Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H07711g3.567ON56654323840.0
YGL244W (RTF1)3.567ON55855315620.0
Smik_7.173.567ON56555315450.0
Suva_7.173.567ON56955815320.0
Skud_7.233.567ON56454815050.0
NCAS0E002603.567ON55854614960.0
TPHA0A060003.567ON54954214670.0
TDEL0D063503.567ON56555914610.0
ZYRO0E09526g3.567ON56055114430.0
NDAI0I032403.567ON56355114320.0
KNAG0I002303.567ON57155714320.0
SAKL0F00814g3.567ON57449314030.0
Kpol_507.103.567ON46146813810.0
AFR266W3.567ON56256313840.0
Ecym_25973.567ON56251713770.0
KLTH0G00726g3.567ON56149613251e-177
Kwal_47.192653.567ON56755012721e-169
TBLA0E002203.567ON57050412431e-165
KAFR0J028803.567ON55532211451e-150
KLLA0A00737g3.567ON58232310731e-139
Kwal_27.100771.492ON598177770.93
SAKL0E02618gsingletonON27367731.9
KLTH0C07502gna 1ON425124732.5
SAKL0E02684g2.486ON27367722.9
Ecym_12991.405ON37277714.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H07711g
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   922   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   606   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   599   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   594   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   584   0.0  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   580   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   569   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   567   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   560   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   556   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   556   0.0  
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   545   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   536   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   537   0.0  
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   535   0.0  
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   514   e-177
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   494   e-169
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   483   e-165
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   445   e-150
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   417   e-139
Kwal_27.10077 s27 complement(182973..184769) [1797 bp, 598 aa] {...    34   0.93 
SAKL0E02618g Chr5 complement(210003..210824) [822 bp, 273 aa] {O...    33   1.9  
KLTH0C07502g Chr3 complement(647606..648883) [1278 bp, 425 aa] {...    33   2.5  
SAKL0E02684g Chr5 complement(214237..215058) [822 bp, 273 aa] {O...    32   2.9  
Ecym_1299 Chr1 complement(606595..607713) [1119 bp, 372 aa] {ON}...    32   4.9  

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/543 (87%), Positives = 476/543 (87%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDDYNPDDGYEPVDVSDKXXXXXXXNPFPLEGK 83
           TTTNKRTKGSSNSQVKKRRIEVDSEDEEDDYNPDDGYEPVDVSDK       NPFPLEGK
Sbjct: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDDYNPDDGYEPVDVSDKEEEEEEENPFPLEGK 83

Query: 84  YKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTR 143
           YKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTR
Sbjct: 84  YKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTR 143

Query: 144 SSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXXXXXXX 203
           SSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYG             
Sbjct: 144 SSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEFKDDFIEED 203

Query: 204 XXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRIGRSFVA 263
             YKENDDDEEGYDPYARKSKYAQ                 RDAEVQDFNKIRIGRSFVA
Sbjct: 204 SDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKIRIGRSFVA 263

Query: 264 KYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVT 323
           KYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVT
Sbjct: 264 KYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVT 323

Query: 324 QGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTE 383
           QGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTE
Sbjct: 324 QGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTE 383

Query: 384 KLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMA 443
           KLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMA
Sbjct: 384 KLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMA 443

Query: 444 MYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTK 503
           MYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTK
Sbjct: 444 MYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTK 503

Query: 504 VYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIGSINVDIK 563
           VYY                   LKID         QLMLAEFRRLGGLQKIIGSINVDIK
Sbjct: 504 VYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKIIGSINVDIK 563

Query: 564 LDI 566
           LDI
Sbjct: 564 LDI 566

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/553 (58%), Positives = 395/553 (71%), Gaps = 32/553 (5%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDS---EDEEDDYNPDDGYEPVDVSDKXXXXXXXNPFPL 80
           TT+ KR K +  S  KKRRIEV S   +DEEDDYNP   Y   +           NPFPL
Sbjct: 26  TTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNP---YSVGNADYGSEEEEEANPFPL 82

Query: 81  EGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQAGED 138
           EGKYKD +DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RGR++K  QQ+ +  ED
Sbjct: 83  EGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKNDED 142

Query: 139 SQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXX 198
           S+KTR+S RST ATGHSDIKASKLSQLKKQR RK++             +Y         
Sbjct: 143 SRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNR-------------HYSDNEDEDDE 189

Query: 199 XXXXXXXYKEND-----DDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFN 253
                  YK+++     DDEE Y+P+ R+  Y +                 R+ E+ DFN
Sbjct: 190 EDYREEDYKDDEGSEYGDDEE-YNPFDRRDTYDKREEVEWAEEEDEQD---REPEISDFN 245

Query: 254 KIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGK 313
           K+RIGRSFVAK+CFYPGF + ++GCYGRVNVG DKRTG  +YRMV+IE+VFLQKPYNMGK
Sbjct: 246 KLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGK 305

Query: 314 FFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEI 373
           F+TNQYFGVTQGKDRKVFQMN+FSDG F E E++RYL+ALD+S + KPS +++  K KE+
Sbjct: 306 FYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEV 365

Query: 374 SEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSK 433
            +F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DIAKYS 
Sbjct: 366 MDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSA 425

Query: 434 QLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSD 493
           QLRNFEKRM++YEKHHENDQ+DIKKL  LTSKNRKLNM+ IRNAE +KKE+  NFDSKSD
Sbjct: 426 QLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSD 485

Query: 494 PFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQK 553
           PFSRLKTRTKVYY                   L+ D         +L++A+FRRLGGL++
Sbjct: 486 PFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLER 545

Query: 554 IIGSINVDIKLDI 566
           ++G +  DIK D+
Sbjct: 546 MVGEL--DIKFDL 556

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/553 (58%), Positives = 392/553 (70%), Gaps = 25/553 (4%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDS--------EDEEDDYNPDDGYEPVDVSDKXXXXXXX 75
           TT+ KR K +  S  KKRRIEV +        EDEEDDYNP   Y   + S         
Sbjct: 26  TTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNP---YSVGNASYGSEEVEEP 82

Query: 76  NPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKI 133
           NPFPLEGKYK+ +DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RGR++K  QQ+ 
Sbjct: 83  NPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 142

Query: 134 QAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXX 193
           +  EDS+KTR+S RST ATGHSDIKASKLSQLKKQR RK++         SD +      
Sbjct: 143 KNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNR-------HYSDNEGEVDDE 195

Query: 194 XXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFN 253
                         E  DDEE Y+P+ R   Y +                 R+ E+ DFN
Sbjct: 196 DEYREDDYKDDEGSEYGDDEE-YNPFDRGDLYDKREEEVEWAEEEDELD--REPEISDFN 252

Query: 254 KIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGK 313
           K+RIGRSFVAK+CFYPGF ++++GCYGRVNVG DKRTG  +YRMV+IE+VFLQKPYNMGK
Sbjct: 253 KVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGK 312

Query: 314 FFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEI 373
           F+TNQYFGVTQGKDRKVFQMN+FSDG F + E++RYL+ALD+S I KPS +++  K KE+
Sbjct: 313 FYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEV 372

Query: 374 SEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSK 433
            +F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DIAKYS 
Sbjct: 373 MDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSA 432

Query: 434 QLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSD 493
           QLRNFEKRM++YEKHHENDQ+DIKKL  LTSKNRKLNM+ IRNAE +KKE+  NFDSKSD
Sbjct: 433 QLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSD 492

Query: 494 PFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQK 553
           PFSRLKTRTKVYY                   L+ D         +L+LA+FRRLGGL++
Sbjct: 493 PFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLER 552

Query: 554 IIGSINVDIKLDI 566
           +IG +  DIK D 
Sbjct: 553 MIGEL--DIKFDF 563

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/558 (57%), Positives = 394/558 (70%), Gaps = 31/558 (5%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDS-------EDEEDDYNP----DDGYEPVDVSDKXXXX 72
           +T+ KR K +  S  KKRRIEV S       ++EEDDYNP    + GY       +    
Sbjct: 26  STSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGY-----GSEEEEE 80

Query: 73  XXXNPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQ- 131
              NPFPLEGKYKD +DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RG+++K+Q 
Sbjct: 81  VEPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQ 140

Query: 132 ---KIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDN 188
              + +  EDS+KTR+S RST ATGHSDIKASKLSQLKKQR RK++    S+ E+ D++ 
Sbjct: 141 QRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEE 200

Query: 189 YGXXXXXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAE 248
           Y                  E  DDEE Y+P+ RK  Y +                    E
Sbjct: 201 YREDDYKNDEGS-------EYGDDEE-YNPFDRKGVYDKREEEVEWAEEEEDELDRD-PE 251

Query: 249 VQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKP 308
           + DFNK+RIGRSFVAK+CFYPGF ++++GCYGRVNVG DKRTG  +YRMV+IE++FLQKP
Sbjct: 252 ISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKP 311

Query: 309 YNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKT 368
           YNMGKFFTNQYFGVTQGKDRKVFQMN+FSDG F + E++RY KALD S++ KPS + +  
Sbjct: 312 YNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSN 371

Query: 369 KFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDI 428
           K KE+ +F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DI
Sbjct: 372 KTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 431

Query: 429 AKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNF 488
           AKYS QLRNFEKRM++YEKHHENDQ+DIK L  LTSKNRKLN++ IRNAE +KKE+  NF
Sbjct: 432 AKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNF 491

Query: 489 DSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRL 548
           DSKSDPFSRLKTRTKVYY                   L+ D         +L+LA+FRRL
Sbjct: 492 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRL 551

Query: 549 GGLQKIIGSINVDIKLDI 566
           GGL+++IG +  DIK D 
Sbjct: 552 GGLERMIGEL--DIKFDF 567

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/548 (57%), Positives = 392/548 (71%), Gaps = 16/548 (2%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDS-EDEEDDYNPDDGYEPVDVSDKX--XXXXXXNPFPL 80
           +T+ KR K +  S  KKRRIEVDS E+E+++   +D Y P  V +          NPFPL
Sbjct: 26  STSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYGSEGEEANPFPL 85

Query: 81  EGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQAGED 138
           EGK+KD  DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RGR++K  QQ+ +  ED
Sbjct: 86  EGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKDKED 145

Query: 139 SQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXX 198
           S+KTR+S RST ATGHSDIKASKLSQLKKQR RK++    ++ EE DED Y         
Sbjct: 146 SRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEYREDNYKNEE 205

Query: 199 XXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRIG 258
                   + N        P+ RK  Y +                 R+ E+ D+NK+RIG
Sbjct: 206 ESEYEDDEEYN--------PFDRKDLYDKREEEVEWAEEGEDELD-REPEISDYNKLRIG 256

Query: 259 RSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQ 318
           RSFVAK+CFYPGF ++++GCYGRVN+G DKRTG  +YRMV+IE+VFLQKPY+MGKF+TNQ
Sbjct: 257 RSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQ 316

Query: 319 YFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFIS 378
           YFGVTQGKDRKVFQMN+FSDG F + E+ RY KALD+S++ KPS +++  K KE+ +F++
Sbjct: 317 YFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVN 376

Query: 379 QPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNF 438
            PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DIAKYS QLRNF
Sbjct: 377 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 436

Query: 439 EKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRL 498
           EKRM++YEKHHENDQ+DIK L  LTSKNRKLNM+ IRNAE +KKE++ NFDSKSDPFSRL
Sbjct: 437 EKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRL 496

Query: 499 KTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIGSI 558
           KTRTKVYY                   L+ D         +L+LA+FRRLGGL+++IG +
Sbjct: 497 KTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGEL 556

Query: 559 NVDIKLDI 566
             DIK D 
Sbjct: 557 --DIKFDF 562

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/546 (58%), Positives = 388/546 (71%), Gaps = 15/546 (2%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSE-DEEDDYNPDDGYEPVDVSDKXXXXXXXNPFPLEG 82
           TT+NKR K   ++  K+++IEVDSE +EEDDY+P + +   ++S +       NPFPLEG
Sbjct: 25  TTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGN-FGAGNIS-EEEEEMEQNPFPLEG 82

Query: 83  KYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQAGEDSQ 140
           KYKD ADR+ LESLPEMERET+LFERSQ MRKYQERKLFRER RNLK  QQ+    E+  
Sbjct: 83  KYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEGT 142

Query: 141 KTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXXXX 200
           KTR+S R+T ATGHSD+KASKLSQLKKQRERK   RR SD E S+ +             
Sbjct: 143 KTRTSTRTTHATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEEEEEEYDEEEYKK 202

Query: 201 XXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRIGRS 260
                Y+E  +         RK +Y++                 R+ E+ DFNK++IGRS
Sbjct: 203 DEDSEYEEEYNPY------ERKGRYSEDKNDEVEWAEEQTD---RETELDDFNKVKIGRS 253

Query: 261 FVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYF 320
           FVAKYCFYPGFNELI+GCYG+VNVG D+RTG  +YRMVKIEK+FLQKPY MG+FFTNQYF
Sbjct: 254 FVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYF 313

Query: 321 GVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQP 380
           GVTQG +RKVFQMNFFSDG F   EFERY+++LD+S+I KPS Y +K K KEI  FIS+P
Sbjct: 314 GVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEP 373

Query: 381 LTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEK 440
           LTE+L D IVRNRM+ NKKLSGTNAVLEKT+L+DKLRYA+EN NE D+AKYS QLRN EK
Sbjct: 374 LTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEK 433

Query: 441 RMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKT 500
           R+++YEKHHENDQ    KL  LTSKNRK+NM++I+N    KKEE + FDSKSDPFSRLKT
Sbjct: 434 RLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEE-IGFDSKSDPFSRLKT 492

Query: 501 RTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIGSINV 560
           RTK+YY                   LK +         +L+LA+FRRLGGL+ +I S+N+
Sbjct: 493 RTKIYYQEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRLGGLENMINSLNL 552

Query: 561 DIKLDI 566
           D+  DI
Sbjct: 553 DVNFDI 558

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/542 (54%), Positives = 380/542 (70%), Gaps = 19/542 (3%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDDYNPDDGYEPVDVSDKXXXXXXXNPFPLEGK 83
           ++T+KR + + +S  KKR I V  ED+EDDYNP       D  +         PFPLEGK
Sbjct: 26  SSTSKRGRSNEDSVSKKRHINV-GEDDEDDYNPASAGLGDDDDNDDEEEA---PFPLEGK 81

Query: 84  YKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTR 143
           Y+D  DRD+LESLPEMERET+LFERSQ+M+KY++R LFRER R LK+Q+     +++K R
Sbjct: 82  YRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQR--ESSENRKVR 139

Query: 144 SSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXXXXXXX 203
           SS RS++ TGHSD+K+SKLSQLKKQRERK+    S + +E                    
Sbjct: 140 SSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDED---------EYEEEENIYE 190

Query: 204 XXYKENDD-DEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRIGRSFV 262
             Y+E  + ++E YDPY RKS YA+                 R++ V DFNKI+IGRSFV
Sbjct: 191 DKYEEGSEYEDESYDPYKRKSTYAEESEEEDVKWADDTD---RESNVNDFNKIKIGRSFV 247

Query: 263 AKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGV 322
           AKYCFYPGFN++++ CYGRVNVGV+K T    YRMVKIEKVFLQKPY+MG FFTNQYFGV
Sbjct: 248 AKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGV 307

Query: 323 TQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLT 382
           TQGKDRKVFQM FFSDG   + E+ERY++AL+SSN+  PS Y +  KFKE+ EF+++P+T
Sbjct: 308 TQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMT 367

Query: 383 EKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRM 442
            KLTDE+VRNRM+ NKKLSGTNAVLEKT+L++KL +AK+N +E DIAKYS QLRN EKR+
Sbjct: 368 VKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRL 427

Query: 443 AMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRT 502
             YEKHHENDQ   KKL  LTSKNRKLNM++I+  E++K++ D +FD K+DPFSRLKTRT
Sbjct: 428 MTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRLKTRT 487

Query: 503 KVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIGSINVDI 562
           KVYY                   ++ +         +L+LA+FRRLGGL+ I+ +++++I
Sbjct: 488 KVYYQEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNLDINI 547

Query: 563 KL 564
           KL
Sbjct: 548 KL 549

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/559 (55%), Positives = 381/559 (68%), Gaps = 34/559 (6%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDS--EDEEDDYNPDDGYEPVDVSDKX---------XXX 72
           TT+ KR K S N+  K+R+I V+   EDE++D + +D Y P  V  +             
Sbjct: 25  TTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEEDEE 84

Query: 73  XXXNPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK-QQ 131
              NPFPLEGKYKD  DR HLE LPEMERET+LFERSQ+M+KY +R+LFRERGRN+K QQ
Sbjct: 85  EEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKEQQ 144

Query: 132 KIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKS-KGRRSSDYEESDE---D 187
           K +   +  KTRSS R+T ATGHSD+KASKLSQL+KQRE+K  +  R  D+EE +E   D
Sbjct: 145 KNRQLREGNKTRSSARTTHATGHSDLKASKLSQLRKQREQKGHRANRDRDFEEEEEEEED 204

Query: 188 NYGXXXXXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDA 247
            Y                            PY RKS                     R+A
Sbjct: 205 RYEGSEYEDEDEEDYD--------------PYNRKS---HRDARKGRRSGMGRDQLDREA 247

Query: 248 EVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQK 307
           ++ DFNKI+IGRSFVAK+CFYPGFN++++G YGRVNVGVDKR+G   YRMVKIEKVF QK
Sbjct: 248 DITDFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQK 307

Query: 308 PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIK 367
           PYNMG FFTNQYFGVTQGKDRKVFQMNFFSDG F + E++RYL+ALD  +I KPS Y++ 
Sbjct: 308 PYNMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLD 367

Query: 368 TKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHD 427
            K KE++ F+SQPLT+KLTD+IVRNRM+ NKKLSG+NAVLEKT+LK+KLRYA+E GN+ D
Sbjct: 368 NKAKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRD 427

Query: 428 IAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVN 487
           IAKYS QLRN  KRM+ YEKHHE DQ+ IKKL  LTSKNRK+NM+RIRNAE IKK EDVN
Sbjct: 428 IAKYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKK-EDVN 486

Query: 488 FDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRR 547
           FD+KSDPFSRLKTRTKVYY                   L            +L+ ++F+R
Sbjct: 487 FDAKSDPFSRLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKR 546

Query: 548 LGGLQKIIGSINVDIKLDI 566
           LGGL+++IG + +    D+
Sbjct: 547 LGGLERVIGQMQLPFTFDV 565

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/551 (55%), Positives = 382/551 (69%), Gaps = 23/551 (4%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDD-----YNPD-DGYEPVDVSDKXXXXXXXNP 77
            ++ KR+  S  +  KKRRIEV+  ++++D     YNP   G    D  D+       NP
Sbjct: 25  ASSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEE--NP 82

Query: 78  FPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQA 135
           FPLEGKYKD ADRD+L  LPEMERET+LFERSQ+M+KYQ+RK+FR+RG+NLK  QQ+ + 
Sbjct: 83  FPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQ 142

Query: 136 GEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXX 195
            E+ +KTRSS RST ATGHSDIKASKLSQL+KQRE+KS+ R  SD EE  ED        
Sbjct: 143 QEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDYGYE 202

Query: 196 XXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKI 255
                      +        YDPY+R+S++ +                 R+A V DFNK 
Sbjct: 203 DKKYSDEEDEEE--------YDPYSRRSRFEEDEDEVQWAEEALD----REANVADFNKA 250

Query: 256 RIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFF 315
           +IGRSFVA +CFYPGFN++++G YGRVNVG DKR+G   YRMVKIEKVFLQKPYNMGKF 
Sbjct: 251 KIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFI 310

Query: 316 TNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISE 375
           TNQYFGVTQGKDRKVFQM +FSDG   +QEFERY+ AL+  +I  PS Y+++ K KEI+ 
Sbjct: 311 TNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINS 370

Query: 376 FISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQL 435
           F+SQPLTE+LT++IVRNRMV NKKLSG NAVLEKT+LK+KL+YA E  NE DIAKYS QL
Sbjct: 371 FVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQL 430

Query: 436 RNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPF 495
           R+FEKRM+ YEK HEND+  I KL  LT+KNR++N++R++NAE +KK ED +FDSKSDPF
Sbjct: 431 RSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKK-EDTSFDSKSDPF 489

Query: 496 SRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKII 555
           SRLKTRTK YY                   L+ D         +L+ A FRRLGGL+++I
Sbjct: 490 SRLKTRTKFYYQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVI 549

Query: 556 GSINVDIKLDI 566
           G+++    +DI
Sbjct: 550 GTVDFQFSIDI 560

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/551 (55%), Positives = 385/551 (69%), Gaps = 21/551 (3%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDD---YNPDDGYEPVDVSDKXXXXXXXNPFPL 80
           TT+ KR K       K+++IEVDSE EE++   YNP  G +      +       NPFPL
Sbjct: 26  TTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDDYNPYGGNQS-----EEEEIDEPNPFPL 80

Query: 81  EGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQ--KIQAGED 138
           E KYKD  DR+HLESLPEMERET+LFERSQVMRKYQERKLFRER RN+K+Q  + +  E+
Sbjct: 81  ENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNELEEE 140

Query: 139 SQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXX 198
            +KTRSS R+T ATGHSD+KASKLSQLKKQRERK+   R  DY + ++++          
Sbjct: 141 GKKTRSSTRATHATGHSDLKASKLSQLKKQRERKT---RDQDYNDVEDEDDLDDYAPDDN 197

Query: 199 -XXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRI 257
                    +E ++DEE Y+PYA +  Y                   R+AE+ DFNK+++
Sbjct: 198 YKHEDSEYEEEGEEDEEDYNPYATRKSY----DMDKDEVEWAEEQTDREAELDDFNKVKV 253

Query: 258 GRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTN 317
           GRSF+AKYCFYPGF++L++GCYGRVNVG D+RTG ++YRMVKIEKVFL+ PY MG FFTN
Sbjct: 254 GRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTN 313

Query: 318 QYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFI 377
           QY GVTQG DRKV QMN FSDG F   EF+RY +AL++S++ KPS + ++ K KEI  F+
Sbjct: 314 QYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFV 373

Query: 378 SQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRN 437
           S+PLT K+TD IVRNRM+ NKKLSGTNAVLEKT+LKDKLRYA+EN NE D+AKYS QLRN
Sbjct: 374 SEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRN 433

Query: 438 FEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSR 497
            EKRM++YEKHHENDQ  + KL  LTSKNRK+NM++IRNAE IKK ED   DSKSDPFSR
Sbjct: 434 LEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKK-EDHGLDSKSDPFSR 492

Query: 498 LKTRTKVYYX--XXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKII 555
           LKTRTK+YY                     L+ +         +L+LA F+RLGGL+ +I
Sbjct: 493 LKTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLI 552

Query: 556 GSINVDIKLDI 566
            ++++++  DI
Sbjct: 553 QNLDINVTFDI 563

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/557 (54%), Positives = 378/557 (67%), Gaps = 25/557 (4%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDE------------EDDYNPDDGYEPVDVSDKXXX 71
           +T +KR+K S  +  KKRRI   SE+E            EDDYNP +     D  D    
Sbjct: 26  STVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHE-VGNYDTGDDEAE 84

Query: 72  XXXXNPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQ 131
               NPFPL+GKYKD  DR++LESLPE+ERET+LF+RSQ MRKYQERKLFRER R     
Sbjct: 85  NEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKRQ---- 140

Query: 132 KIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGX 191
                ++++ TRSS R+  +TGHSD+KASKLSQLK+QR++K   +RS D  E DE+    
Sbjct: 141 -----QEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDEEEEEE 195

Query: 192 XXXXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQD 251
                           + D+DEE Y+P A KSKY +                 R +E+ D
Sbjct: 196 DDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAEDND-RVSELAD 254

Query: 252 FNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNM 311
           FNK+RIGRSFVAK+CFYPGFN+L+ GCYGRVNVGVDKR+G   YRMVKIEKVFLQKPYNM
Sbjct: 255 FNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNM 314

Query: 312 GKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFK 371
           GKF+TNQYFGVTQGKDRKVFQMNFFSDG F + E+ERYL++L+++NI +PS + +  K K
Sbjct: 315 GKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNKSK 374

Query: 372 EISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKY 431
           EI  FI++PLTEKLTDEIVRNRM+ NKKLSGTNAVLEKT+L+ KL+YA+E+ NE D+AKY
Sbjct: 375 EIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKY 434

Query: 432 SKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDV--NFD 489
           S QLRNFEKRM  YEKHHEND    KKL  LTSKNRK+NM + +N +  KKE+      D
Sbjct: 435 SAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTVD 494

Query: 490 SKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLG 549
           SKSDPFSRLKTRTK+YY                   ++ +         +L+LA+FRRLG
Sbjct: 495 SKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFRRLG 554

Query: 550 GLQKIIGSINVDIKLDI 566
           GL+ +I  INV+  +D+
Sbjct: 555 GLENMISKINVNFDIDL 571

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/493 (58%), Positives = 356/493 (72%), Gaps = 13/493 (2%)

Query: 76  NPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKI 133
           NPFPLEGKYKD  DR  LESLPEMERE++LFERSQ+M++YQER+  ++R +N++  QQK 
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 134 QAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXX 193
           Q  ++ ++ RSS R+TRATGHSD+K SKLS+LKKQR      ++S  Y+ S+++      
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQR-----AKKSGTYDYSEDEEGDGDD 207

Query: 194 XXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFN 253
                         + DD +     Y RK+++ +                 RD  + DFN
Sbjct: 208 HKYDDYYDEGGEDDDEDDYDP----YYRKNRHEEDDDDEEVKWAETEDFD-RDTGLADFN 262

Query: 254 KIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGK 313
           K++IGRSFVAK+CFYPGFNEL+Q  YGRVNVG+DK TG  AYRMVKIEKVFLQKPYNMGK
Sbjct: 263 KVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKPYNMGK 322

Query: 314 FFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEI 373
           FFTNQYFGVTQGKDRKVFQMNFFSDG   + E+ERYLK+L+   I KPS YN+  K KEI
Sbjct: 323 FFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNKSKEI 382

Query: 374 SEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSK 433
           SEF+SQP+T KLTD+IVRNRMV NKKLSGTNAVLEKT+LK+KL+YAKE  NE DIAKYS 
Sbjct: 383 SEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIAKYSS 442

Query: 434 QLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSD 493
           QL+N EKR++ YEKHHENDQA IKKL  LTSKNRKLN++RI++AE ++K +DVNFD+KSD
Sbjct: 443 QLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQK-DDVNFDAKSD 501

Query: 494 PFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQK 553
           PFSRLKTRTK+YY                   L+ D         +L+LA+FR LGGL++
Sbjct: 502 PFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSLGGLEE 561

Query: 554 IIGSINVDIKLDI 566
           IIG I++ I +++
Sbjct: 562 IIGGIDLQINVNL 574

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/468 (58%), Positives = 348/468 (74%), Gaps = 9/468 (1%)

Query: 99  MERETILFERSQVMRKYQERKLFRERGRNLKQQKIQ--AGEDSQKTRSSNRSTRATGHSD 156
           MERET+LFERSQ+M+KYQ+RKLFRER RNLK+Q+    + ++ +KTR+S RST+ATGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 157 IKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXXXXXXXXXXXYKENDDDEEGY 216
           +KASKLSQLK+QRE K+K R+ S+ E   E+                   ++++++ +  
Sbjct: 61  VKASKLSQLKRQRE-KNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYD-- 117

Query: 217 DPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQ 276
            PY+RK +Y                   R+++V DFNKI+IGRSFVA+YCF+P FNE+++
Sbjct: 118 -PYSRKPRY--REEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVK 174

Query: 277 GCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFF 336
           GCYGRVNVGVD+RT   AYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFF
Sbjct: 175 GCYGRVNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFF 234

Query: 337 SDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVL 396
           SDGP   +EF+RY ++LD+SN  KPS Y++  K KEI+EF+S+P+T+KLTDEIVRNRMV 
Sbjct: 235 SDGPITIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVF 294

Query: 397 NKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADI 456
           NKKLSGTNAVLEKT+L+ KL+YAKEN NE DIAKYS QLRN EKR++ YEKHHENDQA  
Sbjct: 295 NKKLSGTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGA 354

Query: 457 KKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTKVYYXXXXXXXXXX 516
           +KL  LTSKNRK+NM++ +N E + KEED+NFDSK+DPFSRLKTRTK+YY          
Sbjct: 355 RKLGALTSKNRKVNMDKAKNVEHV-KEEDINFDSKADPFSRLKTRTKIYYQEVQKEENEK 413

Query: 517 XXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIGSINVDIKL 564
                    L+ D         +L+LA+FRRLGGL+ II SI++++ +
Sbjct: 414 AKELAQQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/563 (50%), Positives = 375/563 (66%), Gaps = 48/563 (8%)

Query: 24  TTTNKRTKGSSNSQVKKRRIEVDSEDEEDD--------------YNP------DDGYEPV 63
            T+ KR+K  S+   K+R ++ +S D+ED+              YNP      D+G+   
Sbjct: 26  VTSQKRSKHDSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGH--- 82

Query: 64  DVSDKXXXXXXXNPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRE 123
                       NP+PL GKY+D ADR+H+E++PEMERET+LFERSQ M+KYQERK+ RE
Sbjct: 83  --EASEDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRE 140

Query: 124 RGRNLK-QQKIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYE 182
           R +N++ QQ+ +  +D    RSS RSTR TGHSD++ SKLS+L+KQR +KS    + DY 
Sbjct: 141 RAKNIRAQQQRRQQKDGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKKSG---NYDYS 197

Query: 183 ESDEDNYGXXXXXXXXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXX 242
             ++D+                 Y ++D+ E+ YDP+  +  Y +               
Sbjct: 198 AGEDDS------------DHSDDYVDSDN-EDDYDPHDGRQLYREEADEVKWAEDDLD-- 242

Query: 243 XXRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEK 302
             RDAE+ DFNKI++GRSFVAK+CFYP FN+ +QGCYGRVN+GVDK TG A YRMVKIEK
Sbjct: 243 --RDAELDDFNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEK 300

Query: 303 VFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPS 362
           VFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGP ++ E+ERYL  +   +I KPS
Sbjct: 301 VFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPS 360

Query: 363 PYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKEN 422
            Y +  K K+++ F+SQP+T KLTD+IVRNRM  NKKL+GTNAVLEKT+L+DKL+YA++ 
Sbjct: 361 LYTLNNKAKDLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDT 420

Query: 423 GNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKK 482
            NE DIAKYS QL+N EKRM+ YEKHHENDQ  I+KL+ LTSKNRK+N+++IR+ E++KK
Sbjct: 421 NNEKDIAKYSSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKK 480

Query: 483 EEDVNFDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLML 542
           E+    + K+DPFSRLKTRTK+YY                    +           Q +L
Sbjct: 481 EDSATLNVKTDPFSRLKTRTKIYYQEIQQEENEKAQELAKQKQQQ--DKEEKHDRKQQLL 538

Query: 543 AEFRRLGGLQKIIGSINVDIKLD 565
           A+FRRLGGL+  +  ++  IKLD
Sbjct: 539 AKFRRLGGLEDALSKLDFRIKLD 561

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/517 (53%), Positives = 354/517 (68%), Gaps = 23/517 (4%)

Query: 51  EDDYNPDDGYEPVDVSD-KXXXXXXXNPFPLEGKYKDTADRDHLESLPEMERETILFERS 109
           EDDYNP   Y+     D         NP+PLEGKYKD  DR+ ++ +PEMERET+LFERS
Sbjct: 64  EDDYNPGTQYDFEGNDDGSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERS 123

Query: 110 QVMRKYQERKLFRERGRNLKQQKIQAGEDSQKT-RSSNRSTRATGHSDIKASKLSQLKKQ 168
           Q M+KYQERK+ R+R ++++ Q+ Q       T RSS RSTR TGHS+++ SKLS+L+KQ
Sbjct: 124 QEMQKYQERKVLRQRAKSIRAQQQQRQLQKDSTKRSSGRSTRTTGHSELRTSKLSELRKQ 183

Query: 169 RERKSKGRRSSDYEESDEDNYGXXXXXXXXXXXXXXXYKENDDDEEGYDPY-ARKSKYAQ 227
           R +KS    + DY ES+ED                  Y E+D+D+  YDP+   K  ++ 
Sbjct: 184 RAKKSG---NYDYSESEED-----------ESDQSDNYAESDNDD--YDPHHGHKDGFSD 227

Query: 228 XXXXXXXXXXXXXXXXXRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVD 287
                            RDAE++DFNK++IGRSFVAK+CFYP F E +Q CYGRVN+G+D
Sbjct: 228 HDNEVKWAEEDLD----RDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLD 283

Query: 288 KRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFE 347
           K TG   YRMVKIE+VFLQKPY+MGKFFTNQYFGVTQGKDRKVFQMN+FSDGP  + EFE
Sbjct: 284 KHTGLPMYRMVKIERVFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFE 343

Query: 348 RYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVL 407
           RYL  +   ++ KPS Y +  K KE+  F+SQP+T KLTD+IVRNRMV NKKL+GTNAVL
Sbjct: 344 RYLNQMAKYDMNKPSLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVL 403

Query: 408 EKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNR 467
           EK++LKDKL+YAK+  NE  +AKY+ QL+N EKRM+ YEKHHENDQ  I+KL  LTSKNR
Sbjct: 404 EKSVLKDKLQYAKDTNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNR 463

Query: 468 KLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLK 527
           K+NM++IR AE+++KE+  N D+KSDPFSRLKTRTK+YY                    +
Sbjct: 464 KVNMDKIRLAENVRKEDSSNVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQE 523

Query: 528 IDXXXXXXXXXQLMLAEFRRLGGLQKIIGSINVDIKL 564
            D         QL+LA+FRRLGGL++I+ SI   I+L
Sbjct: 524 QDKETQENKERQLLLAKFRRLGGLEEIVSSIPFKIEL 560

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  514 bits (1325), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 350/496 (70%), Gaps = 23/496 (4%)

Query: 76  NPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKI 133
           NPFPLEGKYK+  DR +LESLPEMERET+LFERSQ M+KYQER++ +ER +N++  QQK 
Sbjct: 84  NPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKR 143

Query: 134 QAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXX 193
           Q  ++ +KTRSS RSTR TGHSD+K S+LS+LKKQR +K KG             Y    
Sbjct: 144 QLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKK-KG------------TYEYSE 190

Query: 194 XXXXXXXXXXXXY---KENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQ 250
                       Y    + D+ E+ Y+P  +K K                    R+ E+ 
Sbjct: 191 EEEEEGQNEEDEYGYQDQEDESEDDYEPMYKKGK----TEDEEELKWAEDEDLDREPELG 246

Query: 251 DFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYN 310
           DFN+I+IGRSFVAK+CFYP FN++I+GCYGRVNVGVDKR+G   YRMVKIEKVFLQKPYN
Sbjct: 247 DFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYN 306

Query: 311 MGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKF 370
           MGKFFTNQYFGVTQGK+RKVFQMNFFSDG   + EFERYL++L++S I KPS Y I  K 
Sbjct: 307 MGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKS 366

Query: 371 KEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAK 430
            EI+ F+SQP+T KLTDE+VRNRM+ NKKLSGTNAVLEKTILKDKL+YAKE+G+E D+AK
Sbjct: 367 NEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAK 426

Query: 431 YSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDS 490
           YS QLRN EKR++ YEKHHENDQA  KKL  LTSKNR++N+++ +N E + K+ED  FD+
Sbjct: 427 YSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVE-VTKKEDTPFDA 485

Query: 491 KSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGG 550
           K+DPFSRLKTRTK+YY                   L+ D         +L+LA+F+ LGG
Sbjct: 486 KTDPFSRLKTRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGG 545

Query: 551 LQKIIGSINVDIKLDI 566
           L+ II +++  + LD+
Sbjct: 546 LEDIISNMDFQVSLDV 561

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 290/550 (52%), Positives = 373/550 (67%), Gaps = 21/550 (3%)

Query: 26  TNKRTKGSSNSQVKKRRIEVDSEDEEDD-----YNPDDGY--EPVDVSDKXXXXXXXNPF 78
           + KR++ S N+  K+R ++ D E +EDD     YNP+ G   +     D+       NPF
Sbjct: 30  SKKRSRSSQNASNKRRIVDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEEDEEEEENPF 89

Query: 79  PLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQAG 136
           PLEGKYKD  DR++LESLPEMERET+LF+RSQ M+KY+ER++ +ER RN++  QQK Q  
Sbjct: 90  PLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKRQLQ 149

Query: 137 EDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXXX 196
           ++S KTRSS RSTR TGHSD+K S+LS+LKKQR +KS    + DY E ++          
Sbjct: 150 QESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKSG---TYDYSEDED-----DGGRD 201

Query: 197 XXXXXXXXXYKENDDDEEGYDPYARKSKYAQXXXXXXXXXXXXXXXXXRDAEVQDFNKIR 256
                      E ++ E+ Y P  +K K  +                 RD E+ DFNK++
Sbjct: 202 EEDDYGYDDQDEEEESEDDYQPGYKKDKIDEDDEEVKWAEEDDLD---RDPELSDFNKVK 258

Query: 257 IGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFT 316
           IGRSFVAK+CFYP FN+LI+GCYGRVNVGVDKR     YRMVKIE+VFLQKPYNMGKFFT
Sbjct: 259 IGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFT 318

Query: 317 NQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEF 376
           NQYFGVTQGKDRKVFQMNFFSDG   + EFERY+K+LD+S I  PS Y +  K  EI+ F
Sbjct: 319 NQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGF 378

Query: 377 ISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLR 436
           +SQP+T KLTDE+VRNRM+ NKKLSGTNAVLEKTIL+DKL+YAKE G+E D+AKYS QLR
Sbjct: 379 VSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLR 438

Query: 437 NFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFS 496
           + E+R+  YEKHHENDQA  KKL  LTS+NR+ NM++ +N ++ KK ED  FD+K+DPFS
Sbjct: 439 SLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKK-EDTPFDAKTDPFS 497

Query: 497 RLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAEFRRLGGLQKIIG 556
           RLKTRTK+YY                   L+           +L+LA F+ LGGL++++ 
Sbjct: 498 RLKTRTKIYYQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVS 557

Query: 557 SINVDIKLDI 566
            I+  + +++
Sbjct: 558 GIDFKLSIEV 567

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 257/504 (50%), Positives = 323/504 (64%), Gaps = 26/504 (5%)

Query: 76  NPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQA 135
           NPFPLEGKYKD  DR+ +ES+PEMERET+LFERSQ+M+KYQERK+FRER R        +
Sbjct: 80  NPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSRKQMSLNNNS 139

Query: 136 GEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGXXXXX 195
               QKTR+S R T  TG SD K+SKLSQLK+QRER++KG          + NY      
Sbjct: 140 NLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKG----------QSNYSDEDEY 189

Query: 196 XXXXXXX-XXXYKENDDDEEGYDP----------YARKSKYAQX-XXXXXXXXXXXXXXX 243
                      YK +  D +  +           Y  K+KY                   
Sbjct: 190 EDEYEDDLEQEYKSSGSDYDENEAAEEEEDDYDLYGSKTKYNHRGSEEDDDDDVKWAEDI 249

Query: 244 XRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKV 303
            R++ VQDFNKI+IGRSF  K+CFYP FN++++ CY +VNV  D+      YRMVKIEKV
Sbjct: 250 DRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKV 307

Query: 304 FLQK-PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPS 362
           FL K P++MGKFFTNQ FGVTQG +RKV+ M +FSD P    EF+RY++ L+  +I +PS
Sbjct: 308 FLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPS 367

Query: 363 PYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKEN 422
            Y I  KFKEI+ F ++PLT+KLTD+IVRNRM  NKKLSGTNAVLEKT+L+ KL++AKE 
Sbjct: 368 VYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKET 427

Query: 423 GNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKK 482
           GNE D+ KYS QLRN EKR+++YEKHHENDQ   KKL  LTS+NRKLNM++ RN E  KK
Sbjct: 428 GNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KK 486

Query: 483 EEDVNFDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLML 542
            E   FD+K+DPFSRLKTRTK+YY                   L+ D         + +L
Sbjct: 487 VELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLL 546

Query: 543 AEFRRLGGLQKIIGSINVDIKLDI 566
           AEF+ LGGL+K++GS+N     DI
Sbjct: 547 AEFKCLGGLEKMVGSLNFKFDFDI 570

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  445 bits (1145), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/322 (64%), Positives = 257/322 (79%), Gaps = 2/322 (0%)

Query: 245 RDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVF 304
           RD E+ DFNK+RIGRSFVAK+CFYP F E+++GCYGRVNVGVDKRTG  +YRMVKIE++F
Sbjct: 236 RDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIF 295

Query: 305 LQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPY 364
           LQKPY+MGKFFTNQYFGVTQGKDRKVFQM+FFSDG    QE+ERY+++L+SS+IPKP+ Y
Sbjct: 296 LQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVY 355

Query: 365 NIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGN 424
            +K+K KE+  F+S+PLTEKLT+EIVRNRMV NKKLSGTNAVLEKT+LK+KL+YA+E  N
Sbjct: 356 TLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNN 415

Query: 425 EHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEE 484
           E D+AKYS QLRNFEKRM MYEKHHENDQ   KKL  LTSKN+K+NM+++RNAE +KK E
Sbjct: 416 ERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKK-E 474

Query: 485 DVNFDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLAE 544
           D+  D KSDPFSRLKTRTK+YY                   ++ +         +L+LA+
Sbjct: 475 DLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQ 533

Query: 545 FRRLGGLQKIIGSINVDIKLDI 566
           FRRLGGL+K+I  +N++  L I
Sbjct: 534 FRRLGGLEKMISGLNIEFDLGI 555

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/323 (59%), Positives = 254/323 (78%), Gaps = 2/323 (0%)

Query: 245 RDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVF 304
           R++ + D+NKI+IGRSFVAK+CFYP FN++++GCYGRVN+G DK TGN+ YRMVKIE+VF
Sbjct: 261 RESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVF 320

Query: 305 LQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPY 364
           LQKPYNMGKFFTNQYFGVTQGKDRK+FQM++FSD P  + E+ERYL +L+  +I +PSPY
Sbjct: 321 LQKPYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPY 380

Query: 365 NIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGN 424
            +  K K ++EF+ +PLT KL D+IVRNRMV NKKLSGTNAV+EK +LK+KL+++K++G+
Sbjct: 381 ILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGD 440

Query: 425 EHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEE 484
               +KY+ QL+  EKR++ YEKHHENDQ DIK L  LTSKNRKLN++RIR+AE+IK+EE
Sbjct: 441 IESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREE 500

Query: 485 DVN-FDSKSDPFSRLKTRTKVYYXXXXXXXXXXXXXXXXXXXLKIDXXXXXXXXXQLMLA 543
            VN  D+KSDPFSRLKTRTK+YY                   L++D         +L+LA
Sbjct: 501 GVNKVDAKSDPFSRLKTRTKIYY-QEIQQEENEKAREEAKRQLEVDQEAEEQKKKELLLA 559

Query: 544 EFRRLGGLQKIIGSINVDIKLDI 566
           +FRRLGGL++IIGS+++ + +DI
Sbjct: 560 KFRRLGGLEEIIGSLDLKLHIDI 582

>Kwal_27.10077 s27 complement(182973..184769) [1797 bp, 598 aa] {ON}
           YJR052W (RAD7) - nucleotide excision NEF4 component
           [contig 42] FULL
          Length = 598

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 26/177 (14%)

Query: 267 FYPGFNEL-IQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQG 325
           F P  ++L +Q C G++N   ++     A ++  +++V+L  P+ + +F  + +F + +G
Sbjct: 287 FAPNLSKLSLQMC-GQLN---NEALLYIAEKLPHLKEVYLDGPFLINEFTWDAFFTIMKG 342

Query: 326 KDRKVFQMNFFSDGPFVEQEFERYLK-------ALDSSNIPKPSPYNIKTKFKEISEFIS 378
           K R     N      F  Q     L+       +L  S +   S YN+ ++  +  +F S
Sbjct: 343 KLRAFHVSNTHR---FTNQSLTSLLENCGESLVSLKLSRLDDVSDYNLLSQHLKNPQFES 399

Query: 379 QPL-----TEKLTDEIVRNRMVL------NKKLSGTNAVLEKTILKDKLRYAKENGN 424
             L      E +TDE V   + L      +  L+G  A+ +  ++  K   A ENG+
Sbjct: 400 LSLEYPSKEELITDETVTATIKLVGSTLKHMSLNGCIALTDAFLINAKDALASENGS 456

>SAKL0E02618g Chr5 complement(210003..210824) [822 bp, 273 aa] {ON}
           similar to uniprot|P28320 Saccharomyces cerevisiae
           YKL095W YJU2 Essential nuclear protein putative
           spliceosomal component involved in mRNA splicing based
           on computational analysis of large-scale protein-protein
           interaction data
          Length = 273

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 15/67 (22%)

Query: 421 ENGNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESI 480
           ENG E D      +L   EKR+A +++  E+D+    KLE L    RK N+++++ AE +
Sbjct: 147 ENGQEED------KLAELEKRLAKFQQEQEDDE----KLEQL----RKYNVDKMKRAEEL 192

Query: 481 -KKEEDV 486
            KK+ED+
Sbjct: 193 FKKDEDL 199

>KLTH0C07502g Chr3 complement(647606..648883) [1278 bp, 425 aa] {ON}
           conserved hypothetical protein
          Length = 425

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 49/124 (39%), Gaps = 12/124 (9%)

Query: 350 LKALDSSNIPKPSPYNIKTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEK 409
           ++    S + K  PYN   K  +  +    P+T         NR+ LN+   G  A+  K
Sbjct: 161 VRGFPGSKLRKLDPYNAGYKIVDCGDV---PMTPY------DNRIALNQLYRGQRAIYNK 211

Query: 410 TILKDKLRYAK--ENGNEHDIAKYS-KQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKN 466
           T LK  L+  K    G +H +   + K        +A+       D  D K L G  +K 
Sbjct: 212 TTLKSDLKAPKVITLGGDHTVTLMALKAASEHNGPLAVVHFDSHIDTWDPKVLGGGITKT 271

Query: 467 RKLN 470
           + +N
Sbjct: 272 QSIN 275

>SAKL0E02684g Chr5 complement(214237..215058) [822 bp, 273 aa] {ON}
           similar to uniprot|P28320 Saccharomyces cerevisiae
           YKL095W YJU2 Essential nuclear protein putative
           spliceosomal component involved in mRNA splicing based
           on computational analysis of large-scale protein-protein
           interaction data
          Length = 273

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 15/67 (22%)

Query: 421 ENGNEHDIAKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESI 480
           ENG E D      +L   EKR+A +++  E+D+    KLE L    RK N+++++ AE +
Sbjct: 147 ENGQEED------KLAELEKRLAKFQQEQEDDE----KLEQL----RKHNVDKMKRAEEL 192

Query: 481 -KKEEDV 486
            KK+ED+
Sbjct: 193 FKKDEDL 199

>Ecym_1299 Chr1 complement(606595..607713) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii AAL015W
          Length = 372

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%)

Query: 367 KTKFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEH 426
           + KFK IS F    L  K    +V+ R   N  L     V ++ IL+DK++    +  + 
Sbjct: 33  EVKFKAISTFSDVVLCSKNRTWVVKQRNHSNTVLLMNEFVPQEVILEDKIKTFGLSRPQG 92

Query: 427 DIAKYSKQLRNFEKRMA 443
           D   YSKQL   E  + 
Sbjct: 93  DWLGYSKQLCELEPTLV 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,330,513
Number of extensions: 2445140
Number of successful extensions: 14341
Number of sequences better than 10.0: 256
Number of HSP's gapped: 14763
Number of HSP's successfully gapped: 262
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)