Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H07733g3.566ON38538520610.0
NDAI0I032303.566ON3863818221e-107
Kpol_380.73.566ON3853798171e-106
YGL243W (TAD1)3.566ON4003917941e-102
Skud_7.243.566ON3913917931e-102
Smik_7.183.566ON3853887921e-102
KAFR0J028703.566ON3843887801e-100
SAKL0F00836g3.566ON3833887722e-99
Suva_7.183.566ON3853947679e-99
NCAS0E002703.566ON3883777592e-97
TBLA0E002303.566ON3943917576e-97
ZYRO0E09504g3.566ON3773857521e-96
TPHA0G036403.566ON3963877498e-96
TDEL0D063403.566ON4023947454e-95
KNAG0I002403.566ON3913867435e-95
Kwal_47.192633.566ON3833857419e-95
KLTH0G00748g3.566ON3853907164e-91
KLLA0A00759g3.566ON3803797131e-90
Ecym_25963.566ON3873796741e-84
AFR267W3.566ON3853856026e-74
Smik_14.2412.205ON83058751.1
Suva_14.2542.205ON83158741.2
KNAG0F006501.110ON130688713.6
TPHA0C035702.320ON745191694.9
CAGL0B04213g3.438ON90081696.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H07733g
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   798   0.0  
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   321   e-107
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   319   e-106
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   310   e-102
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   310   e-102
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   309   e-102
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   305   e-100
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   301   2e-99
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   300   9e-99
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   296   2e-97
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   296   6e-97
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   294   1e-96
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   293   8e-96
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   291   4e-95
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   290   5e-95
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   290   9e-95
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   280   4e-91
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   279   1e-90
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   264   1e-84
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   236   6e-74
Smik_14.241 Chr14 (447438..449930) [2493 bp, 830 aa] {ON} YNL085...    33   1.1  
Suva_14.254 Chr14 (465825..468320) [2496 bp, 831 aa] {ON} YNL085...    33   1.2  
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    32   3.6  
TPHA0C03570 Chr3 (771348..773585) [2238 bp, 745 aa] {ON} Anc_2.3...    31   4.9  
CAGL0B04213g Chr2 (412230..414932) [2703 bp, 900 aa] {ON} some s...    31   6.2  

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/385 (100%), Positives = 385/385 (100%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTIT 60
           MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTIT
Sbjct: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTIT 60

Query: 61  TGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNGFE 120
           TGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNGFE
Sbjct: 61  TGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNGFE 120

Query: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180
           WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF
Sbjct: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180

Query: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240
           NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS
Sbjct: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240

Query: 241 HQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQEE 300
           HQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQEE
Sbjct: 241 HQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQEE 300

Query: 301 QILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAE 360
           QILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAE
Sbjct: 301 QILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAE 360

Query: 361 LIRSIKSSLSSDGWLSTAEDDCQLP 385
           LIRSIKSSLSSDGWLSTAEDDCQLP
Sbjct: 361 LIRSIKSSLSSDGWLSTAEDDCQLP 385

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  321 bits (822), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 165/381 (43%), Positives = 254/381 (66%), Gaps = 9/381 (2%)

Query: 10  KITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPND 69
           +I +L+  +Y+ L +  +PV RSNG KE T+ A ++A +T T+   ++++ TGVK+ PN 
Sbjct: 10  RIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKALPNK 69

Query: 70  ELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNG--FEWNNELEL 127
           EL RS GK+LHD HAEI+ALRGFN ++L+ I +   G E++L+ ++ +   + + + L++
Sbjct: 70  ELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDSEYYSFKSNLKI 129

Query: 128 TLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYVR 187
            L+IS+LPCG++SM +L+E     E  L  +++D+ QYI  + KTILRGR NFNK+ YVR
Sbjct: 130 ALYISQLPCGDISMRMLKERDIAPE-ELAIKDEDSIQYINQDNKTILRGRLNFNKKGYVR 188

Query: 188 TKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEMN 247
           TKPGR+DS+ T SKSCSDKL ++  TS+LN LT  ++  P+Y+   ++P + +   E+++
Sbjct: 189 TKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMKEDID 248

Query: 248 LYFNRPMDLHSSARR--LYIHTSHYKFGDDL-SPETPPSSMSALKILFNDNDIQEEQILN 304
           L FN+  +     R    Y+ TS  +F D   + +  PS++ A+K+     +  E+ ILN
Sbjct: 249 LCFNKQFERCVGTRHEVCYLSTSK-EFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQTILN 307

Query: 305 GVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIRS 364
           GVKNG YTK +KPLRKNCE+ VSR+S W +F  +  ++  ++YL+FK+    ER +LI  
Sbjct: 308 GVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQ-HERRKLIDY 366

Query: 365 IKSSLSSDGWLSTAEDDCQLP 385
            +S +S DGW+ST EDDC LP
Sbjct: 367 TRSKMSPDGWISTQEDDC-LP 386

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  319 bits (817), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 168/379 (44%), Positives = 241/379 (63%), Gaps = 5/379 (1%)

Query: 8   GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTP 67
           G KI+ ++  EY KL +  +P TRSN  KE T++AA++A     ++   +TI+TGVK+TP
Sbjct: 7   GDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITISTGVKATP 66

Query: 68  NDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLI--HNTPNGFEWNNEL 125
           NDEL RS GKILHDCH+EIL+LR FN  LL+ ++R  EG +S  I        + WN   
Sbjct: 67  NDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPAKADGKYNWNENY 126

Query: 126 ELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNY 185
           ++ L+ISKLPCG+ SM  L E   ++E + T E++D  Q+I P+IKT++RGR N++K+N 
Sbjct: 127 KIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLNYSKKNV 186

Query: 186 VRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEE 245
           VRTKPGR DS  T SKSCSDKL ++   S+LNSL   +   P++++  +IP +    + +
Sbjct: 187 VRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPTLKDELLLK 246

Query: 246 MNLYF-NRPMDLHSSARRLYIHTSHYKFGDDLSP-ETPPSSMSALKILFNDNDIQEEQIL 303
           +N  F  R   +      L   T   KF DD +  +T P+ +S++KIL       E+ I+
Sbjct: 247 LNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPREHQIEQSIV 306

Query: 304 NGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIR 363
           NGV+NG YTK +KPL+KNC+S +S+YS W LF T+  E    +Y+E+K+     R +L  
Sbjct: 307 NGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQTL-REDLKD 365

Query: 364 SIKSSLSSDGWLSTAEDDC 382
            IKS LS DGW+ST +DDC
Sbjct: 366 IIKSKLSPDGWISTFQDDC 384

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  310 bits (794), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 244/391 (62%), Gaps = 15/391 (3%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA--SDTRTDKHSILT 58
           M   D  G +I+  V++EY KL +  RP+ R +G +E TI+A V A   D   +K  IL+
Sbjct: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76

Query: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLI-HN--T 115
           I TGVK+ P+ EL RS+GKILHDCHAEILALRG N +LL  I+          I HN   
Sbjct: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136

Query: 116 PNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILR 175
           P  F      EL L+IS+LPCG+ SMS L +  C++++ +  E+ D  QY+   +KTILR
Sbjct: 137 PARFNLKENWELALYISRLPCGDASMSFLND-NCKNDDFIKIEDSDEFQYVDRSVKTILR 195

Query: 176 GRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVI 235
           GR NFN+RN VRTKPGR DS  T SKSCSDKL ++ ++SVLN L   +   P+++   VI
Sbjct: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255

Query: 236 PNI---NSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILF 292
           PN+     H +E+   +  R  +L +  + L      Y   D L  E  P  M ++K LF
Sbjct: 256 PNLEDETKHHLEQS--FHTRLPNLDNEIKFLNCLKPFY--DDKLDEEDVPGLMCSVK-LF 310

Query: 293 NDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKR 352
            D+   EE ILNGV+NG+YTK+SKPLRK+C+S+VSR++ W LF  +  E++ ++YLEFK 
Sbjct: 311 MDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKS 370

Query: 353 RYCAERAELIRSIKSSLSSDGWLSTAEDDCQ 383
           R   +R++LI +IK+ LS DGW+ T  DD +
Sbjct: 371 RQ-KKRSQLIIAIKNILSPDGWIPTRTDDVK 400

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  310 bits (793), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/391 (44%), Positives = 248/391 (63%), Gaps = 18/391 (4%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LT 58
           MS +++   +I+  V+ EY KL +  +P TR  G KE TI+A V+  +     +++  L+
Sbjct: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66

Query: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-----RSMEGIESNLIH 113
           + TGVK+ P+ EL RS GK+LHDCHAEILALRG N +LL+HIK        + IESN  +
Sbjct: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESN--N 124

Query: 114 NTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTI 173
             P  F   ++ EL L+IS+LPCG+ SM  L +    +E+ +  E++D  QY+ P++KTI
Sbjct: 125 EIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTI 184

Query: 174 LRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNY 233
           LRGR NF+K++ VRTKPGR DS  T SKSCSDKL ++  +S+LNSL   +   P+Y+   
Sbjct: 185 LRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYI 244

Query: 234 VIPNI--NSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETP-PSSMSALKI 290
           VIP+I   +  I E + +   P D H    ++     H  F DD + E   PSSM ++K+
Sbjct: 245 VIPDIEDKTKHILERSFHNRLPCDGH----KVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300

Query: 291 LFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEF 350
             ND+   EE I NG+KNG+YTK+SKPLRK+C+S+VSR++ W LF  +  + K ++YL F
Sbjct: 301 FVNDSS-TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHF 359

Query: 351 KRRYCAERAELIRSIKSSLSSDGWLSTAEDD 381
           K +   ER  LI + K++LS DGW+ST  DD
Sbjct: 360 KSQQ-KERNRLITTAKNALSPDGWISTRIDD 389

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  309 bits (792), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 240/388 (61%), Gaps = 8/388 (2%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LT 58
           M   D+ G +I+  V++EY KL    RPVTR  G KE T++A ++A + + D ++I  L+
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHN---T 115
           + TGVK+ P+ EL RS GKILHDCHAEILALRG N +LL HIK       S+ I +   T
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 116 PNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILR 175
           P  F+  +  EL L+ISKLPCG+ S+  L +    D +    E+DD  QY+   +KTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 176 GRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVI 235
           G  NFN++N VRTKPGR DS  T SKSCSDKL ++  +S+LN+L   +   P+++   VI
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 236 PNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDN 295
           P + +     +   F+  +  +++   +++  +   + D    E  PS M ++K+  ND+
Sbjct: 241 PGLENEVKHVLKQSFHDRLP-NANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDH 299

Query: 296 DIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYC 355
              EE ILNGVKNG+YTK+SKPLRK+C+S VSR++ W LF  +  E++ ++YL+FK    
Sbjct: 300 -TNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQ- 357

Query: 356 AERAELIRSIKSSLSSDGWLSTAEDDCQ 383
             R  LI +IK  LS DGW+ T  DD Q
Sbjct: 358 KRRTRLIIAIKDILSPDGWIPTKIDDVQ 385

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  305 bits (780), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 241/388 (62%), Gaps = 17/388 (4%)

Query: 5   DDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LTITTG 62
           D  G +I +LV  EY++L A  +PVTRSNG KE T++AAV+A +   D+  +  + I+TG
Sbjct: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62

Query: 63  VKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNG--FE 120
           VK+ PN  L RS G+ILHDCHAEILALRGFN +LL++++       S+ +  +  G  F 
Sbjct: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQGGKFR 122

Query: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180
           W ++ +L L++S+LPCG+ SM  LE+     E  +   EDD  QYI P    ILRGR NF
Sbjct: 123 WKSKWKLALYVSRLPCGDASMDHLEDAS---ELDIEMSEDDRLQYIDPGKSKILRGRMNF 179

Query: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240
            ++  VRTKPGR+DS  T SKSCSDKL I+  TS LNSLT  +M TP+Y+   VIP +N 
Sbjct: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239

Query: 241 HQIEEMNLYFN----RPMDLHSSARRLYIHTSHYKFGDDLSPETP-PSSMSALKILFNDN 295
              + +   F+      +DL S   R    T    F DD + ++  PS+ S +K+  +  
Sbjct: 240 TDKKALIRCFHTRLCSSLDLIS---RFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQE 296

Query: 296 DIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKD-LTYLEFKRRY 354
              E+ ILNGVKNG+YTK  KPLR+ CES +SRYS W+L+ ++  + ++ L+YL+FK   
Sbjct: 297 HTIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQ 356

Query: 355 CAERAELIRSIKSSLSSDGWLSTAEDDC 382
             +R +L+ + K  LS   W++T +DDC
Sbjct: 357 -EQRRDLVENAKICLSHGSWIATLKDDC 383

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  301 bits (772), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 234/388 (60%), Gaps = 11/388 (2%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTIT 60
           MS+ +      ++L+   Y +L    +P  RSNG KE T++A +IA + R +   ++++ 
Sbjct: 1   MSYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLG 60

Query: 61  TGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIES--NLIHNTPNG 118
           TGVK+TPN+EL RSKGKI+HDCHAEILALRGFN +LL  +    +G     +L+    +G
Sbjct: 61  TGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDG 120

Query: 119 --FEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRG 176
             F+  +     L+ISKLPCG+ SM  LEE   ED NS   E  D  QY+     T+LRG
Sbjct: 121 LSFKVPDHWSFALYISKLPCGDSSMDTLEE---EDLNSFNIENTDACQYLEQNNHTLLRG 177

Query: 177 RCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIP 236
           R N+ K+ +VRTKPGR DSK T SKSCSDKL IR  TS+LNS+   +  TP+Y+   +IP
Sbjct: 178 RFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIP 237

Query: 237 NINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDD-LSPETPPSSMSALKI-LFND 294
           N++ H +  +   F R  + H S   L   +    F DD ++ +  PSSMS++ + + N+
Sbjct: 238 NLDEHALVGLERSFERLCN-HPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHNN 296

Query: 295 NDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRY 354
            +  +E ILNGVKNG+Y K  KPLRKNCES VSR S W L+ T+    +  TYL+FK   
Sbjct: 297 GEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKSTQ 356

Query: 355 CAERAELIRSIKSSLSSDGWLSTAEDDC 382
             ER  L    K  LS DGW+ T  DDC
Sbjct: 357 -VERNILKNEAKLCLSPDGWIPTGVDDC 383

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  300 bits (767), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 183/394 (46%), Positives = 247/394 (62%), Gaps = 20/394 (5%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA--SDTRTDKHSILT 58
           M  +D+   +I+  V+ EY KL A  RPVTR +G +E TI+A V A   +   D   +L+
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-----RSMEGIESNLIH 113
           I TGVKS P+ EL RS+GK+LHDCHAEILALRG N + L HIK        + IESN  +
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESN--N 118

Query: 114 NTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTI 173
             P  F   ++ EL L+ISKLPCG+ SM  L +    D++ L  ++DD  QY+ P++KTI
Sbjct: 119 EIPPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTI 178

Query: 174 LRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNY 233
           LRGR NF K++ VRTKPGR DS  T SKSCSDKL +R  +S+LNSL S +   P+++   
Sbjct: 179 LRGRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYI 238

Query: 234 VIPNINS---HQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPE-TPPSSMSALK 289
           VIPN++    H +E+   + NR   L   + R      H  F DD   E + PS M + K
Sbjct: 239 VIPNLDEKTRHTLEQS--FHNR---LPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTK 293

Query: 290 ILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLE 349
           +  ND+ + EE ILNG+KNG+YTK  KPLRK+CES +SR++ W LF  +  E+KD +YL+
Sbjct: 294 LFMNDSTV-EEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQ 352

Query: 350 FKRRYCAERAELIRSIKSSLSSDGWLSTAEDDCQ 383
           FK +   ER +LI  IK +LS DGW+ T  DD +
Sbjct: 353 FKAQQ-TERNQLITLIKGALSPDGWIPTKTDDVK 385

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  296 bits (759), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 238/377 (63%), Gaps = 6/377 (1%)

Query: 10  KITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPND 69
           ++ ++V  EY KL    +PV RSNG KE T++A+ +  D+ T    +++++TGVK+ P+ 
Sbjct: 10  RVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKALPDK 69

Query: 70  ELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGI-ESNLIH-NTPNG-FEWNNELE 126
           EL+RS GK++HDCHAEILALRGFN +LL+ I    + + +S+L+  +  NG +    + +
Sbjct: 70  ELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHLRAKWK 129

Query: 127 LTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYV 186
           L L+IS+LPCG+ SM  L        +  + ++ D  QYI P I TILRGR NF++   V
Sbjct: 130 LILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLNFSRNGVV 189

Query: 187 RTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEM 246
           RTKPGR+DS  T SKSCSDKL +R  TS+LN +T  ++ TP++I   +IP +N     ++
Sbjct: 190 RTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYDNKNDL 249

Query: 247 NLYF-NRPMDLHSSARRLYIHTSHYKFGDDLSPET-PPSSMSALKILFNDNDIQEEQILN 304
            L F NR      + R +   T+  KF +D +  T  PSSMS++K+     +  EE +LN
Sbjct: 250 LLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETIEEALLN 309

Query: 305 GVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIRS 364
           GVKNG YTK +KPLRKNCES VSRY+ W ++  ++  +   +YLEFKR   A R ELI+ 
Sbjct: 310 GVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA-RLELIKY 368

Query: 365 IKSSLSSDGWLSTAEDD 381
               LSS+GWL T  DD
Sbjct: 369 TNEILSSEGWLPTQPDD 385

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  296 bits (757), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 169/391 (43%), Positives = 242/391 (61%), Gaps = 18/391 (4%)

Query: 6   DYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA-SDTRTDKHSILTITTGVK 64
           + G KI  L+  EY KL    +P+ +SNG KE TI++ ++A S+  T+   ++++ TGVK
Sbjct: 5   ELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLATGVK 64

Query: 65  STPNDELARSKGKILHDCHAEILALRGFNRLLLEHIK-RSMEGIES-NLIHNTPNG---- 118
           +TP+ EL RS+G I+HDCHAEILA+RGFN  LL  I+ + ++   S +LI+   N     
Sbjct: 65  ATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKK 124

Query: 119 FEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRC 178
           + WN+E +L L+ISKLPCG+ SM   EE   E  + + F+E+D  QY+ P I+TILRGR 
Sbjct: 125 YSWNDEYDLGLYISKLPCGDSSME--EENSLESNSLIQFQENDLTQYVDPTIRTILRGRI 182

Query: 179 NFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNI 238
           N+NK   VRTKPGRIDS+ T+SKSCSDK+ I+   S+LNSL + ++ +P+YI   V P+I
Sbjct: 183 NYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPDI 242

Query: 239 NSHQIEEMNLYFNR----PMDLHSSARR--LYIHTSHYKFGDDLSPETPPSSMSALKILF 292
               +  +   FNR     +++ SS R   L    S  +F D  + +    S +++  +F
Sbjct: 243 KPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIF 302

Query: 293 NDNDI--QEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEF 350
           N ND    E+ I+NGVK G YTK SKPL KN  + VSR   W++F  +  EF+  +YL F
Sbjct: 303 NSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLTF 362

Query: 351 KRRYCAERAELIRSIKSSLSSDGWLSTAEDD 381
           K R+  +R E    I+  LS DGW+ST  DD
Sbjct: 363 K-RFQTDRIETRNRIRKCLSQDGWISTFNDD 392

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  294 bits (752), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 231/385 (60%), Gaps = 23/385 (5%)

Query: 8   GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTP 67
           G +I + VL  Y KL +  +P TRSNG KE T++A ++A D +     +++I TGVK+ P
Sbjct: 7   GNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKALP 66

Query: 68  NDELARSKGKILHDCHAEILALRGFNRLLLEHIK--RSMEGIESNLIHNTPNG--FEWNN 123
           +  L RS GK++HDCHAEILALR FN ++L+ I    S    + +L+        F + +
Sbjct: 67  DAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFKD 126

Query: 124 ELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKR 183
             EL ++IS LPCG+ SM LL    C+DE+ +  ++DD  Q++ P + +I+RGR N+++R
Sbjct: 127 NWELAIYISTLPCGDASMDLL----CQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYSRR 182

Query: 184 NYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS--H 241
             VRTKPGR DS+ T  KSCSDKL  R   S+LN +T  ++  P+Y+   V PN     H
Sbjct: 183 QVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDLLH 242

Query: 242 Q--IEEMNLYFNRPMDLHSSARRLYIHTSHYKF-GDDLSPETPPSSMSALKILFNDNDIQ 298
           Q   + + +  N P         L +    Y+F  D  S E  PS+MS++K+        
Sbjct: 243 QSFYDRIKVLPNVP---------LKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTV 293

Query: 299 EEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAER 358
           E+ +LNG+KNG+YTK +KPLR+NCE  VSRY+ W LF T+  EF + TYL+FK     +R
Sbjct: 294 EQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATI-QDR 352

Query: 359 AELIRSIKSSLSSDGWLSTAEDDCQ 383
             LI+  +  LS  GW+ST+ DDC+
Sbjct: 353 NALIQDCRKLLSPKGWISTSRDDCE 377

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  293 bits (749), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 160/387 (41%), Positives = 235/387 (60%), Gaps = 12/387 (3%)

Query: 5   DDY-GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGV 63
           D+Y   K++  V  EY KL    +PV +SN   E T++A +IA +  T +   + ITTGV
Sbjct: 13  DNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGV 72

Query: 64  KSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKR--SMEGIESNLIHNTPNGFEW 121
           K+TP+ +L RS+GKI+HDCHAEILALR FN  LL+ I R  + +G    +     N +EW
Sbjct: 73  KATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNSYEW 132

Query: 122 NNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFN 181
           N + +L L+ISKLPCG+ SM  L  MK  D       +D+  QYI P+ KT +RGR N+ 
Sbjct: 133 NKKWDLALYISKLPCGDASMDDL--MKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYK 190

Query: 182 KRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSH 241
           KR+ +RTKPGR DSK T SKSC+DKL ++    +L+S  S +M  P+++   +IP I+  
Sbjct: 191 KRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRISGK 250

Query: 242 QIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPET---PPSSMSALKILFNDNDIQ 298
           +    + + +R    +   +     +    F DD    T    P+ ++++KI  ++N + 
Sbjct: 251 ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVM 310

Query: 299 EEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLF--ITMHR-EFKDLTYLEFKRRYC 355
           E+ I+NGVKNG+Y+K  KPLRKNCE  +SRYS W+L   I  +R E  +++YLEFK    
Sbjct: 311 EQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTL- 369

Query: 356 AERAELIRSIKSSLSSDGWLSTAEDDC 382
            +R  L + ++S LS DGW++T +DDC
Sbjct: 370 TKRMTLQQEVRSLLSPDGWITTKKDDC 396

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  291 bits (745), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 245/394 (62%), Gaps = 13/394 (3%)

Query: 2   SFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASD--TRTDKHSILTI 59
           ++ D  G +I +L   EY KLS+  +PV RSNG+KE T+++ ++A D  +   K  +++I
Sbjct: 5   NWSDRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSI 64

Query: 60  TTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSM--EGIESNLIHNTPN 117
            TGVK+ P+  L RS G+++HDCHAEILALRGFN +LLEH+   +  +  E++LI  T  
Sbjct: 65  GTGVKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTA 124

Query: 118 GF-EWNNELELTLFISKLPCGELSMSLLEEMKCEDEN---SLTFEEDDNQQYITPEIKTI 173
           G     ++ +L L+IS LPCG+ SM  L+     D N    LTFEE+   Q+I  +I++I
Sbjct: 125 GVCILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSI 184

Query: 174 LRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNY 233
           LRGR N+++   VRTKPGR DS+ T+SKSCSDKL I+  TS+LNSLT  +M  P+++   
Sbjct: 185 LRGRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYL 244

Query: 234 VIPNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFN 293
           VIPN+   + + ++  F   +      + L +   +  F D+ S ++   S  +   LF 
Sbjct: 245 VIPNLAVDRCQGVHHSFQDRLG-RLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFL 303

Query: 294 D---NDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEF 350
           D       E+ ILNG+KNG+YTK +KPLRKNCES VSR + W +++ +  + K  TYLEF
Sbjct: 304 DLPERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEF 363

Query: 351 KRRYCAERAELIRSIKSSLSSDGWLSTAEDDCQL 384
           K    +ER  +I+ +K  LS DGW+ST  DDC +
Sbjct: 364 KAGL-SERNRIIQEVKKVLSPDGWISTRNDDCHI 396

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  290 bits (743), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 235/386 (60%), Gaps = 10/386 (2%)

Query: 5   DDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKH-SILTITTGV 63
           D  G +I +LV SEY++LS   +P  RSNG KE TI++ ++A          ++++TTGV
Sbjct: 3   DLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGV 62

Query: 64  KSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIH---NTPNGFE 120
           K+TPN +L RS+G++LHDCHAEILALRGFN +LL  ++ +      +LI       N F 
Sbjct: 63  KATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKFR 122

Query: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180
            N E +L LFIS+LPCG+ SM+ L+E     +++   ++DD  QYI P  +++LRGR N+
Sbjct: 123 LNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNY 182

Query: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS 240
            K+  VRTKPGR+DSK TYSKSCSDKL     TS+LN+ T  ++   +YI   ++PNI++
Sbjct: 183 AKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISA 242

Query: 241 HQIEEMNLYFNRPMDLHS-SARRLYIHTSHYKFGDDLSPET-PPSSMSALKILFNDNDIQ 298
                +   F   +   +    ++ I +    F DD   E   PSS+S +K+   + +  
Sbjct: 243 SDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGETL 302

Query: 299 EEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREF--KDLTYLEFKRRYCA 356
           E+ +L+G++NG++TK SKPLR NCE+ VSR S W LF T++ E   K  +Y +FK +   
Sbjct: 303 EQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKL-V 361

Query: 357 ERAELIRSIKSSLS-SDGWLSTAEDD 381
            RAELI   +S L+    W+ T  DD
Sbjct: 362 PRAELITRTRSLLTNGQPWIPTCSDD 387

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  290 bits (741), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 166/385 (43%), Positives = 229/385 (59%), Gaps = 18/385 (4%)

Query: 6   DYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKS 65
           D   KI++L  S YEKL    +PV RSNG KE  ++A VIA         ++++ TGVKS
Sbjct: 6   DLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQGLR-LVSLATGVKS 64

Query: 66  TPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSME---GIESNLIHNTPN---GF 119
           TPNDEL RS G+ILHDCHAEILALRGFN +LL+ I+  ++    +  +L+  + +    F
Sbjct: 65  TPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGKF 124

Query: 120 EWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCN 179
           +  ++    L+IS++PCG+ SM LL+      E+ + F ED + QY+ P  +TILRGR N
Sbjct: 125 KLGDDWSFALYISRIPCGDASMDLLQS-----ESDMEFSEDTSCQYVNPCNRTILRGRFN 179

Query: 180 FNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNIN 239
           +NKR YVRTKPGR DS  T SKSCSDKL  R   S+LN++T  +M +P+++   V+P ++
Sbjct: 180 YNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVS 239

Query: 240 SHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDD-LSPETPPSSMSALKILFNDNDIQ 298
           +         F   +      + + +     +F DD       PSS+S   IL N ND Q
Sbjct: 240 NTARRGFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSG--ILLNTNDGQ 297

Query: 299 EEQ--ILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCA 356
            EQ  ILNGVK+G Y +  KPLRKNCE+ +SR + W+LF  +       +Y  FK    A
Sbjct: 298 PEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVA 357

Query: 357 ERAELIRSIKSSLSSDGWLSTAEDD 381
            R  L   ++SSLSSDGW+ST  DD
Sbjct: 358 -RNVLKNKVRSSLSSDGWISTGPDD 381

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  280 bits (716), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 157/390 (40%), Positives = 224/390 (57%), Gaps = 14/390 (3%)

Query: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTIT 60
           M   ++   KI EL    Y KL    +P  RSNG KE  ++A V+A +   +   ++++ 
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLA 60

Query: 61  TGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHI---KRSMEGIESNLIHNTPN 117
           TGVK+ PN++L RS G+ILHDCHAEILALRGFN +LL+ I   K S      +L+ ++ +
Sbjct: 61  TGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSD 120

Query: 118 G---FEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTIL 174
               +  N E    L+IS+ PCG+ SM LL      DE  ++F +DD  QY+    KTI+
Sbjct: 121 NSGIYRLNEEWSFALYISRAPCGDASMGLL-----YDEGCISFTDDDRCQYVDDNNKTII 175

Query: 175 RGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYV 234
           RGR N+ K+ YVRTKPGR DSK T SKSC+DKL  +   S+LNSLT  ++  P+++   V
Sbjct: 176 RGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIV 235

Query: 235 IPNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPET-PPSSMSALKILFN 293
           IP +      +    F+  +       ++ I +   +F DD + E  PPS MS++ +   
Sbjct: 236 IPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLNII 295

Query: 294 DNDI-QEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKR 352
           +  + Q++ ILNGVK G + K   PL+KNCE+ VSR S WSLF  +       TY EFK 
Sbjct: 296 EGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKS 355

Query: 353 RYCAERAELIRSIKSSLSSDGWLSTAEDDC 382
           +   +R  L   I+ +LS DGW+ T  DDC
Sbjct: 356 QQ-TDRNALKERIRLALSKDGWVGTESDDC 384

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  279 bits (713), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/379 (40%), Positives = 227/379 (59%), Gaps = 12/379 (3%)

Query: 10  KITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPND 69
           +I   V+S Y+KL   G+P  RSNG  E T+++ ++A D   D++  +++ TGVK+TPN+
Sbjct: 7   RIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVKATPNE 66

Query: 70  ELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHNTPNGFEWNNELELTL 129
           EL RS G+I+HDCHAE++ LR FN LLL+ I     G +S LI  + +G++  +  +  +
Sbjct: 67  ELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSADGYKVKDVWKFAM 126

Query: 130 FISKLPCGELSMSLLE-EMKCEDENSLTFEED-DNQQYITPEIKTILRGRCNFNKRNYVR 187
           +IS++PCG+ SM+LLE E K E EN         N QY+ PEI TI+RGR N+  R  VR
Sbjct: 127 YISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRANYKLRKVVR 186

Query: 188 TKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEMN 247
           TKPGR DSK T SKSCSDKL ++   S+ N+LT  ++ +P+Y+   V+P    +Q E++ 
Sbjct: 187 TKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLP--KQYQYEQVQ 244

Query: 248 LYFNRPMDLHSSA----RRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQEEQIL 303
           L     + L +      + L+ + +   F  D +  +   S+S+   L+  N+   E IL
Sbjct: 245 LEDTFWLRLKNQQFLPFKFLFCNET---FSADRTNLSQQPSLSSCVSLYGSNEAVSEVIL 301

Query: 304 NGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIR 363
           NGVKNG+Y K  KPLRK C+S +SR + WS F  +     D  Y  FK     +R  +I 
Sbjct: 302 NGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSV-VDRNHIIS 360

Query: 364 SIKSSLSSDGWLSTAEDDC 382
             K++LS+ GW+ST  D+C
Sbjct: 361 KAKATLSASGWISTCRDNC 379

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  264 bits (674), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/379 (39%), Positives = 225/379 (59%), Gaps = 11/379 (2%)

Query: 11  ITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPNDE 70
           ++ELV+ +Y+ L    +P  +SNG KE T++A ++A D  T++  ++++ TGVK+ PN+E
Sbjct: 12  VSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKALPNEE 71

Query: 71  LARSKGKILHDCHAEILALRGFNRLLLEHIK-RSMEGIES-NLIH--NTPNGFEWNNELE 126
           L RS G++LHD HAEILALR FN +LL+ +   +    E+ +L+   NT + +      +
Sbjct: 72  LERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMRKRWK 131

Query: 127 LTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYV 186
           + L+IS+ PCG+ SM +L E   +D N + F  DD  QYI P I+T LRGR N++ +   
Sbjct: 132 IALYISRPPCGDCSMDILGE---DDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKGVT 188

Query: 187 RTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEM 246
           RTKPGR DSK T SKSCSDKL  +   S+LNS    ++ TP+++S  V+P  +  +  + 
Sbjct: 189 RTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKASDG 248

Query: 247 NL--YFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQ-EEQIL 303
            L  +  R + L+       I  S    GD       P  +S + I     ++  EE IL
Sbjct: 249 CLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEGIL 308

Query: 304 NGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIR 363
           NGV NG+Y KA++PLRKNCES +SR S W+LF  +       +YL+FK +    R +L  
Sbjct: 309 NGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQ-TSRNQLKE 367

Query: 364 SIKSSLSSDGWLSTAEDDC 382
            ++  LSSDGW+ T+ DDC
Sbjct: 368 QVRLHLSSDGWIPTSADDC 386

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  236 bits (602), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 140/385 (36%), Positives = 216/385 (56%), Gaps = 17/385 (4%)

Query: 5   DDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVK 64
           D     I   V+ +Y       +P  RSNG+ E T++A V+  D +T +  +++  TGVK
Sbjct: 4   DKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAATGVK 63

Query: 65  STPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEG--IESNLIHN--TPNGFE 120
           + P+ EL RS G+++HD HAEILALRGFN +LL+  K   +G   E +L+    T + F 
Sbjct: 64  ALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQDRFR 123

Query: 121 WNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNF 180
             +  +  L+ISK PCG+ SM + ++   E    +TF  DD  QY+     T+LRGR N+
Sbjct: 124 LASRWQAALYISKAPCGDCSMDMADDDADE----MTFSPDDPIQYVAEHNYTMLRGRFNY 179

Query: 181 NKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPN-IN 239
           +++   RTKPGR DS+ T SKSCSDKL  +   S+L+S+T  +   P+++   V+P+ I 
Sbjct: 180 SRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPHTIA 239

Query: 240 SHQIEEMNLYFNRPMDLHSS--ARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDI 297
           +   E    +  R   L  +   R L  HT+    GD  +P+ PP+  +++ +       
Sbjct: 240 TAGFE--RCFAERLAGLEGTHMPRLLCCHTAFP--GDRAAPQQPPALTASVYLNITAKKH 295

Query: 298 QEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAE 357
            E+ +LNGV+NG Y +  + L  + E+ VSR +LW +F+ +H +   L+Y  FKR+  A 
Sbjct: 296 VEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHA- 353

Query: 358 RAELIRSIKSSLSSDGWLSTAEDDC 382
           R  L R ++  LS DGW +T  DDC
Sbjct: 354 RNRLKRHVRHRLSPDGWPTTRVDDC 378

>Smik_14.241 Chr14 (447438..449930) [2493 bp, 830 aa] {ON} YNL085W
           (REAL)
          Length = 830

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 273 GDDLSPET-PPSSMSALKILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRY 329
           G+DL P T PP  +  +  LF   DI  E +LN   N Y  + S PL+ + +  V  Y
Sbjct: 261 GNDLQPTTLPPLQIYPVPQLF---DIALEMVLNTGTNFYAYQLSTPLQNDSKENVQSY 315

>Suva_14.254 Chr14 (465825..468320) [2496 bp, 831 aa] {ON} YNL085W
           (REAL)
          Length = 831

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 273 GDDLSPET-PPSSMSALKILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRY 329
           G+DL P T PP  +  +  LF   DI  E +LN   N Y  + S PL+ + +  V  Y
Sbjct: 262 GNDLQPTTLPPLQIYPVPQLF---DIALEMVLNTGTNFYAYQLSTPLQNDSKENVQSY 316

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
           YNL250W
          Length = 1306

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 301 QILNGVKNGYYTKASKPLRKNCESKVSRYSLWSL---FITMHREFKDLTYLEFKRRYCAE 357
           Q+ N ++N Y  K    +RK  E    R+    L    +T+  EFK    L+    Y  E
Sbjct: 329 QLKNQLQNAYIEK-DDLIRKEAELTSKRHDYEQLKHDRLTLIEEFKQKFPLDLSSDYPTE 387

Query: 358 RAELIRSIKSSLSSDGWLSTAEDDCQLP 385
              L+R  K +L SD  +  AE + +L 
Sbjct: 388 CLRLLRDYKKTLESDAQMVKAEGESKLA 415

>TPHA0C03570 Chr3 (771348..773585) [2238 bp, 745 aa] {ON} Anc_2.320
           YDL116W
          Length = 745

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 78/191 (40%), Gaps = 38/191 (19%)

Query: 134 LPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYVRTKPGRI 193
           L CGE    + EE K  D  ++       Q+Y+ P + + LR    F K+  V+ +   +
Sbjct: 211 LLCGEYE-RVFEECKLSDNITMYMILCGMQEYVDPVVDSQLRN--GFEKQQGVKKRI--L 265

Query: 194 DSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPN-----INSHQIEEMNL 248
             +A Y+ S +D            SL SY      Y++    PN      N    +E+ +
Sbjct: 266 WRRAVYNLSLND------------SLDSYERAIYSYLAG-DFPNDEEVRSNLSWAKELLI 312

Query: 249 YFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDNDIQEEQILNGVKN 308
           Y N+ M++       Y+        D+L    P  SM          D+Q   ILN + N
Sbjct: 313 YLNQIMNIEIEN---YLMKEEKVTKDELILALPSKSM----------DLQ--SILNLLSN 357

Query: 309 GYYTKASKPLR 319
            Y T+A+ PLR
Sbjct: 358 KYSTEAAHPLR 368

>CAGL0B04213g Chr2 (412230..414932) [2703 bp, 900 aa] {ON} some
           similarities with uniprot|P48361 Saccharomyces
           cerevisiae YGR097w ASK10 involved in SKN7P-dependent
           transcription
          Length = 900

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 205 DKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQ---IEEMNLYFNRPMDLHSSAR 261
           D+    H   +LN  ++   P P  +S+ V  N+ + Q   I +  +Y+    D+   ++
Sbjct: 455 DQFITHHTNCMLNWTSTQPKPVPRELSDIVYQNMKAPQSKCIRKGYMYYGSGKDVKKYSK 514

Query: 262 RLYIHTSHY--KFGD-DLSPE 279
             +I TSHY  +F D D S E
Sbjct: 515 GYFILTSHYLHEFKDSDFSKE 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,168,440
Number of extensions: 1976527
Number of successful extensions: 6236
Number of sequences better than 10.0: 58
Number of HSP's gapped: 6365
Number of HSP's successfully gapped: 58
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)