

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 5/94 (5%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G + LH+    G+  ++ T++D     D++     G T LH+       +    L I + 
Sbjct: 75  GWSPLHVASSVGNLAIVKTLMDSTNMPDVNLVTSSGTTALHLACSKMHYKIAEYLVIVKR 134

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLL 143
                A  RIK+ + QL L          L+ LL
Sbjct: 135 -----ASTRIKDRHYQLALHRAASVGSVPLVKLL 163

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
           aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 21  SDLLSSIFETLGHDAEKIAELINTS--KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDI 78
           + ++++ F T     E   E  N S  KD  GNT LH+         ++ +L+QE  ID+
Sbjct: 600 AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN-----IEILLEQEN-IDV 653

Query: 79  DPQNVDGDTPLHVTVRY 95
           +  N  G TPL V V+Y
Sbjct: 654 NEVNKKGLTPLMVYVKY 670

>NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1141

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GN+ALH     G  +++  +++ +  ++I    +  DTPL       D      L 
Sbjct: 385 QDNAGNSALHEAALNGHLDIVKLLVEHDANVNIQSYEMFQDTPL------FDASANGYLD 438

Query: 106 IARNLIEVGADPRIKN 121
           +   L+E GA+P + N
Sbjct: 439 VVEYLLEHGANPTLTN 454

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G +E    ++++E G D++ Q+  G++ LH
Sbjct: 351 RDSGGRTKLAIACDKGKFETAKRLIEEE-GYDVNDQDNAGNSALH 394

>KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa]
           {ON} Anc_3.175 YAR042W
          Length = 1228

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  V+  D      + + R L+E GADP  ++   +LPLDL+
Sbjct: 216 MDPKT--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDAKGKLPLDLL 261

>SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa]
           {ON} similar to uniprot|P40480 Saccharomyces cerevisiae
           YIL112W HOS4 Subunit of the Set3 complex which is a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity potential Cdc28p
           substrate
          Length = 1085

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GN+ LH     G  +++  +L+    I+I    +  DTPL       D      L 
Sbjct: 388 QDNAGNSPLHEAALNGHLDIVKLLLEHGADINIQSYEMFKDTPL------IDASANGHLE 441

Query: 106 IARNLIEVGADPRIKN 121
           + + L++ GADP I N
Sbjct: 442 VVKLLLDHGADPTIVN 457

 Score = 30.8 bits (68), Expect = 1.9,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHG-L 104
           +D  G T L + C  G +++   ++ +E G +++ Q+  G++PLH       E   +G L
Sbjct: 354 RDAGGRTKLQIACDKGKYDLAKMLIVEE-GYNVNDQDNAGNSPLH-------EAALNGHL 405

Query: 105 FIARNLIEVGADPRIKN 121
            I + L+E GAD  I++
Sbjct: 406 DIVKLLLEHGADINIQS 422

>KLLA0F26004g Chr6 complement(2411261..2412271) [1011 bp, 336 aa]
           {ON} some similarities with uniprot|Q04749 Saccharomyces
           cerevisiae YMR068W AVO2 Component of a complex
           containing the Tor2p kinase and other proteins
          Length = 336

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 49/111 (44%), Gaps = 4/111 (3%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G ++LH    YG + +   ++          +  DGDT +H+ +   DE+  H L   ++
Sbjct: 40  GWSSLHYAAFYGRYLICRHLIQLGHDATAMLKTYDGDTCIHLAITKGDEQTVHLLL--QH 97

Query: 110 LIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQ--GAALAADNYDGDEG 158
            +E G + R  +     P+ +    +    + LL   GA +  ++ +G+ G
Sbjct: 98  FLEEGLNLRSSSARRWAPIHIACRSNHSRCLALLLQCGADVTLEDEEGNTG 148

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 41/98 (41%), Gaps = 11/98 (11%)

Query: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60
           + S  A     +  A R N+S  L+ + +  G D         T +D  GNT LH+  +Y
Sbjct: 105 LRSSSARRWAPIHIACRSNHSRCLALLLQC-GADV--------TLEDEEGNTGLHVAMEY 155

Query: 61  GSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDE 98
           G+ + L  +L   G    D QN  G     V    CDE
Sbjct: 156 GAIQCLPILLQCGGATLADEQNQMGIVARQVG--NCDE 191

>Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON}
           YMR068W - Hypothetical ORF [contig 244] FULL
          Length = 416

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQE 73
           +D  GNTALH+C  YGS   +  ++ +E
Sbjct: 138 RDEFGNTALHICLIYGSENCMRMLVREE 165

>KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}
           Anc_2.639 YMR068W
          Length = 387

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGI 76
           G T LHLC +YGS+  L  +L  +  I
Sbjct: 143 GETPLHLCLEYGSYHCLRMLLTYDTSI 169

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML002W and
           YML003W; YML002W and YML003W represent one ORF in this
           genome
          Length = 1071

 Score = 30.8 bits (68), Expect = 1.9,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 16/111 (14%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +DPLGNT LH+  K G    L T      G +++  N  G TPL V  +Y   E      
Sbjct: 617 EDPLGNTLLHI-IKDGIQLALST-----PGANVNKCNTRGMTPLMVYAKYNRIE------ 664

Query: 106 IARNLIEVGADPRIKNINNQLPLDLVHGDD-KDELIDLLQGAALAADNYDG 155
              N+ E+  D R+     Q P  L   D  K+ +I  L G A+A ++  G
Sbjct: 665 ---NIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYG 712

>Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa]
           {ON} complement(274868..278014) [3147 nt, 1049 aa]
          Length = 1048

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 12  LLDASRRNNSD------LLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEV 65
           L++ S  N+ D       +  I + LG +   + ++    +D +GNT LHL     + ++
Sbjct: 619 LIELSVNNSKDPTVIHYYMDMIIKILGTEDYSLLKMCLNFQDSMGNTVLHLAALNMNIDI 678

Query: 66  LDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
            +T+L  + G   D  N + +TP  +  +Y
Sbjct: 679 YNTLL--QFGASADIANFNNETPSFILAKY 706

>ZYRO0D02332g Chr4 (180577..183222) [2646 bp, 881 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 881

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G+ E+   +++ E G D++ Q+  G+T LH
Sbjct: 276 RDAGGRTRLQIACDKGNLEIAKRLIE-EDGYDVNDQDNAGNTALH 319

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           +D  GNTALH     G  +++  +++    +++    +  DT L       D      L 
Sbjct: 310 QDNAGNTALHEAALNGHLDIVKLLVNHGADVNVQSYEMFKDTAL------IDASANGHLP 363

Query: 106 IARNLIEVGADPRIKN 121
           + + L+E GADP + N
Sbjct: 364 VVQFLLERGADPLVCN 379

>Ecym_3409 Chr3 complement(771477..772787) [1311 bp, 436 aa] {ON}
           similar to Ashbya gossypii ADR151W
          Length = 436

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEE 99
           G T  H+ C +   + L  ++    G D+   + +GDTPLH+ + Y   E
Sbjct: 109 GRTPAHIACLFDYHKCLSLLVS--AGTDLSLGDNNGDTPLHIAMMYGSVE 156

>ZYRO0F03850g Chr6 (322303..328734) [6432 bp, 2143 aa] {ON} similar to
            uniprot|P43583 Saccharomyces cerevisiae YFL007W BLM3
            Protein involved in assembly of proteasomal core
            particles in the nucleus required for normal resistance
            to bleomycin may be involved in protection against
            oxidative damage
          Length = 2143

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 17   RRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGN 51
            R   SD+LS I   LG D E++ +L+ +    LGN
Sbjct: 2008 RMRASDVLSDIVHNLGEDDERLKKLVQSFSSRLGN 2042

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 15/96 (15%)

Query: 34  DAEKIAELINTSKDPLGN--------TALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDG 85
           D   + E++N+ +  + N        T LH         V+D ++ +   ++I   ++  
Sbjct: 77  DLAAVKEIVNSGQVDINNDYDKTEQVTGLHWASINNRLGVVDFLVSRGADVNIKAGSLHA 136

Query: 86  DTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKN 121
             PLH   RY        ++I   L+E GADPR+ +
Sbjct: 137 -PPLHWAARY------GYVYIVHYLLEHGADPRVTD 165

>TBLA0E03570 Chr5 (892332..896438) [4107 bp, 1368 aa] {ON} Anc_2.201
           YNL088W
          Length = 1368

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 111 IEVGADP-----RIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDE 157
           IEV  +P      +KN  N +P++ +H  +K  + +L+ G  L + NYD DE
Sbjct: 83  IEVNINPLENLIEVKNDGNGIPIE-IHKKEKIYIPELIFGHLLTSSNYDDDE 133

>TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1257

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 10/53 (18%)

Query: 49  LGNTALHLCCKYGSWEVLDTILDQ--------EGGI--DIDPQNVDGDTPLHV 91
           +  + LH C + GS E++  ++++        E G+  DI+ Q+ +G+TPLH+
Sbjct: 54  IKKSLLHYCVQVGSLELIKDVVNEFYQSDNSNELGVKLDINQQDENGNTPLHL 106

>KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 1073

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G  +V   ++ +  G D++ Q+  G++PLH
Sbjct: 340 RDAGGRTRLQIACDKGKHDVAKRLIQE--GYDVNDQDNAGNSPLH 382

>TPHA0H00770 Chr8 (156886..160623) [3738 bp, 1245 aa] {ON} Anc_3.175
           YAR042W
          Length = 1245

 Score = 30.0 bits (66), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 79  DPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           DPQ   GDT LH  V+  D      + + R L+E GADP  ++I   LP++++
Sbjct: 208 DPQT--GDTVLHEFVKKRD------IIMCRWLLEHGADPFKRDITGVLPIEIL 252

>KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.60
           YLR182W
          Length = 748

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDK 136
           ++ Q+ +GDT L++  R  +      + I   L++ GADP I N +   P+D   G  K
Sbjct: 414 LNAQDYNGDTSLNIAARLGN------VAIVDALLDYGADPYIANKSGLRPVDFGAGTSK 466

>KLTH0C01232g Chr3 complement(112021..113283) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q04749 Saccharomyces cerevisiae
           YMR068W AVO2 Component of a complex containing the Tor2p
           kinase and other proteins which may have a role in
           regulation of cell growth
          Length = 420

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTP 88
           GNTALH C  YGS   +  ++ +    D++ Q +   TP
Sbjct: 142 GNTALHTCLMYGSESCMRMLVLEANMEDLESQKLGEWTP 180

>NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON}
           Anc_4.232
          Length = 803

 Score = 30.0 bits (66), Expect = 3.5,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 40  ELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV-TVRYCDE 98
           +L+  ++D  GNTALHL    G     +T++     + I  QN +G TP  +   +Y D 
Sbjct: 527 DLLMNAQDENGNTALHLAALNGDKRFFNTLISNGSLLTI--QNKEGRTPNEIMNNKYEDG 584

Query: 99  EPEHGLFIARN 109
           +  + + I R+
Sbjct: 585 DTSNAMMINRS 595

>ADR151W Chr4 (971058..972320) [1263 bp, 420 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR068W
          Length = 420

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 45  SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRY 95
           SKD  G T  H+ C       L   L    G D+   + DG+TPLH+ + Y
Sbjct: 104 SKDVGGRTPAHIACMQDYHTCLS--LLSSAGADLSLTDNDGNTPLHIAMMY 152

>CAGL0D01012g Chr4 (118878..121286) [2409 bp, 802 aa] {ON} similar
           to uniprot|P39678 Saccharomyces cerevisiae YDL056w MBP1
           transcription factor
          Length = 802

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 40  ELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           EL+  +KD  G+TALH+  +    E  D IL + G +     N DG TP  +
Sbjct: 492 ELLLNTKDANGDTALHIAARNNDREFFD-ILIKNGSLSTISNN-DGQTPTEI 541

>Smik_5.256 Chr5 complement(391451..394711) [3261 bp, 1086 aa] {ON}
           YER111C (REAL)
          Length = 1086

 Score = 29.6 bits (65), Expect = 4.1,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 24  LSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNV 83
           + SI  +LG     + ++    +D +GNT LHL     ++EV + ++      DI   N+
Sbjct: 610 MDSIILSLGQQDYNLLKICLNYQDNIGNTPLHLSALNLNFEVYNRLVYLGASTDI--LNL 667

Query: 84  DGDTPLHVTVRY 95
           D ++P  V  +Y
Sbjct: 668 DNESPASVMNKY 679

>NCAS0C01820 Chr3 complement(336290..339691) [3402 bp, 1133 aa] {ON}
           Anc_8.599
          Length = 1133

 Score = 29.6 bits (65), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHV 91
           G TALH+ CKY S E++  +L      ++  +N  G TPL +
Sbjct: 485 GETALHIACKYNSPEIVACLLAHGANSEV-VENKLGWTPLFI 525

>Kwal_23.4914 s23 (921368..924499) [3132 bp, 1043 aa] {ON} YIL112W -
           Hypothetical ORF [contig 6] FULL
          Length = 1043

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLH 90
           +D  G T L + C  G++EV   ++ +  G ++D Q+  G++ LH
Sbjct: 318 RDAGGRTKLQIACDKGNYEVAKRLIQE--GYNVDDQDNAGNSSLH 360

>KAFR0G03170 Chr7 complement(658032..660374) [2343 bp, 780 aa] {ON}
           Anc_4.232 YDL056W
          Length = 780

 Score = 29.6 bits (65), Expect = 4.7,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 7/81 (8%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKD 137
           ++ Q+ +GDT LH+  +  D+           LI+ GA   I N  NQ P ++++   + 
Sbjct: 488 LNSQDSNGDTALHIAAKNGDKS------FFNTLIKNGALSTIPNKENQTPDEIMNKQQQK 541

Query: 138 ELIDLLQGAALAADNYDGDEG 158
            L+ LL+G   +  N + ++ 
Sbjct: 542 HLL-LLEGQNNSVHNLNTNDA 561

>SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P17442 Saccharomyces cerevisiae
           YGR233C PHO81 Cyclin-dependent kinase (CDK) inhibitor
           regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK
           complexes in response to phosphate levels required for
           derepression of PHO5 transcriptionally regulated by
           Pho4p and Pho2p
          Length = 1090

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 36  EKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTV 93
           E + +L+N ++D  G T LH  C+ G  E++  ++  +    +D  + D  TPL + +
Sbjct: 382 ESLRKLLN-ARDIHGRTPLHYACELGKMELVQLLVQSQMLDSVDVLDNDSKTPLILAI 438

>KLLA0B08327g Chr2 (742205..746809) [4605 bp, 1534 aa] {ON} similar
           to uniprot|P22082 Saccharomyces cerevisiae YOR290C SNF2
           involved in the coordinate regulation of phospholipid
           synthesis transcriptional regulator
          Length = 1534

 Score = 29.3 bits (64), Expect = 6.1,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 83  VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPR--IKNINNQLPLDLVHGDDKDELI 140
           + G TPL   + Y D   +  L I  +L+ VG DPR  ++     + LDL      D  +
Sbjct: 376 IPGSTPLVPPISYTDLLNQQNLSITPSLLPVGLDPRSAMETYQTLIALDL------DTSL 429

Query: 141 DLLQGAALAADNYDGDEGDEPELIDD 166
           D      L +D+   D+G   ELI D
Sbjct: 430 DFCLQQLLESDSQVKDKG---ELIMD 452

>Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON}
           (48873..49493) [621 nt, 207 aa]
          Length = 206

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 34  DAEKIAELINTSKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDP 80
           D EK+ E +N + +  GNTALH     G  +V+  + D+    D DP
Sbjct: 78  DEEKLKEFVNATNET-GNTALHWAALNGKLDVVQLLCDE---YDADP 120

>CAGL0M00374g Chr13 (49330..53538) [4209 bp, 1402 aa] {ON} similar
           to uniprot|P47169 Saccharomyces cerevisiae YJR137c ECM17
          Length = 1402

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 124 NQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDEPELID 165
           N LP  L +       I+LLQG++ A++N + ++G EP L+D
Sbjct: 191 NLLPEILANVPSSITRINLLQGSSTASENQEYEDGFEPFLLD 232

>KLLA0E20791g Chr5 complement(1852522..1855323) [2802 bp, 933 aa]
           {ON} some similarities with uniprot|P25302 Saccharomyces
           cerevisiae YER111C SWI4 Involved in cell cycle dependent
           gene expression transcription factor
          Length = 933

 Score = 29.3 bits (64), Expect = 6.6,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 24  LSSIFETLGHDAEKIAELINTSKDPLGNTALHL 56
           + +I +TL  + EK+  +    +D LGNT LHL
Sbjct: 564 MDTILDTLAKEDEKLLRMSLNHQDTLGNTPLHL 596

>Kpol_1037.5 s1037 complement(8144..11782) [3639 bp, 1212 aa] {ON}
           complement(8144..11782) [3639 nt, 1213 aa]
          Length = 1212

 Score = 29.3 bits (64), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 79  DPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           DP+   GDT LH  V+  D      + + R L+E GADP  ++ N  LP++++
Sbjct: 210 DPET--GDTVLHEFVKKRD------VIMCRWLLEHGADPFKRDSNGVLPVEIL 254

>ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL020C (SPT23) and
           YIR033W (MGA2)
          Length = 1139

 Score = 29.3 bits (64), Expect = 6.8,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 18/107 (16%)

Query: 50  GNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEHGLFIARN 109
           G+T LHL C  G ++++  ++ +  G  ++  +  G TPLH      D        I R 
Sbjct: 751 GHTLLHLACLKGYYQLVSLLVKK--GAHVEVTDRFGFTPLHFACVNGDTR------ITRL 802

Query: 110 LIEVGADPRIKNINNQLPLDLV----HGDDK------DELIDLLQGA 146
           LI+  A      +N   P D+       DD+      DE++D+L  A
Sbjct: 803 LIQCKAQVSALALNGVTPSDVFTTNHRRDDRMYKLYFDEMMDVLDAA 849

>KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3.175
           YAR042W
          Length = 1120

 Score = 29.3 bits (64), Expect = 6.9,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 14/90 (15%)

Query: 52  TALHLCCKYGSWEVLDTILDQEGGID------IDPQNVDGDTPLHVTVRYCDEEPEHGLF 105
           TA  L      +E L++IL  +          IDP++  GDT LH  V+  D      + 
Sbjct: 157 TAFKLAFNNRDFEHLESILSNQRNAQLLDINGIDPKS--GDTVLHEFVKKRD------VI 208

Query: 106 IARNLIEVGADPRIKNINNQLPLDLVHGDD 135
           +   L+E G+DP  ++   +LP+D++  ++
Sbjct: 209 MCNWLLEHGSDPFKRDAKGRLPVDIIKNNN 238

>CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q04749 Saccharomyces cerevisiae YMR068w
          Length = 408

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 46  KDPLGNTALHLCCKYGSWEVLDTILDQ 72
           KD  GNT LHLC ++GS   +  ++++
Sbjct: 138 KDDKGNTPLHLCLEFGSTNCMKMLVNE 164

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score = 28.9 bits (63), Expect = 8.4,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 19  NNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTA---LHLCCKYGS 62
           N+   ++ IF+  G  A ++ ELI  S   LG+++   LHLC +Y S
Sbjct: 759 NSISEINMIFKLGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSS 805

>CAGL0C05049g Chr3 (475910..479455) [3546 bp, 1181 aa] {ON} similar
           to uniprot|Q12451 Saccharomyces cerevisiae YDL019c OSH2
           and similar to uniprot|P35845 Saccharomyces cerevisiae
           YAR042w OSH1
          Length = 1181

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 8/54 (14%)

Query: 78  IDPQNVDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRIKNINNQLPLDLV 131
           +DP+   GDT LH  ++  D E      + + L+E GADP  ++    LP DLV
Sbjct: 192 LDPET--GDTVLHEFIKKRDVE------MCKWLLEHGADPFKRDSTGVLPADLV 237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,509,319
Number of extensions: 1053403
Number of successful extensions: 6251
Number of sequences better than 10.0: 272
Number of HSP's gapped: 6109
Number of HSP's successfully gapped: 307
Length of query: 172
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 70
Effective length of database: 41,785,467
Effective search space: 2924982690
Effective search space used: 2924982690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)