Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06721g5.712ON1081108154010.0
TDEL0B020805.712ON1025110221480.0
SAKL0E15136g5.712ON1037111618620.0
KLTH0E00814g5.712ON97486117500.0
ZYRO0B16544g5.712ON104491617030.0
Kwal_55.196455.712ON97084816470.0
KLLA0A00396g5.712ON101288216400.0
NCAS0G001705.712ON103046314690.0
NDAI0F002005.712ON110546614490.0
KNAG0L022005.712ON116152013351e-165
Kpol_2001.785.712ON40342212621e-164
Suva_9.305.712ON106248313001e-160
TBLA0E017605.712ON121250213071e-160
YIL156W (UBP7)5.712ON107149212951e-160
TPHA0D046605.712ON104545912861e-159
Skud_9.125.712ON106448512831e-158
Smik_9.135.712ON106048412661e-156
Ecym_40095.712ON151745112771e-153
AFR296C5.712ON116945512071e-146
Skud_11.3385.712ON71245811241e-139
Smik_11.3625.712ON72145111101e-137
YKR098C (UBP11)5.712ON71745610941e-134
Suva_11.3355.712ON72445310821e-133
KAFR0D021605.712ON84646710041e-120
KAFR0H001505.712ON6564689491e-114
CAGL0G02563gsingletonON6314728721e-103
Kpol_304.65.712ON5622985678e-62
Ecym_61848.188ON8515013104e-28
TBLA0F036108.188ON11442952963e-26
TDEL0B042208.188ON8252502926e-26
YER144C (UBP5)8.188ON8052772901e-25
TPHA0C027708.188ON9703052864e-25
AFR007W8.188ON8484182847e-25
KNAG0D019308.188ON9862422802e-24
Kpol_1032.288.188ON8822422775e-24
KAFR0C025908.188ON9782512775e-24
NDAI0C059008.188ON8265442741e-23
Smik_5.3098.188ON8052412722e-23
KLLA0E10275g8.188ON7962772693e-23
Smik_4.3078.188ON9292562686e-23
CAGL0G05247g8.188ON9472562651e-22
Skud_4.3238.188ON9262562641e-22
Suva_5.2728.188ON7882842642e-22
ZYRO0G06798g8.188ON8772412632e-22
YDR069C (DOA4)8.188ON9262362623e-22
KLTH0H07678g8.188ON8612612604e-22
Suva_2.2288.188ON9272362596e-22
Skud_5.2818.188ON8232542561e-21
NCAS0B042808.188ON9222392552e-21
Kwal_14.20088.188ON4242622473e-21
NDAI0A036808.188ON11162512543e-21
CAGL0I06765g8.188ON8872692525e-21
SAKL0H18986g8.188ON8932652499e-21
NCAS0A039108.188ON7952422032e-15
KNAG0G015908.188ON6712891801e-12
KLTH0F03674g1.137ON11982031667e-11
ZYRO0C17908g1.137ON12042031668e-11
CAGL0L01639g1.137ON11472081659e-11
TDEL0C056401.137ON11782001579e-10
AFR627C1.137ON12871921561e-09
NDAI0F034102.69ON8704901505e-09
Kwal_33.136281.137ON11602171515e-09
TPHA0A025401.137ON12862081471e-08
YJL197W (UBP12)1.137ON12542011471e-08
Kpol_2001.541.137ON12231961462e-08
KAFR0F015601.137ON11712121462e-08
Ecym_81401.137ON12641951452e-08
SAKL0C04246g1.137ON12971571452e-08
TBLA0J006001.137ON14622161443e-08
Smik_10.371.137ON12472051434e-08
Skud_10.221.137ON12552011434e-08
Smik_2.497.390ON7451381415e-08
KNAG0C021801.137ON12311991408e-08
KLLA0C03476g1.137ON12522031401e-07
Suva_6.2761.137ON12562031391e-07
NCAS0C021108.540ON4943981362e-07
TPHA0P006807.390ON7271441372e-07
KNAG0F012202.69ON7844621372e-07
NDAI0B004801.137ON12531961362e-07
ZYRO0B03300g7.390ON8131291353e-07
Suva_2.507.390ON7501381353e-07
KNAG0C035807.390ON7761391343e-07
Skud_2.387.390ON7481361335e-07
CAGL0J11352g2.69ON7715031335e-07
NCAS0I031401.137ON12012121335e-07
KNAG0G029308.742ON4592721325e-07
TPHA0G005608.742ON4632571317e-07
TPHA0L022905.18ON11931071328e-07
KNAG0B023707.390ON7531301319e-07
Kpol_1024.448.540ON4963111309e-07
TBLA0B097602.69ON8982951301e-06
YBL067C (UBP13)7.390ON7471361291e-06
KLLA0C06974g8.742ON4462351263e-06
TBLA0D010708.742ON4832551263e-06
Smik_5.3188.202ON9093951264e-06
TPHA0O016402.69ON7464671254e-06
KLLA0D08459g2.69ON7501541245e-06
YER151C (UBP3)8.202ON9123891246e-06
CAGL0H05335g8.540ON4834871228e-06
NCAS0D023905.18ON12111061239e-06
Ecym_46857.390ON7781301221e-05
KAFR0A069102.307ON6783901211e-05
NCAS0E026107.390ON7171291211e-05
CAGL0A04477g7.390ON7701271202e-05
TBLA0C070205.18ON12471061192e-05
Kpol_1044.242.69ON7244601183e-05
SAKL0E13002g2.69ON7394351183e-05
CAGL0I05522g7.390ON7241271165e-05
KNAG0A019708.540ON4711621155e-05
ABL145W2.69ON7491321165e-05
NCAS0A143707.390ON7291301166e-05
NDAI0A016707.390ON8461291158e-05
Ecym_11668.540ON6964321149e-05
KAFR0A075802.69ON8021571131e-04
NCAS0D006001.369ON4931171121e-04
Kpol_513.255.18ON11901061122e-04
TDEL0G004105.18ON11861061122e-04
KAFR0L017307.390ON7011411112e-04
Kwal_34.162681.369ON4491311102e-04
NDAI0E041807.390ON8271291112e-04
KNAG0A054502.307ON7643081102e-04
Kpol_534.231.369ON4961151093e-04
KNAG0E012905.18ON11961071103e-04
TBLA0H036008.540ON4824001093e-04
KAFR0I026005.18ON12131131103e-04
ZYRO0D07062g5.18ON11931061094e-04
NDAI0I025305.18ON11971061085e-04
TDEL0C015707.390ON7651301085e-04
NDAI0C059508.202ON10801601085e-04
KAFR0A042108.742ON4402591066e-04
ZYRO0F01276g3.270ON7761941076e-04
Skud_5.2898.202ON9103961077e-04
TPHA0E008707.390ON7151001067e-04
CAGL0K10494g1.369ON495291067e-04
Suva_13.4955.18ON12301111077e-04
ZYRO0A05962g8.742ON4651591050.001
Klac_YGOB_Anc_5.18b5.18ON11661061060.001
SAKL0H00418g5.18ON11901061060.001
CAGL0M11198g8.742ON4611751040.001
NCAS0G018002.69ON8751571050.001
KNAG0C019401.369ON4991031040.001
Kwal_33.144302.69ON511971040.001
TBLA0C012001.369ON5031091040.001
YMR304W (UBP15)5.18ON12301121050.001
TPHA0A025101.369ON5051181040.001
Skud_13.4785.18ON12311131040.001
Smik_13.5215.18ON12311131040.001
CAGL0M13783g5.18ON11961041040.002
Ecym_27171.369ON4831381020.002
Ecym_56715.18ON11761061020.003
KLTH0B09944g5.18ON11891061020.003
TDEL0A011002.69ON6611341010.003
Kpol_1045.417.390ON7121231010.003
Smik_13.4318.742ON4711371000.003
Kwal_26.91518.742ON4541301000.003
KAFR0B023708.202ON8293891000.004
AEL242W8.540ON613881000.004
SAKL0H04994g8.742ON454132990.004
NCAS0B061302.307ON770278980.006
AGL357W5.18ON1166106980.007
Suva_13.4078.742ON471137970.008
KLLA0A10791g1.369ON484109970.008
TDEL0B036708.742ON463139970.009
NCAS0I016203.270ON795256970.009
YER098W (UBP9)7.390ON754129970.009
KAFR0C004103.270ON769235970.010
NDAI0E008108.742ON493113960.011
NDAI0H035501.369ON502126960.012
NCAS0B005808.742ON466130950.012
KLTH0D12760g8.742ON453132950.013
Skud_13.3928.742ON473139950.014
Smik_7.3141.369ON499130950.015
Ecym_55448.202ON834166950.016
Kwal_26.95985.18ON1191114950.017
NCAS0A038408.202ON917387950.017
YFR010W (UBP6)1.369ON49930940.018
ZYRO0D03982g8.540ON82181940.020
AGR139C8.202ON789162940.024
YMR223W (UBP8)8.742ON471137930.025
Smik_5.2447.390ON749127930.026
Kpol_219.1singletonON24976910.027
KLLA0E20351g7.390ON697137920.031
Ecym_62488.742ON466108920.034
Skud_6.941.369ON49934920.034
Suva_6.831.369ON50034920.034
YOR124C (UBP2)5.443ON127253930.034
KLTH0H07370g8.202ON781137920.035
Skud_15.2865.443ON127879920.037
Skud_16.2098.540ON503512910.040
TBLA0B019308.202ON1019159920.042
Suva_4.2953.270ON782200910.044
Kpol_1018.937.390ON755145910.046
TDEL0B030608.540ON734245910.046
SAKL0D10120g1.369ON492109900.048
KLLA0E23387g8.540ON78286910.050
TPHA0E017105.443ON1283111910.052
TBLA0D006207.390ON1171129910.058
ZYRO0G01188g1.369ON500117890.066
Kpol_1064.488.742ON466144890.076
Suva_5.2177.390ON754129890.080
ZYRO0B11044g8.202ON826156890.083
KLLA0E02377g5.443ON122067890.092
Suva_8.1765.443ON127058880.10
CAGL0K10252g5.443ON126750880.11
KNAG0B041905.443ON126230880.12
ZYRO0A02420g2.307ON74526870.12
AEL029W1.369ON446110870.13
Smik_16.1638.540ON501427870.13
Smik_15.3015.443ON127253870.14
KAFR0E009308.540ON49877870.14
ZYRO0C09812g2.69ON702211870.14
KAFR0K018107.390ON714131870.15
TDEL0A016208.202ON795159860.16
YPL072W (UBP16)8.540ON499101860.17
Skud_5.2237.390ON748129860.17
Kwal_55.213935.443ON123330860.17
SAKL0H18656g8.202ON772164860.20
KAFR0C045201.369ON49930850.20
TDEL0D024001.369ON49429850.21
AGR370W7.390ON740181850.21
ZYRO0G01606g5.443ON130526860.21
KLTH0H13354g1.369ON49526850.22
SAKL0G02728g5.443ON123727850.23
KNAG0J008003.270ON765115850.23
Kpol_1016.15.443ON125131850.24
NDAI0C015505.443ON129574850.24
SAKL0F12430g7.390ON754196850.25
TBLA0A064705.443ON132039850.26
KLTH0F15862g5.443ON124138850.29
TBLA0E025703.270ON785119840.29
Ecym_45145.443ON1246100840.31
Kpol_1062.235.443ON126627840.35
CAGL0I06600g8.202ON816159840.35
YDL122W (UBP1)2.307ON80939840.35
KAFR0D050705.443ON122746840.36
NCAS0H021005.443ON126964840.37
Smik_4.1152.307ON79051830.47
ACL164C5.443ON138931830.48
CAGL0H10186g3.270ON778230820.48
NDAI0E028208.540ON49578820.51
Skud_4.1332.307ON78739820.58
TDEL0D025805.443ON127226820.63
Suva_16.2408.540ON523437800.75
TBLA0F012303.367ON1189132810.76
SAKL0H10076g8.540ON76781800.86
KLTH0E12540g8.540ON75268800.87
AGR389C2.307ON77526800.96
Kwal_14.19578.202ON444142790.99
NDAI0B034302.307ON85630801.1
TBLA0B060802.307ON82426791.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06721g
         (1081 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...  2085   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   832   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   721   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   678   0.0  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   660   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   639   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   636   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     570   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     562   0.0  
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   518   e-165
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   490   e-164
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   505   e-160
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   508   e-160
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   503   e-160
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   499   e-159
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   498   e-158
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   492   e-156
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   496   e-153
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   469   e-146
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   437   e-139
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   432   e-137
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   426   e-134
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   421   e-133
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   391   e-120
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   370   e-114
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   340   e-103
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   223   8e-62
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   124   4e-28
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   118   3e-26
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   117   6e-26
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   116   1e-25
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   114   4e-25
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   114   7e-25
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   112   2e-24
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   111   5e-24
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   111   5e-24
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   110   1e-23
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   109   2e-23
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   108   3e-23
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   107   6e-23
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   106   1e-22
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   106   1e-22
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   106   2e-22
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   105   2e-22
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   105   3e-22
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   104   4e-22
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   104   6e-22
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   103   1e-21
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    102   2e-21
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   100   3e-21
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             102   3e-21
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   101   5e-21
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   100   9e-21
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     83   2e-15
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    74   1e-12
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    69   7e-11
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    69   8e-11
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    68   9e-11
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    65   9e-10
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    65   1e-09
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    62   5e-09
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    63   5e-09
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    61   1e-08
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    61   1e-08
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    61   2e-08
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    61   2e-08
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    60   2e-08
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    60   2e-08
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    60   3e-08
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    60   4e-08
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    60   4e-08
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    59   5e-08
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    59   8e-08
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    59   1e-07
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    58   1e-07
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    57   2e-07
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    57   2e-07
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    57   2e-07
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    57   2e-07
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    57   3e-07
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    57   3e-07
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    56   3e-07
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    56   5e-07
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    56   5e-07
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    56   5e-07
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    55   5e-07
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    55   7e-07
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    55   8e-07
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    55   9e-07
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    55   9e-07
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    55   1e-06
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    54   1e-06
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    53   3e-06
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    53   3e-06
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    53   4e-06
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    53   4e-06
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    52   5e-06
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    52   6e-06
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    52   8e-06
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    52   9e-06
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    52   1e-05
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    51   1e-05
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    51   1e-05
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    51   2e-05
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    50   2e-05
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    50   3e-05
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    50   3e-05
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    49   5e-05
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    49   5e-05
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    49   5e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    49   6e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    49   8e-05
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    49   9e-05
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    48   1e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    48   1e-04
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    48   2e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    48   2e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    47   2e-04
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    47   2e-04
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    47   2e-04
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    47   2e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   3e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    47   3e-04
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    47   3e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    47   3e-04
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    47   4e-04
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    46   5e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    46   5e-04
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    46   5e-04
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    45   6e-04
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    46   6e-04
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    46   7e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    45   7e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   7e-04
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    46   7e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    45   0.001
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    45   0.001
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    45   0.001
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    45   0.001
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      45   0.001
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   0.001
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    45   0.001
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    45   0.001
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    45   0.001
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    45   0.001
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    45   0.001
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    45   0.001
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    45   0.002
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    44   0.002
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    44   0.003
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    44   0.003
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    44   0.003
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    44   0.003
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    43   0.003
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    43   0.003
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    43   0.004
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    43   0.004
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    43   0.004
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    42   0.006
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    42   0.007
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    42   0.008
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    42   0.008
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    42   0.009
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    42   0.009
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    42   0.009
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    42   0.010
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    42   0.011
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    42   0.012
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       41   0.012
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    41   0.013
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    41   0.014
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    41   0.015
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    41   0.016
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    41   0.017
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    41   0.017
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    41   0.018
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    41   0.020
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    41   0.024
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    40   0.025
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    40   0.026
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    40   0.027
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    40   0.031
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    40   0.034
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    40   0.034
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.034
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    40   0.034
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    40   0.035
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    40   0.037
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    40   0.040
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    40   0.042
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    40   0.044
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    40   0.046
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    40   0.046
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    39   0.048
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    40   0.050
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.052
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    40   0.058
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    39   0.066
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    39   0.076
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    39   0.080
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    39   0.083
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.092
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    39   0.10 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    39   0.11 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    39   0.12 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    38   0.12 
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    38   0.13 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    38   0.13 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    38   0.14 
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    38   0.14 
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    38   0.14 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    38   0.15 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    38   0.16 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    38   0.17 
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    38   0.17 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.17 
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    38   0.20 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    37   0.20 
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    37   0.21 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.21 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    38   0.21 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    37   0.22 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    37   0.23 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    37   0.23 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    37   0.24 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.24 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.25 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    37   0.26 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.29 
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    37   0.29 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    37   0.31 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    37   0.35 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    37   0.35 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    37   0.35 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.36 
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    37   0.37 
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    37   0.47 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.48 
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    36   0.48 
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    36   0.51 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    36   0.58 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    36   0.63 
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    35   0.75 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    36   0.76 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    35   0.86 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    35   0.87 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    35   0.96 
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    35   0.99 
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     35   1.1  
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    35   1.2  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    35   1.2  
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    35   1.2  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.3  
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    35   1.3  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    35   1.6  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   1.8  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    34   2.2  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    34   2.5  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   2.9  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    33   3.5  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    33   4.0  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    33   5.5  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   5.9  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    33   6.4  

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score = 2085 bits (5401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1016/1081 (93%), Positives = 1016/1081 (93%)

Query: 1    MDRFTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDTSK 60
            MDRFTPEFSGQLLLQIQQIYVDEIRPQFP               CMLEDYMGCVDVDTSK
Sbjct: 1    MDRFTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTSK 60

Query: 61   AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ 120
            AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ
Sbjct: 61   AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ 120

Query: 121  EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELP 180
            EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELP
Sbjct: 121  EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELP 180

Query: 181  EHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIP 240
            EHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIP
Sbjct: 181  EHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIP 240

Query: 241  TLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTEL 300
            TLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTEL
Sbjct: 241  TLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTEL 300

Query: 301  LSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDD 360
            LSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDD
Sbjct: 301  LSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDD 360

Query: 361  NNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANH 420
            NNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANH
Sbjct: 361  NNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANH 420

Query: 421  IVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFE 480
            IVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFE
Sbjct: 421  IVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFE 480

Query: 481  YDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNN 540
            YDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNN
Sbjct: 481  YDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNN 540

Query: 541  KGEQNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIKLESIEESAP 600
            KGEQNNAQI                                      QKIKLESIEESAP
Sbjct: 541  KGEQNNAQIPDVPTWKPPPVPVMVRKRPPPPVPVSIPIPPETPPPLPQKIKLESIEESAP 600

Query: 601  SDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYIN 660
            SDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYIN
Sbjct: 601  SDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYIN 660

Query: 661  CMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGF 720
            CMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGF
Sbjct: 661  CMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGF 720

Query: 721  LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDK 780
            LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI            KMMVDK
Sbjct: 721  LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDK 780

Query: 781  EKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPA 840
            EKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPA
Sbjct: 781  EKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPA 840

Query: 841  FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHK 900
            FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHK
Sbjct: 841  FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHK 900

Query: 901  KSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKT 960
            KSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKT
Sbjct: 901  KSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKT 960

Query: 961  INFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLI 1020
            INFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLI
Sbjct: 961  INFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLI 1020

Query: 1021 SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV
Sbjct: 1021 SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

Query: 1081 D 1081
            D
Sbjct: 1081 D 1081

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1102 (43%), Positives = 641/1102 (58%), Gaps = 108/1102 (9%)

Query: 4    FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCV-DVDTSKAV 62
            FTPE+S +LL  +Q +Y D+I+  F                 + E Y+  + + +   A+
Sbjct: 8    FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDAL 67

Query: 63   RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
              FI GC+Y+YL++P+S++FQTR+KSYS++ +L  +Y++Q NMTNV+ MVK+EV  I   
Sbjct: 68   TAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSI--- 124

Query: 123  CDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISS---PSGMSTLSLHDEL 179
                           L  N +      +Q  R  TR  AYS+      S ++ L++H+E 
Sbjct: 125  ---------------LDRNAREFKEFEHQKAR--TR--AYSVPDRNFESRLTNLNIHNEN 165

Query: 180  PEHRSEQQTRFPSVE-RDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNE 238
            P    + Q    S + R+  N ++ D   E       + P+    +P   L + L+A   
Sbjct: 166  PLPLGDHQAASKSEQGREDMNNLQND---EDSSPVWTAPPL----EPNDQLRIALDATPL 218

Query: 239  IPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGT 298
             P++          DQ    K L   A  +  +      S +   P   P ++L ++   
Sbjct: 219  SPSI-------MALDQPMATKEL---AISTSRKALSRRASAMGPTP--YPIEELDIS--- 263

Query: 299  ELLSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMID 358
                    G DG++  D++ +             K   + + +R  THRKDSYHS+YM +
Sbjct: 264  --------GQDGNSHYDELGF------------NKTLWNANVDRQTTHRKDSYHSVYMFE 303

Query: 359  DDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMA 418
              +++       S  F QGLERLQKQSIITAPELF+ILS+ EE  KLLLID RL+KRS  
Sbjct: 304  GGSDDHMPSI--SKDFTQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSKV 361

Query: 419  NHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMN 478
            NHI+AP  V IDP  LWD + N+PI     L++ +  P F  R  YDYIVYY+DMKTYM 
Sbjct: 362  NHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSYDYIVYYTDMKTYMT 421

Query: 479  FEYDYSFILFYLLTTSGK-HLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAP 537
             +YDY F LFYLLT S   +L S+PT LLGGYEKWKK+M  Y   + + +D+Y+YRPY  
Sbjct: 422  IDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRPYGE 481

Query: 538  SNNKGEQNNAQIXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIK 591
            S       +++                                              K+ 
Sbjct: 482  SKKALPDTSSKRTPELPSWKPPAIPPRIRKRPPPPPPISVPVPTEKPPAAPPPPIPPKVS 541

Query: 592  LESIEESAPS--DNSQYIRPPAKL--------PIHALHSPRNQTLTRKFSIPTIEKNSNP 641
            LE+  E  P+  D+S     P ++        P+H     +  +L R +SIPTIEK+SN 
Sbjct: 542  LETHPEEPPAVDDHSVETTRPTRITRKAIGSRPLHTHPHDQRLSLQRHYSIPTIEKSSNT 601

Query: 642  YVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFA 701
            YV+ S+TGLRNLGNTCYIN MLQ LFAT + ++LF+SGK+ E+    N +    +S +F 
Sbjct: 602  YVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEF-FNQNYSNRPQLSKSFN 660

Query: 702  NLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNV 761
             LF KMY+NGGC+VVP+ FLK+ + LRPDLRIPDDQQDTQEFL+  L+RLHDELSNQ  V
Sbjct: 661  ILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDELSNQAAV 720

Query: 762  IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESV 821
                         +M V+ ++YKKWF+++V+ NGL+P+D +FQGQ+EN L+CQRCG  S 
Sbjct: 721  ANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIENILECQRCGNSSF 780

Query: 822  NYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVE-- 879
            +YSTFYVLSLA+PKPS   F ++ RVKLEDCINMFT+DE+L+GENAWDCPKCGS   +  
Sbjct: 781  SYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCGSAVTDMG 840

Query: 880  PRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKM 939
            P    ++  +           KS FF + +     RSKSPFR LG  +            
Sbjct: 841  PNHLKKSKKKKKSELGEERRSKSGFFRIHSKS--KRSKSPFRMLGSTKFPLA-------- 890

Query: 940  ERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVL 999
                +E+W   KSK+L T KT+NFI LP VLIIHLSRFYYDLTKKND +V+YPLVLNI+L
Sbjct: 891  ----MEDW---KSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIIL 943

Query: 1000 KNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGN 1059
            KN E  RY+LY++VNHTGNLISGHYTSLVNK+P H L    QKWYYFDDEVVK E  HGN
Sbjct: 944  KNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGN 1003

Query: 1060 VDKGITKVSSKNVYVLFYERVD 1081
            +D+GI KVSS +VYVLFYER+D
Sbjct: 1004 IDQGILKVSSSDVYVLFYERLD 1025

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1116 (39%), Positives = 603/1116 (54%), Gaps = 124/1116 (11%)

Query: 4    FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDY-MGCVDVDTSKAV 62
            +TPE+S +LL  +Q +Y  +I+  +P                + E Y M     +   A+
Sbjct: 5    YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 63   RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
              FI G FY+YL++P+S+QF TR+KSY +Y +LR  Y+ + +MTNV+ MV ++V  I  +
Sbjct: 65   TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 123  CDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPEH 182
              +F      DD+K                   ITR+ AYS+ S +  + L     L  +
Sbjct: 125  SRDF------DDTK-------------------ITRKRAYSVPSQALANQLR---SLTLN 156

Query: 183  RSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPTL 242
             ++   + P V ++      +D L       T       + +P   L + LN  ++  + 
Sbjct: 157  NTDGLEQLPEVSKE------SDTLTNYADDYTTIWSAPKL-EPDDQLKLALNPPSKS-SS 208

Query: 243  SLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLS 302
            +  S    V DQH++  S+  +++D  E    +   P+  A   + + + +         
Sbjct: 209  ATSSLSSFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHATPSEISQRTR--------- 259

Query: 303  PPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDL------HANRLITHRKDSYHSIYM 356
                           ++  VS  D    R    E +      + +R  THRKDSYHS+YM
Sbjct: 260  ---------------HHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHSVYM 304

Query: 357  IDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRS 416
            +++D++   N +D    F Q L RLQKQ +I+  EL  IL + +ER+ +LL+DLR++KR 
Sbjct: 305  LNEDDDT--NEYD----FFQNLSRLQKQYVISCEELMDILQS-DERNNVLLVDLRISKRF 357

Query: 417  MANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLKYDYIVYYSDMKT 475
              NHIVAPN++NIDP +LWD +   PI  D  LE+++ +   F  R K+ YIVYY+DMKT
Sbjct: 358  HNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKT 417

Query: 476  YMNFEYDYSFILFYLL-TTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRP 534
            ++N ++DY  + F LL  +S   L S P ALLG YE+WK  +  Y   + I   DYL+RP
Sbjct: 418  FLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRP 477

Query: 535  YAPSNNKGEQNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIKLES 594
            YA S    +     I                                      Q I    
Sbjct: 478  YASSAKSQKDKVKPISAPPVPATRPPPPPLPAQAPPALPSQAPPTLPSQAPPTQSIPAVH 537

Query: 595  IEESAPSD--NSQY-----IRPPAKLPIHALHSPRNQTLTRK---------------FSI 632
            +    P    N  Y     ++PP        H+ R++ L+                  S+
Sbjct: 538  LPPLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPISHQYISV 597

Query: 633  PTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK 692
            PTIE++SN YV+ S+TGLRNLG+TCYIN MLQ LFAT + +++F+S KY +Y  K   ++
Sbjct: 598  PTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHR 657

Query: 693  ESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLH 752
             + IS +F  LF KMYMNGGC+VVPSGFLK CN +RPD +IP+DQQDTQEFLLF+L++LH
Sbjct: 658  -AQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLH 716

Query: 753  DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
            DELS+   V              + VD ++Y KWF+ ++  NGLSP+D +FQGQMEN LQ
Sbjct: 717  DELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQ 776

Query: 813  CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPK 872
            CQRCG+ S NYSTFYVLSLA+P P    F K+ +V LEDCIN+FTSDEVL+GENAWDCP+
Sbjct: 777  CQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPR 836

Query: 873  CGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLP--------TGKAISRSKSPFRKLG 924
            CG           TS     P      KK KF  LP        T +          +  
Sbjct: 837  CG-----------TSMSGSGPGEGKAKKKRKFL-LPHDHVNNNRTSRFFKFRSKSRSRSS 884

Query: 925  LLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKK 984
                          M   E     K KSKKL TIKT NFI++P +L+IHLSRF+YDLTKK
Sbjct: 885  SPFNSSNGHNSGSSMPGSE-----KWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKK 939

Query: 985  NDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWY 1044
            N  V++YPL+LNIVLKN E+ +Y+LY IVNH GNLISGHYTSLVNKD  H + + +QKWY
Sbjct: 940  NSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWY 999

Query: 1045 YFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            YFDDEVVK +  HG+ D GI  VSS +VYVLFYER+
Sbjct: 1000 YFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/861 (44%), Positives = 511/861 (59%), Gaps = 74/861 (8%)

Query: 257  EAKSLPGTAT---DSDEEYYVEHGSPIWTAPDLDPNDQLKLA------------------ 295
            +A S   +AT   D+  E   E+G+ +WTAP+L+PND LK++                  
Sbjct: 149  QALSKANSATVEPDAPTETEFENGTTMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFP 208

Query: 296  -LGTELLSPP-------VMGLDGDTLGDDIYYETVSK--GDDVSYRGKDFEDLHANRLIT 345
             +  E  S P        + L G            S+  G   +    DF D   NR  T
Sbjct: 209  KIHNESHSFPFEEPELHALSLGGSRTRRSSVPARASRKLGTTQASNSSDFNDQKINRYAT 268

Query: 346  HRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKL 405
            HRKDSYHS++M +DD           +AF   L RLQKQS++T  +L  IL + ++R  L
Sbjct: 269  HRKDSYHSVHMSNDD----------YDAFTFNLARLQKQSVVTCDQLMRILCS-QDRDNL 317

Query: 406  LLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYD 465
            LLIDLR +KR   NHI+APN++N+DPT LW+    SPI  D  LE+ L+N L N R +++
Sbjct: 318  LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFE 377

Query: 466  YIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQI 525
            YIVYY+DMKT+M  ++DY  + F L+ TS K+L   P  LLGGYE+WKK ++   SQ   
Sbjct: 378  YIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSK-SSQAYC 436

Query: 526  ELDDYLYRPYAPSNNKGEQNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 585
            + D +LY     S N G   NA +                                    
Sbjct: 437  DKDAFLYS----STNNGR--NAPVTSHSLPEHYPVAPPSIPPPPPPIAKTEEMTKTPYNR 490

Query: 586  XXQKIKLESIEES--APSDNSQYIRPPAKLPIHALHS-PRNQTLTRKFSIPTIEKNSNPY 642
                  L   + +   P+ +  + R   ++  H++ +   N   ++  +IPTIE++ N Y
Sbjct: 491  APFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEY 550

Query: 643  VAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFAN 702
            VA S+TGLRN+G TCY+N MLQ LFAT   ++LF+S KY  Y  +   N  + +S  F  
Sbjct: 551  VALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP-NQLSKYFNV 609

Query: 703  LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
            LF KMYMNGGC+VVP+GFLK CN LRPD RIP DQQDTQEFLLF+L++LHDELS    V 
Sbjct: 610  LFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVA 669

Query: 763  XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                        K+ VD+++Y  WF+K +  NG+SP+D +FQGQMEN L CQRCG+ S N
Sbjct: 670  NDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFN 729

Query: 823  YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKA--VEP 880
            YS FYVLSLA+P  S   F +  +V+LEDCIN+FTSDE LT ENAWDCPKCG+ A    P
Sbjct: 730  YSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGP 788

Query: 881  RFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKME 940
                +     + P++     +S+FF L   K+ SRS SPFRK         +Q+ L+K+ 
Sbjct: 789  EEEKKKKRFLLNPDTRASGNRSRFFKL-RSKSRSRSVSPFRK------QSSQQQNLEKL- 840

Query: 941  RDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLK 1000
                      KSKKL TIKT+NFISLP VL IHLSRF+YDLTKKN+ V++YPL+L+IVLK
Sbjct: 841  ----------KSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLK 890

Query: 1001 NEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNV 1060
            NE+I++Y+LY+I NH GNLISGHYTSLVNKD  H+L   +QKWYYFDDE VK +  HG++
Sbjct: 891  NEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDI 950

Query: 1061 DKGITKVSSKNVYVLFYERVD 1081
            D GIT +SS +VYVLFYE++D
Sbjct: 951  DAGITSISSSDVYVLFYEKID 971

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 71/123 (57%), Gaps = 2/123 (1%)

Query: 1   MDR-FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDTS 59
           M+R ++PE+S +LL  ++ +Y  +I   FP                + E Y   +  + +
Sbjct: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60

Query: 60  K-AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQ 118
           +  +  F+ GCFYIYL++P S+QFQ+R KSY++Y +L+  Y+ + NMTNV+ MV E +  
Sbjct: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120

Query: 119 IQE 121
           + +
Sbjct: 121 MSK 123

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/916 (42%), Positives = 534/916 (58%), Gaps = 90/916 (9%)

Query: 236  NNEIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295
            ++EI  L+L  +   +   H   K      +DS+   +     P+W AP+L+PNDQLKLA
Sbjct: 149  DSEISRLTLAGNGSTLPKMH---KKWDFIRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLA 205

Query: 296  LGTELLSPPVMGLDGDTLGDDI---------YYETVSKGD-------------------- 326
            L + + S     L  DT+G +          Y +  SK +                    
Sbjct: 206  LDSAVPS----SLSVDTVGKEAPELSLSPLGYPKHKSKSELTVEEKEHPQQDHRHHHGVQ 261

Query: 327  -DVSYRGKD-----FEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSN---AFIQG 377
             +    GKD     F D   +R + HRKDSYHS+YM D D++  +N   G+    + +Q 
Sbjct: 262  QETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDGDHDFGEN--KGATFPESEVQA 319

Query: 378  LERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDN 437
            ++RLQKQSIIT+PELFSILSN +ER++LLLIDLRL  R   N+I+APN+V IDP  LWD 
Sbjct: 320  MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379

Query: 438  EANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGK- 496
               +P+   ++L++RL N +FN R  +D+IVYY+DMKTYM  ++DY F+ + L+  S + 
Sbjct: 380  NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEV 439

Query: 497  HLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQN--NAQIXXXXX 554
             L S+P+ LLGGYEKWK V+  Y++Q+ I +DDYLYRPY+ SN +G++   NA+      
Sbjct: 440  SLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYS-SNKEGKEKSANAKHIEPVP 498

Query: 555  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIKLESIEESAPSD-NSQYIRPPAKL 613
                                              KI+LE  E+   +   S+ +  PA++
Sbjct: 499  WKPPALPERMRNLPPPPPPATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEV 558

Query: 614  PIHALHSPRNQTL------TRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLF 667
            P + +   +   L       R+FS+PTIE+++N YVA S+TGLRNLG TCYIN MLQ LF
Sbjct: 559  PKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLF 618

Query: 668  ATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFL 727
            ATN  ++LF    Y  +   P       +S +F+ L  KMYMNGGC+VVP+ FLKICNFL
Sbjct: 619  ATNMFRDLFEPSNYERF-FNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFL 677

Query: 728  RPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWF 787
            RPD  IPDDQQD QEFL+  ++RLHDELSNQ  V+               V KE+YK+WF
Sbjct: 678  RPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWF 737

Query: 788  DKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKP--SAPAFYKSG 845
            + +++    SP+D +FQGQ+EN L C++CGY S +YSTFY+LSLA+PKP  S  +  K  
Sbjct: 738  ENSLINTKFSPIDKIFQGQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGN 797

Query: 846  RVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTS-----RTSTQTILPNSPHHHK 900
             V LEDCINMFTSDEV++ ENAWDCPKCG    + +  S     + S+ +    SP   K
Sbjct: 798  WVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRHNKQSSSSGSTASPEPRK 857

Query: 901  -------------KSKFFGLP--TGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIE 945
                         K+KF   P     + S+S SPF  L                   +  
Sbjct: 858  AKKKDEEGSSLKSKTKFLLFPRKRKSSSSKSLSPFNLLNSSSSSSNTNNNSSSNSGSKKN 917

Query: 946  EWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIV 1005
             +  +++   VT+  +  I L        SRFYYDLTKKN+ V++YPL+LNIVLKN E +
Sbjct: 918  SF-SIRATNFVTLPPVLVIHL--------SRFYYDLTKKNETVITYPLILNIVLKNNETL 968

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGIT 1065
            +Y+LY++VNH GNLISGHYTSLVNK+  H+L N  Q+WYYFDDEVVK E +HGN+ +G+ 
Sbjct: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028

Query: 1066 KVSSKNVYVLFYERVD 1081
            KVSSK+VYVLFYER+D
Sbjct: 1029 KVSSKDVYVLFYERID 1044

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCV-DVDTSKAV 62
           FTPE+S +LL  ++ IY D+I+P +                 + E +   + + +   A+
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             +I GC+++YL++P+S QFQ R+K++ ++  L+ LYE+Q+NMTNV+ MVK+EV  + ++
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 123 CDNFQDNEGVDDSKPLGNNLKGADNMLNQ 151
             +F+  + V+  +   +   G D+ +++
Sbjct: 128 --DFRKLKDVERKRAFSSPDNGLDSEISR 154

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/848 (43%), Positives = 483/848 (56%), Gaps = 65/848 (7%)

Query: 263  GTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLSPPV---------MGLDGDTL 313
             ++T++  E   E+ S +WTAP+L+PND LK+ LG    S            +G +G++ 
Sbjct: 158  ASSTNAGPETDNENDSTMWTAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSS 217

Query: 314  G-DDIYYETVSKGDDVSYRGKDF---------------EDLHA---NRLITHRKDSYHSI 354
              DDI     S   D   R                   +D++    +R  THRK SYHS+
Sbjct: 218  SSDDIEMAVHSTTQDQRPRRSSVPIKVEAPQNSLQSTVDDIYCQKVDRYNTHRKGSYHSV 277

Query: 355  YMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNK 414
            +M  D+           ++F     RLQKQSIIT  +L  IL + EE  +LLL+DLR  K
Sbjct: 278  HMTGDE----------YDSFTFNTARLQKQSIITCDKLLRIL-DSEEAERLLLVDLRFIK 326

Query: 415  RSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMK 474
            R   NHIVAPN+VN+DP NLWD      I  D  LE    N       ++ +IVYY+DMK
Sbjct: 327  RFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMK 386

Query: 475  TYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRP 534
            T+M  ++DY  + F +L TS   +S  P  LLGGYE+WKK +   V Q ++ + +     
Sbjct: 387  TFMRLDFDYQLVFFQMLYTSNWRISCTPKVLLGGYEQWKKFL-AKVPQSRVPIKEAFLFR 445

Query: 535  YAPSNNKGEQNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIKLES 594
              P    G++  A                                           K   
Sbjct: 446  LKPG---GKETVASAIIHQKASTPLPPSIPPPPPPVEKVSKADSGSYTRAPFPLPAKEMV 502

Query: 595  IEESAPSDNSQYIRPPAKLPIHALHSP--RNQTLTRKFSIPTIEKNSNPYVAYSVTGLRN 652
            I+ S  S +   I  P+ L  H  H    +N+    + +IPTIE++SN YVA S+TGLRN
Sbjct: 503  IQSSLDSISRTQI--PSHLESHYTHEKVLQNKMHHAEGTIPTIEQSSNEYVALSITGLRN 560

Query: 653  LGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGG 712
            +GNTCYIN MLQ LFAT + ++LF+S KY +Y  K   N    +S  F  LF KMYMNGG
Sbjct: 561  MGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQ-LSKYFNILFKKMYMNGG 619

Query: 713  CTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXX 772
            C+VVP+GFLK CN LRPDL+IP +QQDTQEFLLF+L++LHDELS   +V           
Sbjct: 620  CSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELSESNHVANDYPNLLLHD 679

Query: 773  XXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLA 832
               + VD+++Y KWF+  +  NG+SP+D +FQGQMEN L CQRCG+ S NYS FYVLSLA
Sbjct: 680  DESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRCGHSSYNYSMFYVLSLA 739

Query: 833  LPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTIL 892
            +P  S  +F +  +++LEDCIN+FTSDE LT ENAWDCPKCGS               + 
Sbjct: 740  IP-ASMSSFGQKKKMRLEDCINLFTSDEKLTNENAWDCPKCGS--------------AVS 784

Query: 893  PNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKS 952
             N P   KK + F   +  +  RS+S F KL    +            +    E  K KS
Sbjct: 785  GNGPDGDKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPSSQSPASE--KWKS 842

Query: 953  KKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSI 1012
            KKL TIKT+NF+SLP VL IHLSRF YDLT KN+ V++YPL L+IVLKN E+V Y+LY+I
Sbjct: 843  KKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAI 902

Query: 1013 VNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNV 1072
             NH GNLISGHYTSLVNKD  H+LGN  QKWYYFDDEV K +  HGN+D GIT VSS +V
Sbjct: 903  ANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDV 962

Query: 1073 YVLFYERV 1080
            YVLFYE++
Sbjct: 963  YVLFYEKI 970

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 64/110 (58%), Gaps = 1/110 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDV-DTSKAV 62
           ++PE+S +LL  ++++Y  +I   +P                + E Y   ++    S+ +
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMV 112
             F+ GCFYIYL++P S+QF +R KSY++Y +LR  Y+ + NMTNV+ MV
Sbjct: 65  TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMV 114

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/882 (41%), Positives = 504/882 (57%), Gaps = 116/882 (13%)

Query: 273  YVEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYE------------ 320
            Y    S  W AP LDPND+L LA+ +   +     L+  +L +++Y E            
Sbjct: 170  YKSFASTEWKAPQLDPNDRLHLAIASSKTTESS-SLNSISLDENLYKEQDDTDALDSVSD 228

Query: 321  ----TVSKGDDVSYRG-------------KDFEDLHA--------------NRLITHRKD 349
                ++ K D +   G             +    L+A              +R  THRKD
Sbjct: 229  KLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKD 288

Query: 350  SYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLID 409
            SYHS+Y+ D+         +  N    GL R Q+++ I    LFS+L + E R  LLLID
Sbjct: 289  SYHSVYLGDE--------LEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLID 340

Query: 410  LRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVY 469
            LRL KR  +NH+VAPN++NIDP  L+D E  + +     L++ + NP+ +   +YD IVY
Sbjct: 341  LRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVY 400

Query: 470  YSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDD 529
            Y+D K++M+  ++Y  ILF LL    K  +++P +LLGGYE+WK  +N  +   + +   
Sbjct: 401  YTDYKSFMHLTFNYELILFELLFK--KTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSL 458

Query: 530  YLYRPY--APSNNKGEQNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 587
            +L+R    APS+    + + Q                                       
Sbjct: 459  FLFRKSKSAPSDKTASKPSVQ--------TDNIIKSSPSILSKEHNDDTLISSTPPIPKV 510

Query: 588  QKIKLESIEESAPSDNSQYIRPPAKLPIHA------------LHSPR-------NQTLTR 628
                L     SAP+    Y RPP  LPI++            L +P+        Q L  
Sbjct: 511  APPPLPGSPLSAPT--IVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHV 568

Query: 629  KFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKP 688
             FSIPTIE++ N +V+ S+TGLRN+GNTCYIN MLQ LF  ++ ++LF+ GKY  Y    
Sbjct: 569  PFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPK 628

Query: 689  NDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFIL 748
              N  + IS  F+ LF KMY+NGGC+VVP+GFLK C+ LRPD  IP DQQDTQEFLLF+L
Sbjct: 629  RSN--TIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLL 686

Query: 749  NRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808
            + LHDELS    V             K++VD ++Y KWFD+ +  NGLSP+D +FQGQME
Sbjct: 687  DTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQME 746

Query: 809  NALQCQRCGYESVNYSTFYVLSLALPK-PSAPAFYKSGRV-KLEDCINMFTSDEVLTGEN 866
            N+L+CQRCG+ S NYSTFYVLSLA+P  P    F +S ++ +LEDCIN++T DE+LTGEN
Sbjct: 747  NSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGEN 806

Query: 867  AWDCPKCGSKAVEPRFTSRTSTQTI--------LPNSPHHHKKSKFFGLPTGKAISRSKS 918
            AWDCPKCG+ +      S  S +T+        L  +  H  +SKFF L + ++  RS S
Sbjct: 807  AWDCPKCGTHSNSSD-GSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLS 865

Query: 919  PFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFY 978
            PF+       +  K EKL             +KSKK+ TIKT+NFI++P +L+IHLSRF+
Sbjct: 866  PFKS------NSVKPEKL------------HIKSKKMTTIKTLNFITMPNILVIHLSRFF 907

Query: 979  YDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGN 1038
            YDLTKKN+ +++YPL+L++VLKN EI RY+LY I+NH GNL+SGHYTSLVNK   H +  
Sbjct: 908  YDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRK 967

Query: 1039 TEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             +QKWYYFDDEVVK E  HG+ D+GIT +SS +VYVLFYER+
Sbjct: 968  GQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 69/120 (57%), Gaps = 1/120 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           +TPE+S +LL  +Q++Y  +++  +                 + E Y   + V+     +
Sbjct: 5   YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCL 64

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             ++ G FY++L++P S+QF  R+KSYS+Y++L+ LY+ +LNM+NV+ MV  +V  +  Q
Sbjct: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/463 (60%), Positives = 342/463 (73%), Gaps = 14/463 (3%)

Query: 619  HSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS 678
            H  +  TLTR+ SIPTIE++ N YV+ S+TGLRNLGNTCYIN MLQ LFAT   ++LF++
Sbjct: 579  HLQQTTTLTRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLT 638

Query: 679  GKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQ 738
             KY  +           ISN+F  LF KMY+NGGC+VVP+ FLK CN LRPDL+IPDDQQ
Sbjct: 639  SKYSSFLNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQ 698

Query: 739  DTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSP 798
            DTQEFL+ IL+RLHDELSNQ  V+             + V  E+YK WF+K+V+ NGLSP
Sbjct: 699  DTQEFLMIILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSP 758

Query: 799  VDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTS 858
            +D +FQGQ+EN LQCQRCG+ S NYSTFYVLSLA+PKPS   F +S RVKLEDCINMFT+
Sbjct: 759  IDEIFQGQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTN 818

Query: 859  DEVLTGENAWDCPKCGSKAVEP-RFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSK 917
            DE+L+GENAWDCP CGS A +  R  +  S +       H H KS+FFGLPT     RS 
Sbjct: 819  DEMLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRH-KSRFFGLPTRP--HRSL 875

Query: 918  SPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRF 977
            SPFRK G    +   + K +       ++W   K+KKL+TIKT+NFI LP VL+IHLSRF
Sbjct: 876  SPFRKSGSSSTNSTSKIKHE-------QQW---KTKKLITIKTLNFIMLPPVLVIHLSRF 925

Query: 978  YYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLG 1037
            +YDLTKKN  V++YPL+LNIVLKN E+ +YKLY IVNHTGNLISGHYTSLVNK+P HNL 
Sbjct: 926  FYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLN 985

Query: 1038 NTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            + +Q+WYYFDDEVVKAE  HG++D GI+KVSSK+VYVLFYER+
Sbjct: 986  HNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERL 1028

 Score =  335 bits (860), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 212/566 (37%), Positives = 296/566 (52%), Gaps = 120/566 (21%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDTSK-AV 62
           FTPE+S +LL +IQ +Y ++I+  +P                + E ++       +K A+
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             FI GC+Y++L+MP+S+QFQ+R+KSY +Y++L+ LYE+Q +MTNV+ MVK+E+  I E 
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILE- 128

Query: 123 CDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPEH 182
                               K A+  +N+    I R+ AYS+                  
Sbjct: 129 --------------------KTAEREINETNNRIVRQRAYSVPD---------------- 152

Query: 183 RSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPTL 242
                          SN +   +       R   +P      PRK L      NN     
Sbjct: 153 ---------------SNDLTEQLHSLSVSDRNLKSP------PRKIL-----MNN----- 181

Query: 243 SLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA-LGTELL 301
           S    D  V ++ N+  S                  P+WTAP L+P DQLKLA LG E L
Sbjct: 182 SFEHSDSDVINEENDMSS------------------PLWTAPPLEPTDQLKLAVLGNETL 223

Query: 302 SPPVMGLDGDTLG--------------------------DDIYYETVSKGDDVSY----- 330
            PPV+  + D                             +  +   +S  +D+       
Sbjct: 224 PPPVIPYEADIQERTDLLKQPSIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPS 283

Query: 331 RGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAP 390
             + F + +A+R  THRKDSYHS+YMID+++ +  N F  S  +IQ L+RLQKQSIITA 
Sbjct: 284 NNRSFRETNADRSQTHRKDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQ 343

Query: 391 ELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILE 450
           EL SILS P ER KLLLIDLR +KR+  NHIVAPNVV+IDP  LWD+  ++PIY    LE
Sbjct: 344 ELLSILSCPPERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLE 403

Query: 451 QRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKH-LSSVPTALLGGY 509
           + L+N LFN R +++Y+VYY+DMKTYM+ ++DY+F LFYLLTT   + L S PT LLGGY
Sbjct: 404 KLLDNELFNRRHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGY 463

Query: 510 EKWKKVMNTYVSQYQIELDDYLYRPY 535
           +KWK  ++ Y  +Y I + DYLYRPY
Sbjct: 464 DKWKVFLHHYAKEYDINIPDYLYRPY 489

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/466 (60%), Positives = 345/466 (74%), Gaps = 27/466 (5%)

Query: 625  TLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY 684
            T +RKFSIPTIEK+ N YV+ S+TGLRNLGNTCYIN MLQ LFAT   ++LFIS K++ +
Sbjct: 655  TRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSF 714

Query: 685  QMKPNDNK---ESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQ 741
                ND+K      ISN+F  LF KMY+NGGC+VVP+ FLK CN LRPDLRIPDDQQDTQ
Sbjct: 715  I---NDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQ 771

Query: 742  EFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG 801
            EFL+ IL+RLHDELSNQ  V+             + V  ++YK WFDK V+ NGLSP+D 
Sbjct: 772  EFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDH 831

Query: 802  VFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEV 861
            +F GQMEN+LQCQRCG  S NYSTFYVLSLA+PKPS+  F +S RVKLE+CINMFTSDEV
Sbjct: 832  IFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891

Query: 862  LTGENAWDCPKCG-----SKAVEPRFTSRTST--QTILPNSPHHHKKSKFFGLPTGKAIS 914
            L+GENAWDCPKCG     + +   +  + TS+  + +  ++ HH  KSKFF L T     
Sbjct: 892  LSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS--H 949

Query: 915  RSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHL 974
            RS SPFRK         K          + E W   KSKKL+TIKT+NFI LP +L+IHL
Sbjct: 950  RSISPFRK---------KTSPAAVPSSTKNEPW---KSKKLITIKTLNFIVLPPILVIHL 997

Query: 975  SRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034
            SRFYYDLTKKN+ V++YPL+LNIVLKN E+ +Y+LY IVNH+GNLISGHYTSLVNK+P+H
Sbjct: 998  SRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNH 1057

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            +LG+ +Q+WYYFDDE VK E+ HG++DKGI +VSS++VYVLFYER+
Sbjct: 1058 DLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103

 Score =  225 bits (573), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 146/214 (68%), Gaps = 6/214 (2%)

Query: 333 KDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPEL 392
           K  E  + +R   HRKDSYHSIYM+DD + +    +  SN +I  LERLQKQ IITA EL
Sbjct: 323 KTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQEL 382

Query: 393 FSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQR 452
           FSILSNP E+ KLLLIDLR  KR  +NHIVAPN++ IDP  LW+++ N+PIY  T LE  
Sbjct: 383 FSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENL 442

Query: 453 LNNP----LFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS--GKHLSSVPTALL 506
           L  P    L   R +++YIV+Y+D KTYMN  +DYSF  FYLL TS   K++ S PT LL
Sbjct: 443 LYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL 502

Query: 507 GGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNN 540
           GGY+KWKKV+ +Y  QY   + DYLY+P+  S +
Sbjct: 503 GGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGD 536

 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 145/294 (49%), Gaps = 71/294 (24%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDTSK--A 61
           FTPE+S +LL ++Q IY D+I+  +P                +LE +      +T+    
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 62  VRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQE 121
           +  FI GC+Y++L++P+S+QFQ+++KSY +YTEL+ LYE++ +MTNV+ MVK+E+  + +
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 122 QCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPE 181
             +N   N G D               LN   R+I R+ AYSIS    ++ LS       
Sbjct: 129 MDEN---NNGSD---------------LNH--RIIKRQRAYSIS----INELS------- 157

Query: 182 HRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPT 241
                Q +  S+    SN +  + +  K ++          NQP          N+ +  
Sbjct: 158 ----NQVKSLSI----SNSIDQEHINNKTETSL-------TNQP---------PNHHLLP 193

Query: 242 LSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295
           + LH D++   ++ N        ATD D        SP+WTAP L+P DQLKLA
Sbjct: 194 IILHCDEEFSNEEIN--------ATDFDR------ASPLWTAPSLEPKDQLKLA 233

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  518 bits (1335), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 339/520 (65%), Gaps = 39/520 (7%)

Query: 599  APSDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCY 658
            A  D +  + P  ++      S  N  L   +SIPTIE+N N YV+ S+TGLRNLGNTCY
Sbjct: 643  ADEDTALQVAPTKRIQQEPFRSATN-GLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCY 701

Query: 659  INCMLQSLFATNELKNLFISGKYREY----QMKPNDN-KESAISNTFANLFNKMYMNGGC 713
            IN M+Q LFAT   +NLFIS KY+E+      KP  N  +  IS TF  LF KMY+NGGC
Sbjct: 702  INSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGC 761

Query: 714  TVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXX 773
            +VVP  FLK C+ LRPD +IPDDQQDT EFL+ IL+RLHDELSNQ  V+           
Sbjct: 762  SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDE 821

Query: 774  XKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLAL 833
             K+ V  ++YKKWFDK+V+ NGLSP+D +FQGQMEN+L CQRCG+ S NYSTFYVLSLA+
Sbjct: 822  KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881

Query: 834  PKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG------SKAVEPRFTSRTS 887
            PK ++  F +S RV LE+C+NM+TSDEVL+GENAWDCP C          VE    ++ +
Sbjct: 882  PKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAA 941

Query: 888  TQTILPNSPHHHKKSKF---------------FGLPTGKAISRSKSPFRKLG-----LLE 927
              T+ P S     K                   G      I+RS SPFR LG      + 
Sbjct: 942  RDTLSPGSSSSSSKKGKLFSFSLHHRHHHRSELGELNVSKINRSLSPFRVLGGSSSKSVR 1001

Query: 928  KHEGKQEKLDKMERDEIEEWHKM-------KSKKLVTIKTINFISLPKVLIIHLSRFYYD 980
            K E    + D   + +I+E  +M       KSKKL TIKT+NFI +P+ LIIHLSRFYYD
Sbjct: 1002 KSEDSHSRADVDAQRDIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYD 1061

Query: 981  LTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTE 1040
            LTKKN  +V+YPL+LNIVLK+ E+V+YKLY +VNHTGNLISGHYTS+V+K   H+L +  
Sbjct: 1062 LTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNG 1121

Query: 1041 QKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
              WYYFDDEVVK E  HG+V  G+ K+SS +VYVLFYER+
Sbjct: 1122 DGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161

 Score =  240 bits (612), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 117/203 (57%), Positives = 153/203 (75%), Gaps = 2/203 (0%)

Query: 333 KDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKN-YFDGSNAFIQGLERLQKQSIITAPE 391
           + F+D   +R +THRK+SYHS+YM+++  ++  N Y+D SNA+IQ LERLQKQSIITAPE
Sbjct: 343 RSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPE 402

Query: 392 LFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQ 451
           LFSILSN ++  +LLLIDLRL+ R   + I+APN V+IDP  LW++ + +P+Y+ T LE 
Sbjct: 403 LFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462

Query: 452 RLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS-GKHLSSVPTALLGGYE 510
           +LNNPLFN R ++DY+VY+SDMKT+M   +DY F  FYLL T+ GK L  VPT LLGGYE
Sbjct: 463 KLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYE 522

Query: 511 KWKKVMNTYVSQYQIELDDYLYR 533
           KWKKV+  Y  QY I + DYL R
Sbjct: 523 KWKKVILEYGKQYNICVTDYLVR 545

 Score =  119 bits (298), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 139/305 (45%), Gaps = 73/305 (23%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDTS-KAV 62
           FTPE S +L  ++ ++Y D+I    P                + E Y+ C+  D +  A+
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQE- 121
             FI GCFY+YLVMP+S+QF TR++++++Y+++R LYESQ+NMTNV+ MVKEEV  + E 
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 122 QCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPE 181
           Q D+   NE                         I R  AYS+  P     +   D+L  
Sbjct: 134 QWDSASLNER------------------------IPRNRAYSV--PDEARVVQNLDKL-- 165

Query: 182 HRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPT 241
                  + P+               E +  R +S     +  PR   +V +++++E   
Sbjct: 166 -----TLQSPT---------------ETRGGRPRSQKKQLLQLPRPG-NVPVHSDSEFIA 204

Query: 242 ---LSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGT 298
              +SLH DD    D  +++                   SP+W AP L+PNDQLKLA   
Sbjct: 205 EQGISLHGDDSGWSDLDDQS-------------------SPLWRAPQLEPNDQLKLAAEV 245

Query: 299 ELLSP 303
             L P
Sbjct: 246 HDLPP 250

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  490 bits (1262), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 300/422 (71%), Gaps = 24/422 (5%)

Query: 662  MLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFL 721
            M+Q LF T  L++LFIS KY +Y  K  D + S +S +F+ LF KMY+NGGC+VVP+ FL
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSKRID-RSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 722  KICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKE 781
            K CN LRPDLRIPDDQQDTQEFL+ +L+RLHDELSNQ  V             K+ V+ +
Sbjct: 60   KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 782  KYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAF 841
            +Y KWFDKT+ ANGLSP+D +FQGQ+EN L CQRCG+ S NYSTFYVLSLA+PKPS+  F
Sbjct: 120  EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 842  YKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKK 901
             +S RVKLEDCINMFT+DEVL+GENAWDC  CGS +V      R    T         +K
Sbjct: 180  SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVH-NVEQRKDKTTGNGEEKKRSRK 238

Query: 902  SKFFGLPT--GKAISRSKSPFRKLGLLEK-HEGKQEKLDKMERDEIEEWHKMKSKKLVTI 958
            S+ F LP   G++ SRS SPFRK       HE                  K+K KKLVTI
Sbjct: 239  SRLFLLPNINGRS-SRSISPFRKSASPRPPHE------------------KLKHKKLVTI 279

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGN 1018
            K++NFISLP  L+IHLSRFYYDL+KKN+ +V+YPL+LNIVL N E  +Y+LY IVNHTGN
Sbjct: 280  KSMNFISLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGN 339

Query: 1019 LISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYE 1078
            LISGHYT+LVNK+ +H L   +QKWYYFDDEVVK E  HGN+D+G+ KVSS  VYVLFYE
Sbjct: 340  LISGHYTTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYE 399

Query: 1079 RV 1080
            RV
Sbjct: 400  RV 401

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  505 bits (1300), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 260/483 (53%), Positives = 326/483 (67%), Gaps = 34/483 (7%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY--Q 685
            R + IPTIE++SN YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS KY+ Y  Q
Sbjct: 582  RVYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ 641

Query: 686  MKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLL 745
             + N      +SN+   LF+KMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL+
Sbjct: 642  SRGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLM 701

Query: 746  FILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQG 805
             +L+RLHDELSNQ +V              + V  ++YK WFDK V+ NG+SP+D +FQG
Sbjct: 702  ILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQG 761

Query: 806  QMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSG-----RVKLEDCINMFTSDE 860
            QMEN+LQC+RCGY + NYSTFYVLSLA+P+ S     K G     RVKLEDCINMFTSDE
Sbjct: 762  QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM-KLSKLGRPNEKRVKLEDCINMFTSDE 820

Query: 861  VLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGL------------- 907
            VL+GENAWDCP+CG  A      S ++ +          KKS+FF L             
Sbjct: 821  VLSGENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFG 880

Query: 908  ----------PTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVT 957
                      P      RS+SPF+ LG   K             D    ++  K+KKL T
Sbjct: 881  DSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDG-NNFNDFKNKKLTT 939

Query: 958  IKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTG 1017
            +KTINF++LPK+L+IHLSRFYYDLTKKN+ V++YPL+LNI+LKN + ++Y+L+ +VNHTG
Sbjct: 940  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTG 999

Query: 1018 NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFY 1077
             LISGHYTSLVNKD  HN+     KWYYFDDEVVKA+K HG+ DK + K+SS + YVLFY
Sbjct: 1000 TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFY 1057

Query: 1078 ERV 1080
            ERV
Sbjct: 1058 ERV 1060

 Score =  277 bits (708), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 186/282 (65%), Gaps = 14/282 (4%)

Query: 268 SDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDG---------DTLGDDIY 318
           S  E   +  SP+WTAP+L+PNDQLKLAL  E++  P     G           L +D+ 
Sbjct: 174 SSTEEDADQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVP 233

Query: 319 YETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKN--YFD-GSNAFI 375
           Y         +   + F ++ A+R +THRKDSYHS+YM+D D   S N    D  ++ FI
Sbjct: 234 YTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFI 293

Query: 376 QGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLW 435
           Q LE LQKQSIITAPELF+ILSN  E  KLLLIDLR+ +RS  N+IVAPN+V IDP  LW
Sbjct: 294 QSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLW 353

Query: 436 DNEANSPIYKDTILEQRL-NNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS 494
           D + N P+Y+D ILEQ L  N  F  R K+ Y+V YSD+KT+M   +DYSFI FYLL TS
Sbjct: 354 DKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTS 413

Query: 495 GK-HLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPY 535
            K  L++VPTALLGGYEKWKK ++TY  QY I +DDYLYRPY
Sbjct: 414 QKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPY 455

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 79/117 (67%), Gaps = 1/117 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           FTPE+S +LL +++ +Y ++I+  +P                + E Y+  +  +  + A+
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
             F+ GC+Y++L++P+S+QFQTR+KSYS+Y++L+ +YE+++NMTNV+ MVK+E+  +
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVV 124

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  508 bits (1307), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 329/502 (65%), Gaps = 29/502 (5%)

Query: 607  IRPPAKLPIHALHSPR-NQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQS 665
            I  P +  +H+L + + N  + R FSIP +EK+ N YV+ S+TGLRNLGNTCYIN MLQ 
Sbjct: 711  IHSPLENQVHSLDTHKQNGAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQC 770

Query: 666  LFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICN 725
            LFAT E +N+F+S KY +Y M  +      +S +F  LF KMYMNGGC+VVP+GFLK CN
Sbjct: 771  LFATTEFRNIFLSHKYEKY-MDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCN 829

Query: 726  FLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKK 785
             LRPDLRIPDDQQDTQEFL+ IL+RLHDELSNQ  V              M V   +Y K
Sbjct: 830  ILRPDLRIPDDQQDTQEFLMLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIK 889

Query: 786  WFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSG 845
            W++++V +NGLSP+D VFQGQ E+ L CQRCG  S  YSTFY+LSLA+PK S  AF K  
Sbjct: 890  WYNESVKSNGLSPIDHVFQGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIK 949

Query: 846  RVKLEDCINMFTSDEVLTGENAWDCPKCGSKAV--EPRFTSRTSTQ------TILPNSPH 897
            RV LEDCI MFT+DE+L+ ENAWDCP+CGS A   EP    R               S  
Sbjct: 950  RVNLEDCIKMFTNDEILSDENAWDCPRCGSAAPKQEPIHRHREKKHIHDISPPPRSPSSP 1009

Query: 898  HHKKSKFFGLPTGKAISRSKSPFRKL-GLLEKHEGKQEKLDKMERDEIEEWHKMK----- 951
              +  +FF L   + + RS SP R L G     +  +E  +   R   E     K     
Sbjct: 1010 EPRSKRFFLLNAPREVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQNH 1069

Query: 952  -------------SKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIV 998
                         S K+VTIK++NF+  P++L+IHLSRFYYDLTKKN+ V++YPL LNI 
Sbjct: 1070 TTPNGRAGRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNIS 1129

Query: 999  LKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHG 1058
            LKN E+ RYKLY +VNHTG L+SGHYTSLVNKD  H LG+ +QKW+YFDDE+VK EK HG
Sbjct: 1130 LKNGEVARYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHG 1189

Query: 1059 NVDKGITKVSSKNVYVLFYERV 1080
            +++ G+T +SS +VYVLFY+R+
Sbjct: 1190 DIEGGVTSISSSHVYVLFYQRI 1211

 Score =  235 bits (599), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 113/211 (53%), Positives = 156/211 (73%), Gaps = 2/211 (0%)

Query: 340 ANRLITHRKDSYHSIYMIDDDNNNSKNY-FDGSNAFIQGLERLQKQSIITAPELFSILSN 398
            +R +THRKDSYHS+YM +D N ++ N+ +D ++ +I+ LE +QKQ +IT PELFS+LSN
Sbjct: 446 VDRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLLSN 505

Query: 399 PEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLF 458
             ER K+LLIDLR  +R + NHIVAPN++ ++P  LWD+  N+P+Y    LEQ +NNPLF
Sbjct: 506 NVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINNPLF 565

Query: 459 NGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTT-SGKHLSSVPTALLGGYEKWKKVMN 517
           + R  + Y+VYYSDMKTYMN  +DY F LFYLL T + K + S+PT+LLGGYEKW KV+N
Sbjct: 566 SKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYKVIN 625

Query: 518 TYVSQYQIELDDYLYRPYAPSNNKGEQNNAQ 548
           +YV+QY I ++DY+YR  A ++     NN +
Sbjct: 626 SYVNQYSITMNDYVYRKDAGASAGRPLNNNE 656

 Score =  102 bits (254), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 139/308 (45%), Gaps = 50/308 (16%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCV-DVDTSKAV 62
           +TPE+S +LL  +Q+IY +E +  +P                + E Y   + D     A+
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             FI G FY+Y ++P+S QF T+++ Y +Y EL++LYE +LNMTNV++MVK E+ +I   
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKI--- 126

Query: 123 CDNFQDNEGVDDSKPLGNNLKG---ADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDEL 179
                          L +N K    + N L    + I R  A+S+  P+  +  SL ++ 
Sbjct: 127 ---------------LDSNYKSQNESSNNLFVDSKFIRRERAFSV--PNASNPFSLMNDT 169

Query: 180 PEHRSEQQTRFPSVERDQSNGM-----KADMLLEKKQSRTKSNPITNINQPRKSLDVTLN 234
                       S++    N M      +  +L  K +    +   N   P  +  +TL 
Sbjct: 170 ------------SLDSQLDNSMDTLNTSSTTVLSNKGTSAGPSFSNNSVTPNPTFRITLA 217

Query: 235 ANNEIPTLSLHSDDKAVFDQHNEAKSLP----GTATDSDEEYYVE---HGSPIWTAPDLD 287
            +     +S + ++       N +  LP         SD EY +E     SP+WTAP LD
Sbjct: 218 KDAN--NMSANGNNSNSNSGINSSLQLPRYQYTNEVHSDVEYSIEDTDESSPLWTAPQLD 275

Query: 288 PNDQLKLA 295
             +QLKLA
Sbjct: 276 SKNQLKLA 283

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  503 bits (1295), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 264/492 (53%), Positives = 332/492 (67%), Gaps = 50/492 (10%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY--Q 685
            R ++IPTIE++ N YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS KY+ Y   
Sbjct: 589  RAYNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQP 648

Query: 686  MKPNDNKESA-ISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFL 744
            ++ N +  S  +SN+ + LFNKMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL
Sbjct: 649  IRSNGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 708

Query: 745  LFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQ 804
            + +L+RLHDELS+Q +V              + V   +YK WFDK V+ NG+SP+D +FQ
Sbjct: 709  MILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 768

Query: 805  GQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSG-----RVKLEDCINMFTSD 859
            GQMEN+LQC+RCGY + NYSTFYVLSLA+P+ S     K G     RVKLEDCINMFTSD
Sbjct: 769  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM-KLSKLGRSTEKRVKLEDCINMFTSD 827

Query: 860  EVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSP----HHHKKSKFFGLPTGKAISR 915
            EVL+GENAWDCP+CG  A      S +++ + L N P       KKS+FF L TG    R
Sbjct: 828  EVLSGENAWDCPRCGPTA------SVSTSVSALENEPSIVKSKKKKSRFFTLHTG--TKR 879

Query: 916  SKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKM------------------------- 950
                F   G+ E H          ER+      +M                         
Sbjct: 880  RHLDFFGDGITEGHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSS 939

Query: 951  --KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYK 1008
              K+KKL T+KTINF++LPK+L+IHLSRFYYDLTKKN+ VV+YPL+LNI+LKN + ++YK
Sbjct: 940  DYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYK 999

Query: 1009 LYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVS 1068
            L+ +VNHTG LISGHYTSLVNKD  HN+     KWYYFDDEVVKA++ HG+ DK + K+S
Sbjct: 1000 LFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL-KIS 1057

Query: 1069 SKNVYVLFYERV 1080
            S +VYVLFYERV
Sbjct: 1058 SSDVYVLFYERV 1069

 Score =  267 bits (683), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 209/315 (66%), Gaps = 29/315 (9%)

Query: 238 EIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALG 297
           ++ +LSL   D A    H     L GT T+ D     E  SP+WTAP+L+PNDQLKLAL 
Sbjct: 164 QVASLSL---DTAAPQDH----GLKGTFTEDD----AEQSSPVWTAPNLEPNDQLKLALL 212

Query: 298 TELLSPPV---------MGLDGDTLGDDIYYETVSKGDDVSYRGKD--FEDLHANRLITH 346
            E++  P          + +    L +D+   ++   DD S+   +  F ++ A+R +TH
Sbjct: 213 PEVIPTPAFREPERKTSVPVRPSVLLEDV--PSIYHEDDTSFASLNPPFREITADRSVTH 270

Query: 347 RKDSYHSIYMIDDDN--NNSKNYFDGSN-AFIQGLERLQKQSIITAPELFSILSNPEERH 403
           RKDSYHS+YM+D  N   ++ + F+  N  FIQ L+ LQKQSIITAPELFSILSN  ER 
Sbjct: 271 RKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVERE 330

Query: 404 KLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLN-NPLFNGRL 462
           K+LLIDLR+ +RS  NHIVAPN+VN+DP  LWD + N+PIYKD ILE  L  N  F  R 
Sbjct: 331 KVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRN 390

Query: 463 KYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGK-HLSSVPTALLGGYEKWKKVMNTYVS 521
           K+DYIVYY+D+KT+M   +DY+FI FYL+ TS K  L++VPT LLGGYEKWKK +++Y  
Sbjct: 391 KFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQ 450

Query: 522 QYQIELDDYLYRPYA 536
           +Y I ++DYLYRPY+
Sbjct: 451 EYHISIEDYLYRPYS 465

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 81/120 (67%), Gaps = 1/120 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           FTPE+S +LL ++Q +Y ++I+  +P                + E Y+  +  D  + A+
Sbjct: 17  FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDAL 76

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             FI GC+Y++L++P+S+QFQTR+KSYS+YT+L+ +YE+++NMTNV+ MVK+E+  + ++
Sbjct: 77  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 136

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  499 bits (1286), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 253/459 (55%), Positives = 330/459 (71%), Gaps = 31/459 (6%)

Query: 632  IPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDN 691
            +PTIE+N N YV+ S+TGLRNLGNTCYI+ MLQ LFAT  L++LFI+ KY  Y      +
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 692  KESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRL 751
            K + +S +F+ LF KMY+NGGC+VVP+ FLK CN LRPDL+IPDDQQDTQEFL+ +L+RL
Sbjct: 669  KIN-LSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRL 727

Query: 752  HDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
            HDELS +  V+            +M V  ++YKKWF+ + ++ G+SP+D +FQGQ+EN++
Sbjct: 728  HDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSI 787

Query: 812  QCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCP 871
             CQRCGY S NYS+FYVLSLA+PK S  +F ++ RVKLEDCINMFT DEVL+GENAWDC 
Sbjct: 788  NCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCS 847

Query: 872  KCGSKAVEPRFTS-------RTSTQTILPNSPHHHKKSKFFGLPTG-KAISRSKSPFRKL 923
            +CGS++     TS        TS  T   +    ++KS+ F LP      SRS SPF   
Sbjct: 848  RCGSQSDNFVKTSHNDHHKEHTSETT---DDSKQNRKSRLFLLPKKYNPTSRSLSPF--- 901

Query: 924  GLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK 983
                   G+       E        K KSKK+ TIK++NFI +PK+L+IHLSRF+YD++K
Sbjct: 902  -------GRHSSHKSSE--------KWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSK 946

Query: 984  KNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQK 1042
            KN+ VV+YPL+LNIVLKNEE+ +Y+LY+IVNH GN + SGHYT+LVNK+ +H+LG  EQ+
Sbjct: 947  KNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQ 1006

Query: 1043 WYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
            WYYFDDEVVK E  HGN+D+G+ KVSS +VYVLFYE++D
Sbjct: 1007 WYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKID 1045

 Score =  229 bits (585), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 179/298 (60%), Gaps = 34/298 (11%)

Query: 274 VEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDI------YYETVS---- 323
            E  +PIW  P L+PNDQLKLAL       PV   D +     I       Y  +S    
Sbjct: 211 AEDTAPIWHIPSLEPNDQLKLAL-----EQPVEFSDEEIDASSISEPLGRRYSPLSPYQK 265

Query: 324 -----------------KGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMID-DDNNNSK 365
                            + D V       EDL  +R +THRKDSYHS+YM + D+ ++S 
Sbjct: 266 KRNSSISSAFLVPFPHNENDKVHDNSMLIEDLPVDRSVTHRKDSYHSVYMNNQDEESDSG 325

Query: 366 NYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPN 425
            ++  SN++IQ ++RLQKQ++IT  EL+SILS+P ER KLLL+DLR+ K S  NHI+AP+
Sbjct: 326 AHYGLSNSYIQSMDRLQKQNVITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPH 385

Query: 426 VVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSF 485
           ++ IDP  LW+ E  +PIY    L +R+NNPL +   K+DYIVYYSD++T+M  +YD+ F
Sbjct: 386 IIKIDPNLLWNEETQTPIYSFEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCF 445

Query: 486 ILFY-LLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKG 542
             FY LL+T   +L  VPT LLGG+EKWKKV+ TY  +Y I++  ++ + +A   NK 
Sbjct: 446 TFFYLLLSTKSLNLKQVPTNLLGGFEKWKKVLKTYNKEYGIDITPFIKKLHATELNKN 503

 Score = 99.4 bits (246), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (52%), Gaps = 28/180 (15%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCV-DVDTSKAV 62
           FTPE+S +LL ++   Y +EI+  FP                +LE Y+  + +    + +
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             +I GCFY+YL++P S QFQ R+KS+ +Y EL+ LY++Q NMTNV+A+VK EV  I ++
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 123 CDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSP-----SGMSTLSLHD 177
             +  + EG++                    ++I R  AYS  +P     S  S LS++D
Sbjct: 127 --SILELEGIE--------------------KVIKRDRAYSSPAPKVNNISKFSKLSIND 164

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score =  498 bits (1283), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 328/485 (67%), Gaps = 36/485 (7%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687
            R ++IPTIE++SN YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS  Y+ Y   
Sbjct: 581  RAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQP 640

Query: 688  PNDNKE---SAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFL 744
            P  ++    S +SN+   LFNKMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL
Sbjct: 641  PKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFL 700

Query: 745  LFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQ 804
            + +L+RLHDELSNQ +V              + V   +YK WFDK V+ NG+SP+D +FQ
Sbjct: 701  MILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQ 760

Query: 805  GQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSG-----RVKLEDCINMFTSD 859
            GQMEN+LQC+RCGY + NYSTFYVLSLA+P+ S     K G     RVKLEDCINMFT D
Sbjct: 761  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSM-KLSKLGRSTEKRVKLEDCINMFTDD 819

Query: 860  EVLTGENAWDCPKCG-SKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKA------ 912
            EVL+GENAWDCP+CG + +      S ++ ++  P +    KKS+FF L TG        
Sbjct: 820  EVLSGENAWDCPRCGPTASSSSASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDF 879

Query: 913  -----------------ISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKL 955
                               RS+SPF+ LG   K             D     +  K+KKL
Sbjct: 880  FGDNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFANNNNDGNNI-NDFKNKKL 938

Query: 956  VTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNH 1015
             T+KTINF++LPK+L+IHLSRFYYDLTKKN  V++YPL+LNI+LKN E ++Y+L+ +VNH
Sbjct: 939  TTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNH 998

Query: 1016 TGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVL 1075
            TG L+SGHYTSLVNKD  H++     KWYYFDDEVVKA+  HG+ DK + K+SS +VYVL
Sbjct: 999  TGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVL 1056

Query: 1076 FYERV 1080
            FYERV
Sbjct: 1057 FYERV 1061

 Score =  283 bits (724), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 147/279 (52%), Positives = 191/279 (68%), Gaps = 18/279 (6%)

Query: 274 VEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDG---------DTLGDDIYYETVSK 324
            E  SP+WTAP+L+PNDQLKLAL  E++  P+    G           L +D+ Y     
Sbjct: 180 AEQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDG 239

Query: 325 GDDVSYRGKDFEDLHANRLITHRKDSYHSIYMID-----DDNNNSKNYFDGSNAFIQGLE 379
           G   +     F ++  +R ITHRKDSYHSIYM+D     +DN++  N    ++ FIQ L+
Sbjct: 240 GASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNV--ETDEFIQSLD 297

Query: 380 RLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEA 439
            LQKQSIITAPELFSILSN  ER K+LLIDLR+ +RS  NHIVAPN+V IDP  LWD + 
Sbjct: 298 ILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKT 357

Query: 440 NSPIYKDTILEQRL-NNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGK-H 497
           N+P+Y+D ILE  L  N +F  R K++Y+VYY+D+KT+M   +DY FI FYL+ TS K H
Sbjct: 358 NTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTH 417

Query: 498 LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYA 536
           L+SVPTALLGGYEKWKK ++TY  +Y + ++DYLYRPY+
Sbjct: 418 LTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYS 456

 Score =  102 bits (253), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 81/120 (67%), Gaps = 1/120 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           FTPE+S +LL ++Q +Y ++I+  +P                + E Y+  +  +  + A+
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDAL 67

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             FI GC+Y++L++P+S+QFQTR+KSYS+YT+L+ +YE+++NMTNV+ MVK+E+  + ++
Sbjct: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  492 bits (1266), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 322/484 (66%), Gaps = 34/484 (7%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687
            + +SIPTIE+N N YV+ S+TGLRNLGNTCYIN M+Q LFA    + LFIS  Y+ Y   
Sbjct: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637

Query: 688  PNDNK---ESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFL 744
               N+      +SN+ + LFNKMY+NGGC+VVP+GFLK+ N LRPDL+IPDDQQDTQEFL
Sbjct: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697

Query: 745  LFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQ 804
            + +L+RLHDELSNQ +V              + V   +YK WFDK V+ NG+SP+D +FQ
Sbjct: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757

Query: 805  GQMENALQCQRCGYESVNYSTFYVLSLALP----KPSAPAFYKSGRVKLEDCINMFTSDE 860
            GQMEN+LQC+RCGY + NYSTFYVLSLA+P    K S        RVKLEDCINMFTSDE
Sbjct: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817

Query: 861  VLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKA-------- 912
            VL+GENAWDCP+CG  A      S ++ +          KKS+FF L TG          
Sbjct: 818  VLSGENAWDCPRCGPTASFTASASASALENESSILKSKKKKSRFFTLHTGSKRRHLDIFG 877

Query: 913  ----------------ISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLV 956
                              RS+SPF+ LG   K             D        K+KK+ 
Sbjct: 878  DSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDS-NNTGDFKNKKMT 936

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHT 1016
            T+KTINF++LPK+L+IHLSRFYYDLTKKN+ V++YPL+LNI+LKN + ++Y+L+ +VNHT
Sbjct: 937  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996

Query: 1017 GNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLF 1076
            G LISGHYTSLVNKD  H++     KWYYFDDEVVKA+K HG+ DK + K+SS +VYVLF
Sbjct: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLF 1054

Query: 1077 YERV 1080
            YERV
Sbjct: 1055 YERV 1058

 Score =  274 bits (701), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 199/313 (63%), Gaps = 25/313 (7%)

Query: 238 EIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALG 297
           ++ +LSL   D A   QHN    +P T  D D+       SP+WTAP+L+PNDQLKLAL 
Sbjct: 155 QVASLSL---DTAGPQQHN--IKVPLTEDDMDQ------SSPVWTAPNLEPNDQLKLALL 203

Query: 298 TELLSPPVMG---------LDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRK 348
            E++                    L +D+           +     F D+ A+R +THRK
Sbjct: 204 PEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDNDASTASLNPPFRDITADRSVTHRK 263

Query: 349 DSYHSIYMIDDDNNNSKN--YFDGSN-AFIQGLERLQKQSIITAPELFSILSNPEERHKL 405
           DSYHS+YM+D DN    N  + +  N  FIQ L+ LQKQSIITAPELFSILSN  ER K+
Sbjct: 264 DSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKV 323

Query: 406 LLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLN-NPLFNGRLKY 464
           LLIDLR+ +RS  NHIVAPN+V +DP  LWD + N+P+Y+D ILE  L  N  F  R K+
Sbjct: 324 LLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKF 383

Query: 465 DYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKH-LSSVPTALLGGYEKWKKVMNTYVSQY 523
           DYIVYYSD+KT+M   +DY FI FYL+ TS K  L++VPTALLGGYEKWKK +++Y  +Y
Sbjct: 384 DYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEY 443

Query: 524 QIELDDYLYRPYA 536
            I ++DYLYRPY+
Sbjct: 444 HISVEDYLYRPYS 456

 Score =  101 bits (251), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 80/120 (66%), Gaps = 1/120 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           FTPE+S +LL ++Q +Y ++I+  +P                + E Y+  +     + A+
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDAL 67

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             F+ GC+Y++L++P+S+QFQTR+KSYS+YT+L+ +YE+++NMTNV+ MVK+E+  + ++
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  496 bits (1277), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 246/451 (54%), Positives = 308/451 (68%), Gaps = 22/451 (4%)

Query: 630  FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN 689
            FSIPTIE + N YVA S+TGLRN+ NTCYIN MLQ LF+T+  +NLF+S KY  Y   P 
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP- 1145

Query: 690  DNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILN 749
              +   +S +F  LF KMYMNGGC+VVPSGFLK+CN L+PDLRIP  QQDTQEFLLF+L+
Sbjct: 1146 --EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLD 1203

Query: 750  RLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMEN 809
            +LHDELS+  +V             ++ VD  +Y KWFD+ +  NGLSP+D +FQGQMEN
Sbjct: 1204 KLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263

Query: 810  ALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWD 869
             L CQRCGY S  YSTFYVLSLALP P A AF K+ +++LEDCIN FT DEVL+ +NAWD
Sbjct: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWD 1323

Query: 870  CPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKH 929
            CP+C S +    +  +              K S  F    G   SRSK    K G   + 
Sbjct: 1324 CPRCCSPSDYMSYDHKG-----------KRKISTSFESLNGGNSSRSK--LFKFGYKMRS 1370

Query: 930  EGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVV 989
              +  K      D      K+ + K  T+K++NFI++P++L+IHLSRF YDLTKKN+ VV
Sbjct: 1371 RSEAPKFSSKLSD------KVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVV 1424

Query: 990  SYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE 1049
            SYPL+LNIVLKN E+ +++LYSIVNH G LISGHYTSLVNK+ +H + + +QKWYYFDDE
Sbjct: 1425 SYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDE 1484

Query: 1050 VVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            +VK +  HG+ D GI  VSS NVYVLFYER+
Sbjct: 1485 IVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515

 Score =  142 bits (357), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 147/544 (27%), Positives = 238/544 (43%), Gaps = 93/544 (17%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDY---MGCVDVDTSK 60
           + PE+S +L   ++++YV+ +   +                 +LE Y   +G   V+   
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEA-- 62

Query: 61  AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ 120
            +  ++ G FY+YL++P+S++F TR+ SYS+Y +L+  YES  NM NV+ +V  +V  + 
Sbjct: 63  GITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVM 122

Query: 121 EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELP 180
           +    +   EG  D K               G R   R+ AYS+ S     +  L D L 
Sbjct: 123 QL---YLSGEG--DEK--------------YGARFTGRKRAYSMQS---CDSSKLADTLG 160

Query: 181 EHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIP 240
           +          S+ER  + G          + +T+        Q  +  D   +A N  P
Sbjct: 161 KL---------SIERSSTRGTTV------FEGKTEQGAFGQQQQDDEWEDTVWSAPNLEP 205

Query: 241 TLSL-----HSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295
              L     +S   ++ D  +      G   +S  E+ V                     
Sbjct: 206 DDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV--------------------- 244

Query: 296 LGTELLSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIY 355
           L  E +S    G    +L  D    + +K +D      D  D+  +R  TH +D  + I 
Sbjct: 245 LDEEWVSERRSGFMSQSLQVD---SSDNKNNDELPSIGDHNDV-LDRFYTHGQDLRYPIC 300

Query: 356 ---MIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRL 412
              ++  +N++    ++ S+  I+ L+ L K   +T+ E  S+L          LIDLRL
Sbjct: 301 NDGVVPCENSSIMWLYESSS--IKCLDLLSK---LTSSERSSML----------LIDLRL 345

Query: 413 NKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSD 472
            KR   +HI+A NV+NIDP  LWD+E  +P+     LE  ++N LF  R ++  IV Y+D
Sbjct: 346 PKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTD 405

Query: 473 MKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLY 532
             TYM  ++D+ F+LF LL      L  V   L GGYE+WK  +        I L D+L+
Sbjct: 406 NYTYMQIDFDFVFLLFRLLYLGRPQL--VLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463

Query: 533 -RPY 535
            RP+
Sbjct: 464 KRPH 467

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  469 bits (1207), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 244/455 (53%), Positives = 312/455 (68%), Gaps = 18/455 (3%)

Query: 630  FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN 689
            FS+PTIEKN N Y+A S+TGLRN+ NTCYIN MLQ LF+T E +NLF+S KY  Y    N
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSN 787

Query: 690  -DNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFIL 748
             DN    +S +F  LF KMYMNGGC+VVPSGFLK+C++L+PDLRIP  QQDTQEFLLF+L
Sbjct: 788  MDN----MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLL 843

Query: 749  NRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808
            +RL DELS    V+             + V+ ++Y  WFD+    NGLSP+D +FQGQ+E
Sbjct: 844  DRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIE 903

Query: 809  NALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAW 868
            + L CQRC + S +YSTFYVLSLALP P + AF K+ +++LEDCIN FT DEVLTG+N W
Sbjct: 904  HQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPW 963

Query: 869  DCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFF-GLPTGKAISRSKSPFRKLGLLE 927
            DCPKCG  +   R            NS    +K+KFF G     + + ++    +L  + 
Sbjct: 964  DCPKCGVNSSGDRQM----------NSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIG 1013

Query: 928  KHEGKQEKLDKME--RDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKN 985
                 +     +   +   +   K  +KKL TIK++NFI+LP++LIIHLSRF YDLTKKN
Sbjct: 1014 SKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKN 1073

Query: 986  DAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYY 1045
            + VV+YPL+LNIVLKN E+ +Y+LYS +NH G LISGHYTSLVNKD  H +   +QKWYY
Sbjct: 1074 NTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYY 1133

Query: 1046 FDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            FDDE+VK +  HGN D+GIT VSS +VY+LFYER+
Sbjct: 1134 FDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 88/156 (56%), Gaps = 3/156 (1%)

Query: 378 LERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDN 437
           L RL + S I   +L  IL + + + ++L IDLR  KR   NHIVA +++NIDP  LWD 
Sbjct: 441 LTRLYETSSIKCSDLMIILES-DIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499

Query: 438 EANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKH 497
           E ++PI      E+RL+NPLF  R ++ Y+V Y+D  T MN ++ +    F L+      
Sbjct: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPR 559

Query: 498 LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYR 533
           L  +   L GGY++W+  + T       ++ D+++R
Sbjct: 560 L--LTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%), Gaps = 1/117 (0%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCV-DVDTSKAV 62
           + PE+S +L   +Q+ Y  +++  +P                + E Y   V +  T + +
Sbjct: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
             ++ G FY+YL++P+S++F TR+ SYSLYT+LR  YE + NMTNV+ MV E+V  +
Sbjct: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAV 121

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  437 bits (1124), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 227/458 (49%), Positives = 302/458 (65%), Gaps = 26/458 (5%)

Query: 626  LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
            ++  F  PTIE +       S+TGL+N  NTCYIN ++Q LF +   ++LF++ KYR + 
Sbjct: 270  ISETFEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFL 329

Query: 686  MKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLL 745
                  KE  +S +  +LF KMY NGG  +VP+GFLK+C  LRPDL IPDDQQDTQEFLL
Sbjct: 330  KTEEYPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLL 389

Query: 746  FILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQG 805
             IL R+H+ELSN+ NV              + V+  KY+KW+++T++A+GLSP+D +F+G
Sbjct: 390  IILARIHEELSNE-NVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRG 448

Query: 806  QMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTG 864
            QMEN L+CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN+FTSDE LTG
Sbjct: 449  QMENILKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTG 508

Query: 865  ENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLG 924
            +NAWDCP+C     + + T   S+Q          K+S  F   +    SRSKSP     
Sbjct: 509  DNAWDCPECRIDDSKLK-TGENSSQ---------KKRSPLFSFHSR---SRSKSPHHHHH 555

Query: 925  LLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKK 984
                      K            +K KSK+L TIK+++FI LP +L+IHLSRFYYDLTKK
Sbjct: 556  YHHHGSDNTTK----------NSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKK 605

Query: 985  NDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWY 1044
            N+AV++YPL+LNI+LKN ++VRYKLY  VNH+GNLI+GHYTS+VNK+  H +G  +Q W 
Sbjct: 606  NNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWV 665

Query: 1045 YFDDE-VVKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
             FDD+ +++  K     + G TK+SS  VYVLFYER+D
Sbjct: 666  TFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFYERMD 703

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 25/122 (20%)

Query: 60  KAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
           +A+  FI G +Y+YL++P+S+QFQTRS  YS Y +L++ Y+ +  M+ V+ +V++E   I
Sbjct: 57  EALTAFIIGGYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSI 116

Query: 120 QEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLH 176
            +Q         + DS              N+    ITR+ AYS+     P  M++LS+H
Sbjct: 117 VDQ--------YLSDS--------------NRITVTITRKRAYSLPLRPLPVHMASLSIH 154

Query: 177 DE 178
           ++
Sbjct: 155 NQ 156

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  432 bits (1110), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/451 (49%), Positives = 295/451 (65%), Gaps = 26/451 (5%)

Query: 632  IPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDN 691
            +PTIE +++     S+TGL+N  NTCYIN ++Q LF T   ++LF++ KYR +       
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 692  KESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRL 751
            +E  +S +   LF KMY+NGG  + P+GFLK+C  LRPDL IPDDQQDTQEFLL IL RL
Sbjct: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406

Query: 752  HDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
            H+ELSN   V                V+  KY+KW++ +V+ +GLSP+D +F+GQMEN L
Sbjct: 407  HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465

Query: 812  QCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTGENAWDC 870
            +CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN+FTSDE L+G+N+WDC
Sbjct: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525

Query: 871  PKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHE 930
            P CG+  ++ +    TS +          KKS FF   +    SRSKSP           
Sbjct: 526  PNCGTTDLKTKINESTSQK----------KKSTFFSFHSR---SRSKSPHHHHHHHHHSH 572

Query: 931  GKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVS 990
               EK  K          K  S+KL T+K+ +FI LP +L+IHLSRFYYDLT+KN+ V++
Sbjct: 573  DNTEKHSK----------KWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVIT 622

Query: 991  YPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEV 1050
            YPL+LN++LKN ++VRYKLY  VNH GNL++GHYTS VNK+ +H +G   Q W  FDD+ 
Sbjct: 623  YPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDY 682

Query: 1051 VKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
            +K +  H + + G T+VSS  VYVLFYER+D
Sbjct: 683  IK-QHHHDDFEAGKTEVSSSEVYVLFYERMD 712

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 25/129 (19%)

Query: 60  KAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
           +A+  FI G +Y+YLV+P+S+QFQTR+  YS Y +L++ Y+ +  M+ V+ +VKEE   I
Sbjct: 57  EALTAFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMI 116

Query: 120 QEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLH 176
            ++         + DS              N+  R ITR+ AYS+     P  M++LS+ 
Sbjct: 117 VDRY--------LSDS--------------NRISRTITRKRAYSLPLRPLPVHMASLSIL 154

Query: 177 DELPEHRSE 185
           ++L   R E
Sbjct: 155 NQLENPRHE 163

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  426 bits (1094), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 218/456 (47%), Positives = 298/456 (65%), Gaps = 27/456 (5%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687
            + +++P IE +++     S+TGL+N  NTCYIN ++Q LF T   ++LF++ KYR +   
Sbjct: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337

Query: 688  PNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFI 747
                KE  +S +   LF KMY+NGG  ++P+ FLK+C  LRPDL IPDDQQDTQEFLL +
Sbjct: 338  NKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIV 397

Query: 748  LNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQM 807
            L R+H+ELSN+ NV+             + V+  KY+KW+++ V+ +GLSP+D +++GQ+
Sbjct: 398  LARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQL 456

Query: 808  ENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTGEN 866
            EN L+CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN+FT DE L+G+N
Sbjct: 457  ENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDN 516

Query: 867  AWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLL 926
            AWDCP C       R T   S +  + +     KKS  FG  +    SRSKSP       
Sbjct: 517  AWDCPNC-------RITDSKSKKEEITS---QKKKSTIFGFHSR---SRSKSPHHHHHHH 563

Query: 927  EKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKND 986
               +           D  +   K  SKKL TIK+++FI LP +L+IHLSRFYYDLTKKN 
Sbjct: 564  HSSD-----------DSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNS 612

Query: 987  AVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYF 1046
             V++YPL+LNI+LKN +++RYKLY  VNH+GNLI+GHYTS+VNK+  H +G   Q W  F
Sbjct: 613  TVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTF 672

Query: 1047 DDEVVKA-EKTHGNVDKGITKVSSKNVYVLFYERVD 1081
            DD+ ++   K   N + G T++SS  VYVLFYER+D
Sbjct: 673  DDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMD 708

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 25/123 (20%)

Query: 60  KAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
           +A+  FI GC+Y+YL++P+S+QFQTR+  YS Y +L++ Y+ +  M  V+ +V++E   I
Sbjct: 57  EALTAFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVI 116

Query: 120 QEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLH 176
            ++     ++ G+                     R I R+ AYS+     P  M++LS+H
Sbjct: 117 VDRY--LAESNGI--------------------CRTIKRKRAYSLPLRPLPVHMASLSIH 154

Query: 177 DEL 179
           ++ 
Sbjct: 155 NKF 157

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  421 bits (1082), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 223/453 (49%), Positives = 298/453 (65%), Gaps = 18/453 (3%)

Query: 627  TRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM 686
            ++ F +P IE + N     S+TGLRN  NTCYIN M+Q LF+T   ++LF++ KY+ +  
Sbjct: 275  SKTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLE 334

Query: 687  KPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLF 746
                 K   +S++   LF KMY+NGG  ++P+GFLK+C  LRPDL IPDDQQDTQEFL+ 
Sbjct: 335  NEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMI 394

Query: 747  ILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806
            IL R+H+ELSN  NV              + V+  KY+KW ++TV+++GLSP+D +FQGQ
Sbjct: 395  ILARIHEELSNN-NVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQ 453

Query: 807  MENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTGE 865
            MEN L+CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN FTSDE L+ +
Sbjct: 454  MENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDD 513

Query: 866  NAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGL 925
            NAWDCPKC +   + +     S +          K+S  F L +     RSKSP  +   
Sbjct: 514  NAWDCPKCRTAEYKLKKDENLSQK----------KRSILFNLHSR---PRSKSPRHRHHH 560

Query: 926  LEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKN 985
                    +   K   D  +   K KSKKL TIK+++FI LP +L+IHLSRFYYDLTKKN
Sbjct: 561  HHHRHKNDDA--KKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKN 618

Query: 986  DAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYY 1045
            + V++YPL+LNI+LKN ++VRYKLY+ VNH+GNLI+GHYTS+VNK+  H +G   Q W  
Sbjct: 619  NTVITYPLILNIILKNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVT 678

Query: 1046 FDDEVVKA-EKTHGNVDKGITKVSSKNVYVLFY 1077
            FDD+V+K   K   + + G T++SS  VYVLFY
Sbjct: 679  FDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (56%), Gaps = 25/122 (20%)

Query: 61  AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ 120
           A+  FI G FY+YLV+P S+QFQTR+  YS Y +L++ Y+ +  M+ V+ +VK+E   I 
Sbjct: 58  ALTAFIVGGFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIV 117

Query: 121 EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLHD 177
           +QC        + DSK +  ++K              R+ AYS+     P  M++LS+H+
Sbjct: 118 DQC--------LSDSKRISRSMK--------------RKRAYSLPLRPLPVHMASLSIHN 155

Query: 178 EL 179
           +L
Sbjct: 156 QL 157

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  391 bits (1004), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/467 (46%), Positives = 287/467 (61%), Gaps = 43/467 (9%)

Query: 619  HSPRNQTLTR--KFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLF 676
            H P+ + +TR  K+ +P +  +SN YV  S++GLRNLGNTCYIN MLQ LFAT   +NLF
Sbjct: 416  HRPK-RIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLF 474

Query: 677  ISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD 736
            +S +Y+EY     D     +SN+F  LF KMY+NGGC V+P  FLK CNFLRPDLRIPD 
Sbjct: 475  LSNRYKEYIGTKVD---PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDV 531

Query: 737  QQDTQEFLLFILNRLHDEL-SNQVNVIXXXXXXXXXXXXKMMVD-KEKYKKWFDKTVVAN 794
            QQDTQEFL+ +L++LH+EL SNQ  ++             M V+   +YKKWF +++   
Sbjct: 532  QQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENE 591

Query: 795  GLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCIN 854
            GLS +  +FQGQ+EN+L+CQRC Y S NYS F  LSL++P      F K   V LEDCI+
Sbjct: 592  GLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRR-KFRK--LVDLEDCIS 648

Query: 855  MFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAIS 914
            +F  +E+LTGENAW+CPKC S +                 +    K   FF     K  S
Sbjct: 649  LFIENEMLTGENAWNCPKCSSSSNN---------------NTSKRKSRGFFKFSKHKNRS 693

Query: 915  RSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHL 974
             +   F +      H    + +            K   KKLVT K+ +FI LP +LIIHL
Sbjct: 694  HNDLTFSEYN----HNSSSDDV------------KFSKKKLVTRKSTSFIKLPNLLIIHL 737

Query: 975  SRFYYD-LTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            SRF    L  KN+  ++YP +L I LKN+E  R+KLY +VNH GNL +GHYTSL+NK+P 
Sbjct: 738  SRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPS 797

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            H+L    QKW+YFDDE VK +  + ++DK + ++SS +VYVLFYE++
Sbjct: 798  HDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 141/281 (50%), Gaps = 51/281 (18%)

Query: 262 PGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYET 321
           P + +  +E+   +  + IW AP L+PNDQLKLA+ +              +        
Sbjct: 130 PSSHSQHEEDNTADSSTTIWQAPFLEPNDQLKLAIISSESELESETEVEAEI-------- 181

Query: 322 VSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERL 381
                          D++AN       +S ++ ++ D   N+   Y          L+ L
Sbjct: 182 ---------------DINAN-------ESKYTNFINDKTINDEDTY----------LKHL 209

Query: 382 QKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANS 441
            ++  IT  ELFSILSNP +R K+L+IDLRL++      I +PN++  DP  LW+N   +
Sbjct: 210 YEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNNRDQT 269

Query: 442 PIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFE-YDYSFILFYLLTTSGKHLSS 500
           P+   T L    +NPLF     + YI+ YSD +T   FE ++Y+F  F LL +S   +  
Sbjct: 270 PVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSS--MKV 324

Query: 501 VPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNK 541
            P  LLGG+EKW++++++Y  QY IE  +Y++     +NNK
Sbjct: 325 TPNFLLGGFEKWEQLISSYSEQYGIETSNYIF-----TNNK 360

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 65  FITGCFYIYLVMPES--MQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
           FI G FYI LV+P S  M   + +   ++Y +L+  YESQ N+++++ +++ E   I + 
Sbjct: 65  FIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQS 124

Query: 123 CD 124
            D
Sbjct: 125 FD 126

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  370 bits (949), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/468 (44%), Positives = 286/468 (61%), Gaps = 43/468 (9%)

Query: 628  RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS-GKYREYQM 686
            +K ++P I+   N     S+ GLRN GNTCYIN M+Q LF T  L++LFIS   Y+++  
Sbjct: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK 277

Query: 687  KPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLF 746
            K   + E+ IS  FA L   MY NGG +V+P  FL+  + LRPDL IP DQQDTQEFL+ 
Sbjct: 278  K---DAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVI 334

Query: 747  ILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806
            +L+ LHDEL    ++I            K      +Y  W    + ANG SP+D +FQGQ
Sbjct: 335  LLDILHDELVYTDDLISNNYVSDDINLGK------EYMPWLQNNLKANGKSPIDLIFQGQ 388

Query: 807  MENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGEN 866
            +EN LQCQRCG  S NYS FY+LSLA+PK +        RVKLEDCIN FTSDE+LTGEN
Sbjct: 389  IENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKEN--SKNRVKLEDCINFFTSDEILTGEN 446

Query: 867  AWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSK------FFGLPTGKAISRSKSPF 920
            AW+CPKC    +E      T  +   P +  +  K+K      FF L   K +S S    
Sbjct: 447  AWNCPKCCPTTIE------TYDEADSPATVENRVKNKSINPLNFFKL--HKVLSPSSG-- 496

Query: 921  RKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYD 980
                    +  +        + + +  +K K++KL+T+K +NFI LP +L+IHLSRFYY+
Sbjct: 497  --------NHHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYN 548

Query: 981  LTKKNDAVVSYPLVLNIVLKNE-EIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNT 1039
             TKKN+AV++YPL+LNI++KN  ++V+YKLY ++NH G L  GHYTS+VNKD +H+L   
Sbjct: 549  STKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLN 608

Query: 1040 EQKWYYFDDEVVKAEKTHGNVDKGIT------KVSSKNVYVLFYERVD 1081
            EQ+WY FDDEV+K   ++  ++K  +      +  S  VYVLFYER++
Sbjct: 609  EQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 43/63 (68%)

Query: 60  KAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQI 119
           +A   F+ G FY++L++P  +QFQT++K ++ Y +L+  YE Q++M N++  VKE+   I
Sbjct: 80  QATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSI 139

Query: 120 QEQ 122
            EQ
Sbjct: 140 LEQ 142

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  340 bits (872), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/472 (37%), Positives = 270/472 (57%), Gaps = 24/472 (5%)

Query: 611  AKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATN 670
            AK PI   H       ++++++P I          SV G+RN+GNTCY+N MLQ LF + 
Sbjct: 182  AKSPIDIDHD------SKQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGST 235

Query: 671  ELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPD 730
            + ++LF++ K+  ++ + N    S I+N  + LF KMY NGGC ++P  F++ C  LRPD
Sbjct: 236  QFRDLFLTDKFEMFKAETNSESLS-IANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPD 294

Query: 731  LRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKT 790
             +IP  QQDTQEFL+F+L RL  EL+N    +            + +   + Y +W+++ 
Sbjct: 295  FKIPHCQQDTQEFLMFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEM 354

Query: 791  VVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLE 850
            +  N LSP+D +F+G +E+ L C+ C   +  +S+FY+LSL +PK  +  F+KS  ++LE
Sbjct: 355  ISRNNLSPIDLLFRGDVESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLE 414

Query: 851  DCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG-LPT 909
            DCIN+FT  E+LTGEN+W CP C +KA      +  + Q    N   H K  +FF  +  
Sbjct: 415  DCINLFTRKEILTGENSWACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEA 474

Query: 910  GKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIE-EWHKMKSKKLVTIKTINFISLPK 968
            GK               E++ G   K  +++ D +E E    + KK  TI +++F+SLP 
Sbjct: 475  GKT--------------ERNSGAN-KFSQLKYDNLENEQRHRQQKKSETILSVSFVSLPP 519

Query: 969  VLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLV 1028
            +L+IHLSRF YD++KKN + +SYP+ L +   +   V Y+LY  +NH G+   GHYT+LV
Sbjct: 520  ILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALV 579

Query: 1029 NKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            NK+ +H      QKW  FDD++V            I  +++ + YVLFYER+
Sbjct: 580  NKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 65  FITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLY----ESQLNMTNVIAMVKEEVAQIQ 120
           +  GCFYIYL++P + QFQ     Y  Y +L++ Y    E  L    ++  V+E+    Q
Sbjct: 67  YAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLTFQYLLDRVREKCRTSQ 126

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  223 bits (567), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 133/298 (44%), Positives = 183/298 (61%), Gaps = 31/298 (10%)

Query: 274 VEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYETVS---------- 323
           ++  +P+WTAP L+PNDQLKLAL       P + LD + L D   +  +           
Sbjct: 190 LDDSTPLWTAPSLNPNDQLKLALEQ-----PELTLD-EQLSDKTQHNLIDDKYNNFTIPL 243

Query: 324 --------KGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYF---DGSN 372
                   K  D ++  K  +    +R  THRKDSYHS+YM   DN+NS  Y    D +N
Sbjct: 244 PHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYM---DNDNSAGYVRKNDEAN 300

Query: 373 AFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPT 432
            +IQ LERLQKQ++IT PELFSILS+P  +  +LLI L L +R+ +N+IVA N +NIDP 
Sbjct: 301 NYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPN 360

Query: 433 NLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLT 492
            LWD E N PI +DT LE+ LN+ LFN R  + Y+VYY+D+KTYM   +DY+F LFYLLT
Sbjct: 361 VLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLT 420

Query: 493 TSGKH-LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNNAQI 549
           +S    L + PT+LLGG EKWKKV+ TY  +  I   +YL++ +  + ++ E + + I
Sbjct: 421 SSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNIDQKEGDRSNI 478

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 94/181 (51%), Gaps = 8/181 (4%)

Query: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPXXXXXXXXXXXXXXXCMLEDYMGCVDVDT-SKAV 62
           FTPE+S +L  ++Q IY ++I+P  P                +LE +   +       A+
Sbjct: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70

Query: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122
             +I GC+Y+YL++P+S QFQT++KSYS+Y + + LY+++ NMTNV +MV+ EV  I ++
Sbjct: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130

Query: 123 CDNFQDNEGVDDSKPLGNNLKGADNM---LNQGKRLITRRSAYSISSPSGMSTLSLHDEL 179
              +Q+ E      P G      D+     N  +  I  R + +   P  M+    +D L
Sbjct: 131 S--YQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMA--KPYDSL 186

Query: 180 P 180
           P
Sbjct: 187 P 187

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
            Ashbya gossypii AFR007W
          Length = 851

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 124/501 (24%), Positives = 201/501 (40%), Gaps = 106/501 (21%)

Query: 597  ESAPSDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSV---TGLRNL 653
            +S+P  N+  +  P+  P+      RN+      S+ +  +      A+++    GL N 
Sbjct: 437  KSSPQSNTSNLLNPSASPLK-----RNENSVGFSSMKSPGQEWAMLTAFNLNFSVGLVNC 491

Query: 654  GNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNKMYMNG- 711
            GN+CY++C++Q L  T EL  +F++  Y+ +  +      +  ++  F+ L ++MY  G 
Sbjct: 492  GNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQMYQQGK 551

Query: 712  ---------GCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
                        V+P+ F   C  +    R    QQD QEF  F+L+ LH++L+   N  
Sbjct: 552  DIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDLNQCGNNP 610

Query: 763  XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                        + M+          +  +    S +  +FQGQ  + L+C+ CG  S  
Sbjct: 611  PLKELSEKAEKMREMMPMRIASSIEWERYLTTDFSVIVDLFQGQYASQLRCKVCGRTSTT 670

Query: 823  YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRF 882
            Y  F VLS+ +P         S +  + DC   FT  E L  +  W CP C  +      
Sbjct: 671  YQPFSVLSVPVP--------SSRQCTIIDCFTEFTKVETLDLDEQWSCPDCKKRQ----- 717

Query: 883  TSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERD 942
                                     P+ K I+ ++ P R L +                 
Sbjct: 718  -------------------------PSTKKITITRLP-RNLII----------------- 734

Query: 943  EIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFY---YDLTKKNDAVVSYPLVLNIVL 999
             ++ +  M +K  V      F+S   VL  +L+ F+   YD    N+  V  P    +  
Sbjct: 735  HLKRFDNMLNKNNV------FVSYSAVL--NLTSFWANDYDKKVMNNNNVELPSRGQVPP 786

Query: 1000 KNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGN 1059
             N     Y+LY +  HTG L  GHYT+ VNK     LG     W Y+DD       T+  
Sbjct: 787  FN-----YQLYGVACHTGTLYGGHYTAYVNKGA--TLG-----WCYYDD-------TNWR 827

Query: 1060 VDKGITKVSSKNVYVLFYERV 1080
              +   +  S+N YVLFY R+
Sbjct: 828  QIRSSNEYISQNAYVLFYHRI 848

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 4/148 (2%)

Query: 381 LQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEAN 440
           ++  S I++  L ++++ P     +LLID+R     +  HI   +++ I+P +  D+ ++
Sbjct: 153 VENGSSISSLMLHNLITTPATATSVLLIDIRPRVDFVNFHIKFESLICIEPVSFKDSHSD 212

Query: 441 SPIYKDTILEQRLNN-PLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLS 499
             I K +++    N   LF  R K++YI+ Y+      ++      +L  LL       S
Sbjct: 213 IDIAKKSMITSPDNEIALFQERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKS 272

Query: 500 SVPTALL---GGYEKWKKVMNTYVSQYQ 524
              T +L   GG+  W          +Q
Sbjct: 273 LYNTKILTLDGGFSSWSTAYPNLCESFQ 300

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  118 bits (296), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 137/295 (46%), Gaps = 44/295 (14%)

Query: 619 HSPRNQTLTRKFSIPTIEKNSNPYVA-----YSVTGLRNLGNTCYINCMLQSLFATNELK 673
           H P N T+T       I ++SN Y       + V GL N+GN+CY+NC++Q L   +EL 
Sbjct: 709 HHPNNTTMT-------ISQSSNGYTPDLDLDFKV-GLENMGNSCYLNCIIQCLLNNHELT 760

Query: 674 NLFISGKYREY-QMKPNDNKESAISNTFANLFNKMYMNGGCT-----------VVPSGFL 721
            +F++  Y ++  +      +  ++ +FA L + MY NG  +           V P  F 
Sbjct: 761 KMFLNNSYEKHININSKLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFK 820

Query: 722 KICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNV---IXXXXXXXXXXXXKMMV 778
             C  +   L    +QQD QEF  F+L+ LH++L NQ      +            K+ +
Sbjct: 821 TACGSIN-SLFKGSNQQDCQEFCQFLLDGLHEDL-NQCGANPPLKELSTEAERMREKLSL 878

Query: 779 DKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSA 838
                 +W  +  +    S +  ++QGQ  + L+CQ CG  S  Y TF VLS+ +P    
Sbjct: 879 RIASSIEW--ERFLTTDFSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVP---- 932

Query: 839 PAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILP 893
               K+  + L DC N FT  E L  +  W C +C  K  +P  +++T T T LP
Sbjct: 933 ----KNKSIHLLDCFNEFTKTEFLGKDELWSCTECKKK--QP--STKTLTITRLP 979

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 79/163 (48%), Gaps = 37/163 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K + + +DE+    + K KK  + KT+    LPK LIIHL RF  ++  KN+  V YPL+
Sbjct: 948  KTEFLGKDELWSCTECK-KKQPSTKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLI 1005

Query: 995  LNIV-------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++                 EE+         +Y+L  +  H G+L  GHYT+ VNK   
Sbjct: 1006 LDLTNYWANDFDGKLPPGVTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKG-- 1063

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLF 1076
                  +  WYYFDD V ++ K         +++ ++N YVLF
Sbjct: 1064 -----LKNGWYYFDDTVYRSIKYS-------SEMITQNAYVLF 1094

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 112/250 (44%), Gaps = 23/250 (9%)

Query: 638 NSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAI 696
           ++N Y      GL N+GN+CYINC++Q L  T+EL N+F++  Y R   M      +  +
Sbjct: 453 SANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNSRLGSKGVL 512

Query: 697 SNTFANLFNKMYMNG-------GCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILN 749
           +  FA L + MY N        G  V P  F   C  +    R    QQD QEF  F+L+
Sbjct: 513 AKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQDCQEFCQFLLD 571

Query: 750 RLHDELSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806
            LH++L NQ      +            K+ +      +W  +  +    S +  +FQGQ
Sbjct: 572 GLHEDL-NQCGGNPPLKELSDEAEKMREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQ 628

Query: 807 MENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGEN 866
             + L+CQ CG  S  Y  F VLS+ +P   +          + DC   FT  E L  + 
Sbjct: 629 YASQLRCQVCGLTSTTYQPFSVLSVPVPHAKS--------CNIIDCFKEFTKVEKLETDE 680

Query: 867 AWDCPKCGSK 876
            W CP+C  K
Sbjct: 681 QWSCPRCKKK 690

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 78/167 (46%), Gaps = 37/167 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++K+E DE     + K K+  T K +    LP+ LIIHL RF  ++  KN+  V YP  
Sbjct: 672  KVEKLETDEQWSCPRCKKKQPST-KKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFT 729

Query: 995  LNIV--------------LKNEEIVR-------YKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++               +  E   R       YKLY I +H G+L  GHYTS V+K P 
Sbjct: 730  LDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGP- 788

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                  ++ W YFDD   +         +  T+  + N YVLFY RV
Sbjct: 789  ------KRGWCYFDDTSFRPV-------RNATECITPNAYVLFYHRV 822

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 124/277 (44%), Gaps = 25/277 (9%)

Query: 614 PIHALHSPRNQTLTRK---FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATN 670
           P   + SPR   L ++    S  TI  NS       + GL N+GN CY+NC+LQ L  T+
Sbjct: 409 PASNVFSPRIPPLPQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYMNCILQCLVGTH 468

Query: 671 ELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNKMYMNGGCT--------VVPSGFL 721
           +L  +F+   Y  +     +   +  ++  FA L N M+ +G  T        V    F 
Sbjct: 469 DLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVRTIPVQTIQFK 528

Query: 722 KICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNV--IXXXXXXXXXXXXKMMVD 779
           KIC  + P +     QQD QEF  F+L+ LH++L+   +   +            KM + 
Sbjct: 529 KICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIR 587

Query: 780 KEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAP 839
           K    +W  +  +    S +  +FQGQ  + LQCQ C + S  Y TF VLS+ +P+    
Sbjct: 588 KASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKT- 644

Query: 840 AFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
                    + DC   FT  E L  +  W CPKC  K
Sbjct: 645 -------CNILDCFREFTKCERLGVDEQWSCPKCLKK 674

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 80/168 (47%), Gaps = 36/168 (21%)

Query: 934  EKLDKMERDEI-EEWHKMKS-KKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSY 991
             +  K ER  + E+W   K  KK  + K +    LPK LII+L RF   + K N+  V Y
Sbjct: 652  REFTKCERLGVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQY 710

Query: 992  PLVLNI-----------VLKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDP 1032
            P  L++            + NE+I         RY+LY +  H+G+L  GHYTS V K P
Sbjct: 711  PYSLDLTPYWARDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGP 770

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                   ++ WY+FDD + +            T+  + + YVLFYER+
Sbjct: 771  -------KKGWYFFDDSLYRPITFS-------TEFITPSAYVLFYERI 804

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 4/121 (3%)

Query: 405 LLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLK 463
           LLLID+R     +  HI   N++ IDP +  D+  +  I   +++    ++   F+ R K
Sbjct: 163 LLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNRDK 222

Query: 464 YDYIVYYSDMKTYMNFEYDYSFILFYLLTTSG--KHLSSVPTALL-GGYEKWKKVMNTYV 520
           + +I+ Y+D + + NF+   + IL  +L+ +   K LS     +L  G+  W K+   Y 
Sbjct: 223 FKFIILYTDTQLHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLGGAYQ 282

Query: 521 S 521
           S
Sbjct: 283 S 283

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  114 bits (286), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 139/305 (45%), Gaps = 38/305 (12%)

Query: 592 LESIEESAPSDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVT--- 648
           ++SIE   PS  S  ++P   L   A   P +Q+L    S+P +   S+   +Y+ +   
Sbjct: 550 IKSIENYKPSSGST-MKP--LLLKSATSKPPSQSLP---SLPQLPSASDTLKSYTNSDKD 603

Query: 649 -----GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFAN 702
                GL N+GN+CY+NC++Q L +++E   +F++  Y ++  +K     +  ++  FA 
Sbjct: 604 YDFSIGLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFAR 663

Query: 703 LFNKMYMNGG--------CTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
           L N MY  G           V P+ F   C  +    R  D QQD+QEF  F+L+ LH++
Sbjct: 664 LINTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHED 722

Query: 755 LSNQVNV---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
           L NQ      +            K+ +      +W  +  +    S +   FQGQ  + L
Sbjct: 723 L-NQCGANPPLKELSPNAEKMREKLSLRIASSIEW--ERYLTTDFSVIVDQFQGQYASQL 779

Query: 812 QCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCP 871
           +C+ CG  S  Y  F VLS+ +P+  +          + DC N FT  E L  +  W CP
Sbjct: 780 RCKVCGGTSTTYQAFSVLSVPVPRGKS--------CNIIDCFNEFTKVENLETDELWACP 831

Query: 872 KCGSK 876
            C  K
Sbjct: 832 HCKKK 836

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 77/167 (46%), Gaps = 38/167 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++ +E DE+      K KK  + K +    LP+ LIIHL RF  ++  KN+  V YP +
Sbjct: 818  KVENLETDELWACPHCK-KKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNIFVKYPFL 875

Query: 995  LNIVL-------------KNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++                 EE+          YKL ++  H G+L  GHYTS V+K   
Sbjct: 876  LDLTPYWANDFDGRLPPGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKG-- 933

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
               G     W YFDD  ++  K   N  + IT     N YVLFY RV
Sbjct: 934  -KFG-----WRYFDDTKIRPLK---NSYECIT----SNAYVLFYHRV 967

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YDR069C (DOA4) and YER144C
            (UBP5)
          Length = 848

 Score =  114 bits (284), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 165/418 (39%), Gaps = 98/418 (23%)

Query: 648  TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNK 706
             GL N GN+CY++C++Q L  T EL  +F++  Y+ +  +      +  ++  F+ L ++
Sbjct: 488  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQ 547

Query: 707  MYMNG----------GCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS 756
            MY  G             V+P+ F   C  +    +  + QQD QEF  F+L+ LH++L+
Sbjct: 548  MYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDLN 606

Query: 757  NQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRC 816
               N              + M+          +  +    S +  +FQGQ  + LQC+ C
Sbjct: 607  QCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQCKVC 666

Query: 817  GYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
               S  Y  F VLS+ +P         +    L DC   FT  E L  E  W CP C  +
Sbjct: 667  QRTSTTYQPFSVLSVPVP--------STRTCTLTDCFTEFTKIETLEQEEQWSCPSCKKR 718

Query: 877  AVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKL 936
                                           P+ K I+ ++ P R L +           
Sbjct: 719  Q------------------------------PSTKKITITRLP-RNLII----------- 736

Query: 937  DKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFY---YDLTKKNDAVVSYPL 993
                   ++ +  M +K  V      F+S P VL   L+ F+   YD    N+       
Sbjct: 737  ------HLKRFDNMLNKNNV------FVSYPSVL--DLTAFWANDYDKKVTNN------- 775

Query: 994  VLNIVLKNEEIV---RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDD 1048
              N+ L +   V    Y+LY I  H G L +GHYT+ VNK     LG     W Y+DD
Sbjct: 776  --NVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNKGAV--LG-----WCYYDD 824

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 71/153 (46%), Gaps = 12/153 (7%)

Query: 323 SKGDDVSYRGKDFEDLH---ANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLE 379
           +K D V   GK   +++    NRL+  + D    I     +N  S+   +  N  I G+E
Sbjct: 99  AKSDAVDRTGKQLLEIYNMLVNRLV--KDDRIAEIKRFVKEN--SRRDPEAKNEQI-GVE 153

Query: 380 RLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEA 439
             +    I A  L ++L  P     +LL+D+R     M  HI + +++ I+P +  ++  
Sbjct: 154 SGKS---IPATLLRNLLMGPSASGTVLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYT 210

Query: 440 NSPIYKDTILEQ-RLNNPLFNGRLKYDYIVYYS 471
           +  + K +++        LF  R K+DYIV Y+
Sbjct: 211 DIDLGKKSMITSPDAEIALFQDRDKFDYIVVYT 243

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 111/242 (45%), Gaps = 22/242 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
           + GL N+GN+CY+NC++Q L   NEL  +F+   + +Y  +      +  ++  F+ L +
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 706 KMYMN------GG--CTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
            MY N      GG    V P+ F   C  +    +    QQD QEF  F+L+ LH++L N
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDL-N 736

Query: 758 QVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQ 814
           Q      +            K+ +      +W  +  +    S +  +FQGQ  + LQC+
Sbjct: 737 QCGGNKRLAELTEEAENLREKLSLRIASSIEW--ERFLTTDFSVIGDLFQGQYASRLQCK 794

Query: 815 RCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            CG  S  Y  F VLS+ +P           +  + DC + FT  E L  +  W CP+C 
Sbjct: 795 TCGKTSTTYQPFSVLSIPVPSKHI------SKCSIIDCFDEFTKVENLEVDEQWSCPRCK 848

Query: 875 SK 876
           SK
Sbjct: 849 SK 850

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 78/166 (46%), Gaps = 36/166 (21%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++ +E DE     + KSK+  T K +    LP+ LIIHL RF   L K N+ +V YP  
Sbjct: 832  KVENLEVDEQWSCPRCKSKQPST-KKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFT 889

Query: 995  LNIV------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034
            L++             L   E+          YKLY +  H G+L  GHYT+ V+K    
Sbjct: 890  LDLTTFWANDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDK---- 945

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                 +  WYYFDD   +  K   N  + IT     + YVLFY+R+
Sbjct: 946  ---GIKNGWYYFDDTSCRPIK---NSMEPIT----SSAYVLFYKRI 981

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 404 KLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRL 462
           ++L ID+R        H   PN++ I+P +   + ++  + K +++    +   LF+ R 
Sbjct: 193 QVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMITSTNDEIVLFHRRQ 252

Query: 463 KYDYIVYYS---DMKTYMNFEYDYSFILFYLLTTS-GKHLSSVPTALLGGYEKWKK 514
           ++ +IV YS   D K+ + ++   + +   LL  S  K LS+    L  G++ W K
Sbjct: 253 EFAFIVLYSNDTDKKSGIVYKERKTLLANLLLNHSFEKPLSNRLYVLENGFDSWTK 308

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  111 bits (277), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 112/242 (46%), Gaps = 24/242 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
             GL N+GN+CY+NC++Q L +T+EL  +F++  Y ++  +      +  ++  FA L +
Sbjct: 518 TVGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVH 577

Query: 706 KMYMNGGCT--------VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
            MY  G           + P  F   C  +   L   + QQD+QEF  F+L+ LH++L N
Sbjct: 578 TMYREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNTQQDSQEFCQFLLDGLHEDL-N 635

Query: 758 QVNV---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQ 814
           Q      +            K+ +      +W  +  +    S +  +FQGQ  + L+C+
Sbjct: 636 QCGANPPLKELSEDAEKMREKLSMRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLKCK 693

Query: 815 RCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            CG  S  Y TF VLS+ +P  S+          + DC N FT  E L  +  W CP C 
Sbjct: 694 VCGCTSTTYQTFSVLSVPVPHVSS--------CHILDCFNEFTKVEKLGTDELWSCPTCK 745

Query: 875 SK 876
            K
Sbjct: 746 KK 747

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 77/167 (46%), Gaps = 37/167 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++K+  DE+      K K+  T K +    LP+ LIIHL RF  ++  KN+  V YP +
Sbjct: 729  KVEKLGTDELWSCPTCKKKQPST-KKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFL 786

Query: 995  LNIV------------------LKNEEIV---RYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++                   L     V   RYKL ++ +H G+L  GHYT+ VNK   
Sbjct: 787  LDLTPYWANDFDGRLPPGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNK--- 843

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                   + W+YFDD   +  K         T+  + N YVLFY RV
Sbjct: 844  ----GINRGWHYFDDTSYRPIKNE-------TECITPNAYVLFYHRV 879

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 405 LLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLK 463
           LLLID+R      + HI A +V+ ++P +  ++  +  + K +++        LF  R K
Sbjct: 186 LLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQKEIALFQARDK 245

Query: 464 YDYIVYYSDMKTYMNFEYDYSFILFYLL 491
           Y+YIV Y+       F      +L  +L
Sbjct: 246 YNYIVIYTQQSEKTQFYMHQQLVLLDIL 273

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  111 bits (277), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 118/251 (47%), Gaps = 33/251 (13%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
           + GL N+GN+CY+NC++Q +  T++L  +F++  Y ++  +      +  ++  FA L +
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 706 KMYMNGGCTVV------------PSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHD 753
            MYM+   + +            P  F   C  +    R    QQD+QEF  F+L+ LH+
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGLHE 722

Query: 754 ELSN--------QVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQG 805
           +L+         ++++                ++ E+Y        +    S +  +FQG
Sbjct: 723 DLNQCGGNPPLKELSLEAERLRENLSLRIASSIEWERY--------LTTDFSVIVDLFQG 774

Query: 806 QMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGE 865
           Q  + L+C+ C + S  Y +F VLS+ LPK   P   ++ ++ L DC N FT  E L  +
Sbjct: 775 QYASRLECKVCHHTSTTYQSFSVLSVPLPKKFDP---QTRKIDLIDCFNEFTKIENLEVD 831

Query: 866 NAWDCPKCGSK 876
             W CP C  K
Sbjct: 832 EQWSCPTCKKK 842

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 80/168 (47%), Gaps = 39/168 (23%)

Query: 935  KLDKMERDEIEEWH-KMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K++ +E DE  +W      KK  + K +    LP+ LIIHL RF  ++  KN++ + YP 
Sbjct: 824  KIENLEVDE--QWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPF 880

Query: 994  VLNIV--------------LKNEEIVR-------YKLYSIVNHTGNLISGHYTSLVNKDP 1032
             L++               + NE   R       Y+LY +  H G+L  GHYT+ V+K  
Sbjct: 881  NLDLTEFWADDFDGNLPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDK-- 938

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
               +GN    WYYFDD   +  K     DK   +  S + YVLFY RV
Sbjct: 939  --GIGN---GWYYFDDTTYRPLKN----DK---EPISSSAYVLFYTRV 974

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 372 NAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDP 431
           N  I+ L      S I+  +L  ++ N  +   LL+ID+R     + +HI + N++ I+P
Sbjct: 171 NDIIKNLHLPSNGSFISTIQLNELMRNFND--SLLIIDIRSRSEFIKSHIKSKNIICIEP 228

Query: 432 TNLWDNEANSPIYKDTILEQRLNN-PLFNGRLKYDYIVYYSDM 473
            +  D+ ++  + + +I+    N   LFN R  + +IV Y+++
Sbjct: 229 ISFKDSYSDYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 126/544 (23%), Positives = 215/544 (39%), Gaps = 60/544 (11%)

Query: 385 SIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIY 444
           S I   +L  +LS+   +  LLLID+R  K     HI AP ++ I P +      +  I 
Sbjct: 167 SFILPEKLHDLLSS--HKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIE 224

Query: 445 KDTILEQRLNNP-LFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLT--TSGKHLSSV 501
           + ++L         F  R ++ YIV Y+       + Y     LF +LT   S +++  +
Sbjct: 225 QTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQI 284

Query: 502 PTALL---GGYEKWKKVMNTY----------VSQYQIEL-----DDYLYRPYAPSNNKGE 543
             ++    GG   W  V ++Y           +QY   L     D  +Y+  A S+N   
Sbjct: 285 CPSIFILKGGITSW--VQHSYECKTNLTGKTANQYNQNLFKRSKDSSIYKHVALSDNSLN 342

Query: 544 QNNAQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKIKLESIEESAP--- 600
           + +                                          ++ + ++   AP   
Sbjct: 343 EGSKTCNPIVPASVQTVIPNFIPPSHSKSTICLMKNEQPQALYNHQV-IPNLIHRAPLDT 401

Query: 601 -SDNSQYIRPPAKLPIHALHS-PR-NQTLTRKFSIPTIEKNSNPYVAYS------VTGLR 651
            S+N+Q +    K PI  ++  P+ N ++     +P +   +NP            TGL 
Sbjct: 402 ESNNTQNVPMGFKNPIPQMYEIPKYNPSVNSGPKLPLLPPTANPQQIVPKLDLDFTTGLE 461

Query: 652 NLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFNKMYMN 710
           N+ N+CY+NC++Q L +T++L  L+++  +  +  ++     +  +S  FANL   MY  
Sbjct: 462 NVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKLGSKGFLSKNFANLIQTMYKK 521

Query: 711 GGCT---------VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS----N 757
                        V P  F   C  +   +     +QD QEF  F+L+ LH++L+    N
Sbjct: 522 SAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHEDLNQCSGN 580

Query: 758 QVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
                             M +  E   +W  ++ +    SP+  +FQGQ  + LQC  C 
Sbjct: 581 PRPKELSANEAELRESLSMRIASE--IEW--ESFLTTNFSPIINLFQGQYASRLQCLICQ 636

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKA 877
           + S  Y  F +LS+ +P   +  F       + DC   FT  E L  +  W CPKC  K 
Sbjct: 637 HTSTTYQPFSLLSIPVP---SMVFSNGQTCNILDCFKEFTKCERLDNDEKWFCPKCRRKQ 693

Query: 878 VEPR 881
           +  +
Sbjct: 694 ISTK 697

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 76/170 (44%), Gaps = 38/170 (22%)

Query: 934  EKLDKMER-DEIEEWHKMKSK-KLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSY 991
            ++  K ER D  E+W   K + K ++ K +    LPK LIIH  RF  +   KN+  V Y
Sbjct: 670  KEFTKCERLDNDEKWFCPKCRRKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQY 728

Query: 992  PLVLNIV---------------------LKNEEIVRYKLYSIVNHTGNLISGHYTSLVNK 1030
            P  L++                             +YKL ++  H+GNL SGHYT+ V+K
Sbjct: 729  PYQLDLTSLWVNDYDGKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDK 788

Query: 1031 DPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
              +       + W+ FDD   +  K         T+  + + Y+LFY+R+
Sbjct: 789  GLY-------RGWFRFDDASYRPVKFG-------TEFLTPDAYLLFYQRI 824

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 106/241 (43%), Gaps = 22/241 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
           + GL N GN CY+NC+LQ L  T++L  +F+   Y  +     +   +  ++  FA L  
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 706 KMYMNGGCTVVPS--------GFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
            M+ N     V S         F KIC  +   +     QQD QEF  F+L+ LH++L+ 
Sbjct: 505 NMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 758 QVNV--IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
                 +            KM + K    +W  +  +    S +  +FQGQ  + LQCQ 
Sbjct: 564 NGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQA 621

Query: 816 CGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGS 875
           C   S  Y TF VLS+ +P+ +           + DC   FT  E L  +  W CP+C  
Sbjct: 622 CDRTSTTYQTFSVLSVPVPRITT--------CNILDCFREFTKCEKLGIDELWSCPRCLK 673

Query: 876 K 876
           K
Sbjct: 674 K 674

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 83/166 (50%), Gaps = 37/166 (22%)

Query: 935  KLDKMERDEIEEWHKMKS-KKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K +K+  DE+  W   +  KK  + K +    LPK LII+L RF   + K N+  V YP 
Sbjct: 656  KCEKLGIDEL--WSCPRCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPY 712

Query: 994  VLNI-----------VLKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034
             L++            + NE+I         RY+LY +  H+G+L  GHYTS V K P  
Sbjct: 713  FLDLTPYWARDFNHEAIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-- 770

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                 ++ WY+FDD + +  + +   D+ IT     N YVLFYER+
Sbjct: 771  -----KKGWYFFDDSIYRPIRFN---DEFIT----PNAYVLFYERI 804

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 405 LLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLK 463
           LLLID+R        HI   N++ I+P +  D+  +  +   +++    ++  LF+ R  
Sbjct: 163 LLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQSDIDLFSNRNM 222

Query: 464 YDYIVYYSDMKTYMNFEYDYSFILFYLLTTSG--KHLSSVPTALL-GGYEKWKKVMNTY 519
           + YIV Y+D + + +F    +  L  +L+       L+     +L  G+  W K+  TY
Sbjct: 223 FKYIVLYTDAQLHGDFWQRQTRTLAKILSQQSILNPLNGTKVLILETGFSNWVKLGGTY 281

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 124/277 (44%), Gaps = 32/277 (11%)

Query: 634 TIEKNSNPYVAYS-VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDN 691
           ++ K+ +P +      GL NLGN+CY+NC++Q L   +EL  +F++  YR++  +     
Sbjct: 417 SVAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLG 476

Query: 692 KESAISNTFANLFNKMYMNG-----------GCTVVPSGFLKICNFLRPDLRIPDDQQDT 740
            +  ++N F+ L  KMY  G              V P+ F   C  +   L     QQD 
Sbjct: 477 SKGLLANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDC 535

Query: 741 QEFLLFILNRLHDELSNQVNV---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLS 797
           QEF  F+L+ LH++L NQ      +             M +      +W  +  +    S
Sbjct: 536 QEFCQFLLDGLHEDL-NQCGTNPPLKELSPEAEKMRETMPMRIASAIEW--ERYLTTDFS 592

Query: 798 PVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFT 857
            +  +FQGQ  + L+C+ C + S  Y  F VLS+ +P+  +   Y        DC   FT
Sbjct: 593 VIVDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVPRARSCTIY--------DCFKEFT 644

Query: 858 SDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPN 894
             E L  +  W CP C  K  +P  +++    T LPN
Sbjct: 645 KLETLEKDELWYCPYC--KQRQP--STKQIIITRLPN 677

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 78/168 (46%), Gaps = 38/168 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            KL+ +E+DE+      K ++  T K I    LP  LIIHL RF  ++  KN+  V+YP  
Sbjct: 645  KLETLEKDELWYCPYCKQRQPST-KQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNE 702

Query: 995  LNIV--------------------LKNEEI-VRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++                     L+ ++    Y+L+++ +H+G L  GHYTS V+K   
Sbjct: 703  LDLTGFWIDDYNGEMPKDNGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDKG-- 760

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
                     W  FDD  V   K     D+ IT     N YVLFY RV+
Sbjct: 761  ------RVGWCSFDD--VSWRKIRRK-DEYIT----PNAYVLFYRRVN 795

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 74/167 (44%), Gaps = 12/167 (7%)

Query: 386 IITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYK 445
            ++  +L S++ +  +   +LL+D+R        HI   NV+ I+P +  ++  +S I +
Sbjct: 155 FVSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILR 214

Query: 446 DTILEQRLNN-PLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSG--KHLSSVP 502
            +++        LF  R K+  IV Y+D   +  + +    +L  +L      K L    
Sbjct: 215 KSLITASDREVDLFKNRDKFRLIVLYTDTDEHTKYYWQQLEVLQDILCNRSFDKPLHHTK 274

Query: 503 TALL-GGYEKW--------KKVMNTYVSQYQIELDDYLYRPYAPSNN 540
             +L  G   W        KK+M + +S  + +  ++ + P A SNN
Sbjct: 275 VIVLQNGVNAWKEKYPMELKKIMESAISDIRTKPVEHNFHPMALSNN 321

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  107 bits (268), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 120/256 (46%), Gaps = 22/256 (8%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
             GL NLGN+CY+NC++Q +  T+EL  +F+   Y ++  +      +  ++  FA L +
Sbjct: 564 AVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVH 623

Query: 706 KMYM-----NGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            MY      +   ++ P  F   C  +    +    QQD QEF  F+L+ LH++L NQ  
Sbjct: 624 MMYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQCG 681

Query: 761 V---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
               +            K+ +      +W  +  +    S +  +FQGQ  + L+C+ C 
Sbjct: 682 SNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVCN 739

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKA 877
           + S  Y  F VLS+ +PK ++       ++ +EDC   FT  E L  E  W CP C  K 
Sbjct: 740 HTSTTYQPFTVLSIPIPKKNS-----QNKITIEDCFKEFTKCENLEVEEQWLCPHC--KQ 792

Query: 878 VEPRFTSRTSTQTILP 893
            +P  +++  T T LP
Sbjct: 793 RQP--STKQLTVTRLP 806

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 75/171 (43%), Gaps = 39/171 (22%)

Query: 934  EKLDKMERDEIEE-WHKMKSK-KLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSY 991
            ++  K E  E+EE W     K +  + K +    LP+ LI+HL RF   L K ND  V Y
Sbjct: 771  KEFTKCENLEVEEQWLCPHCKQRQPSTKQLTVTRLPRNLIVHLKRFDNFLNKNND-FVRY 829

Query: 992  PLVLNIV--------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVN 1029
            P +L++               + ++E+         +Y+LY +  H G L  GHYT+ V 
Sbjct: 830  PFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVK 889

Query: 1030 KDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            K         ++ W YFDD   K  K         T   + N YVLFY RV
Sbjct: 890  K-------GLKKGWLYFDDTKYKPVKNQ-------TDAINSNAYVLFYHRV 926

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 111/256 (43%), Gaps = 14/256 (5%)

Query: 628 RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QM 686
           RKF+   +      Y      GL N+GN+CY+NC+LQ +  TNEL  +F++  Y ++  +
Sbjct: 563 RKFNHSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHINI 622

Query: 687 KPNDNKESAISNTFANLFNKMYMNG------GCTVVPSGFLKICNFLRPDLRIPDDQQDT 740
                 +  ++  FA L + M+            V P+ F      +    R   +QQD 
Sbjct: 623 NSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDC 681

Query: 741 QEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVD 800
           QEF  F+L+ LH++L+   N              + ++          +  +    S + 
Sbjct: 682 QEFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVII 741

Query: 801 GVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDE 860
            +FQGQ  + L+C  C   S  Y  F VLS+ LP  +  +      V L DC N FT  E
Sbjct: 742 DLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPTGTKSS------VNLMDCFNEFTKCE 795

Query: 861 VLTGENAWDCPKCGSK 876
            L  +  W+CP C  K
Sbjct: 796 KLEHDEYWNCPTCKKK 811

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 79/168 (47%), Gaps = 38/168 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K +K+E DE       K KK  + K +    LP+ LIIHL RF   + K N  ++ YP  
Sbjct: 793  KCEKLEHDEYWNCPTCK-KKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFN 850

Query: 995  LNIVL-----KNEEI-----------------VRYKLYSIVNHTGNLISGHYTSLVNKDP 1032
            L++       K++ +                  +Y LY++ NH G+L  GHYTS VNK  
Sbjct: 851  LDLTSFWANDKDDRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNK-- 908

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                    + WYYFDD+  +       + K  ++V + N YVLFY RV
Sbjct: 909  -----GLSRGWYYFDDQNYR-------LVKKTSEVVNSNAYVLFYRRV 944

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 119/256 (46%), Gaps = 22/256 (8%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
             GL NLGN+CY+NC++Q +  T+EL  +F+   Y ++  +      +  ++  FA L +
Sbjct: 561 AVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVH 620

Query: 706 KMY-----MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            MY      +   ++ P  F   C  +    +    QQD QEF  F+L+ LH++L NQ  
Sbjct: 621 MMYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQCG 678

Query: 761 V---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
               +            K+ +      +W  +  +    S +  +FQGQ  + L+C+ CG
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKICG 736

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKA 877
           + S  Y  F VLS+ +P+   P       + +EDC   FT  E L  +  W CP C  K 
Sbjct: 737 HTSTTYQPFTVLSIPIPR-KVP----QNEITIEDCFKEFTKCENLEVDEQWLCPHC--KK 789

Query: 878 VEPRFTSRTSTQTILP 893
            +P  +++  T T LP
Sbjct: 790 RQP--STKQLTVTRLP 803

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 75/169 (44%), Gaps = 40/169 (23%)

Query: 935  KLDKMERDEIEEWHKMKSKKLV-TIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K + +E DE  +W     KK   + K +    LP+ LIIHL RF   L K ND  V YP 
Sbjct: 772  KCENLEVDE--QWLCPHCKKRQPSTKQLTVTRLPRNLIIHLKRFDNLLNKNND-FVKYPF 828

Query: 994  VLNIV--------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKD 1031
            +L++               + ++E+         +Y+LY +  H G L  GHYT+ V K 
Sbjct: 829  LLDLTPFWANDFDGVFPPGVNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK- 887

Query: 1032 PHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                     + W YFDD   K  K         T V++ N YVLFY RV
Sbjct: 888  ------GLRKGWLYFDDTKFKPVKNK-------TDVTNSNAYVLFYHRV 923

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 67/137 (48%), Gaps = 12/137 (8%)

Query: 406 LLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLKY 464
           LLID+R       +HI + N++ ++P +   + ++  + K +++    N   LF  R  +
Sbjct: 210 LLIDIRSRLEFDKSHIASKNIICLEPISFKISYSDHDLEKKSLITSPNNEIKLFQSRNLF 269

Query: 465 DYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALL---GGYEKW------KKV 515
            +I+ Y+D   Y N +   + +   L  +  K +SS  T +     G+  W      K++
Sbjct: 270 KFIILYTDSNEY-NIKQQSALLDILLNHSFEKPISSDFTKVFILKSGFPSWLNSNHGKQI 328

Query: 516 MNTYVSQYQIELDDYLY 532
            +T+ S++ I+ DD +Y
Sbjct: 329 SSTFPSKHNIK-DDSVY 344

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 124/284 (43%), Gaps = 25/284 (8%)

Query: 607 IRPPAKLPIHALHSPRNQTLTRK---FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCML 663
           + P  +LP   +  PR   L ++    S P I+ ++  +    + GL N+GN CY+NC+L
Sbjct: 385 LSPGPQLPQANVIPPRIPPLPQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCIL 444

Query: 664 QSLFATNELKNLFISGKYREYQMKPN-DNKESAISNTFANLFNKMYMNGGCTVVPS---- 718
           Q L  T++L  +F+   Y  +    N    +  ++  FANL + M+ +G    + S    
Sbjct: 445 QCLVGTHDLTRMFLDNTYLNFINFDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITP 504

Query: 719 ----GFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNV--IXXXXXXXXXX 772
                F K C  +   +     QQD QEF  F+L+ LH++L+       +          
Sbjct: 505 VQTIQFKKTCGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERT 563

Query: 773 XXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLA 832
              M + K    +W  +  +    S V  +FQGQ  + LQCQ C + S  Y TF VLS+ 
Sbjct: 564 RENMSIRKASALEW--ERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVP 621

Query: 833 LPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
           +P+             + DC   FT  E L     W C +C  K
Sbjct: 622 VPRIMT--------CNVLDCFREFTKCEKLGIGEQWSCSRCLKK 657

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 75/156 (48%), Gaps = 35/156 (22%)

Query: 945  EEWHKMKS-KKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIV----- 998
            E+W   +  KK  + K +    LPK LII+L RF   +  KN+  V YP  L++      
Sbjct: 647  EQWSCSRCLKKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWAR 705

Query: 999  -LKNEEIV-------------RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWY 1044
               +E I+             RY+LY +  H+G+L  GHYTS V K P       ++ WY
Sbjct: 706  DFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWY 758

Query: 1045 YFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            +FDD + +  + +        +  + N YVLFYER+
Sbjct: 759  FFDDTIYRLIRFNN-------EFITPNAYVLFYERI 787

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 16/122 (13%)

Query: 405 LLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQ-------RLNNPL 457
            LL+D+R     +  HI   +++ IDP +  D+      Y DT++E+       +L   L
Sbjct: 165 FLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDS------YTDTLVERVSLAASPQLEIEL 218

Query: 458 FNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMN 517
           F+ R  +  IV Y+D +   +F+   + IL  +LT   +H  +  + L  G+  W K+  
Sbjct: 219 FSKRNTFKNIVLYTDTQLQGDFQQRQTRILANILT---RHSVAKVSILENGFSNWVKLGG 275

Query: 518 TY 519
            +
Sbjct: 276 AF 277

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 109/241 (45%), Gaps = 23/241 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFN 705
             GL N+GN+CYINC++Q L  T+EL N+F++  Y R   +      +  ++  FA L +
Sbjct: 514 TVGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIH 573

Query: 706 KMYMNGGC-------TVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQ 758
           +M+ +           V P  F   C  +    R    QQD+QEF  F+L+ LH++L NQ
Sbjct: 574 QMHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL-NQ 631

Query: 759 VN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
                 +            ++ +      +W  +  +    S +  +FQGQ  + L+C+ 
Sbjct: 632 CGGNPPLKELSEEAEKMRERLSMRIASSIEW--ERYLTRDFSVIVDLFQGQYASQLRCKV 689

Query: 816 CGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGS 875
           C + S  Y  F +  LA P P A + Y      L DC   FT  E L  +  W CP C  
Sbjct: 690 CNHTSTTYQPFSI--LAAPVPHAKSCY------LLDCFKEFTKLEQLEKDEEWLCPYCKK 741

Query: 876 K 876
           K
Sbjct: 742 K 742

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/168 (33%), Positives = 84/168 (50%), Gaps = 39/168 (23%)

Query: 935  KLDKMERDEIEEW-HKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            KL+++E+DE  EW      KK  + K +    LP+ LIIHL RF  +L  KN+ +V+YP 
Sbjct: 724  KLEQLEKDE--EWLCPYCKKKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPF 780

Query: 994  VLNIV------------------LKNEEIV---RYKLYSIVNHTGNLISGHYTSLVNKDP 1032
             L++                   L +   V   +YKLY++ +H+G+L  GHYT+ V+K  
Sbjct: 781  FLDLTPFWANDFDGRLPPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDK-- 838

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                    + WYYFDD   +  +T        T+  + N YVLFY RV
Sbjct: 839  -----GLNKGWYYFDDTGYRPMRTP-------TECITSNAYVLFYHRV 874

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 375 IQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNL 434
           I   + L+    I+A EL  +L +  +   +LL+D+R        HI A NV+ I+P + 
Sbjct: 142 ISSDKELKTGGFISAKELEFLLKS--DDRNILLVDVRQRSEFEETHIKASNVICIEPISF 199

Query: 435 WDNEANSPIYKDTILEQR--LNNP-----LFNGRLKYDYIVYYSDMKT---YMNFEYDYS 484
             +      Y D  LE++  + +P     +F  R ++ +++ Y+D      + NF     
Sbjct: 200 KSS------YTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTDGNKENGHHNFYIQQE 253

Query: 485 FILFYLL 491
            +L  LL
Sbjct: 254 MVLLDLL 260

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  105 bits (262), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 111/236 (47%), Gaps = 18/236 (7%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
             GL NLGN+CY+NC++Q +  T+EL  +F+   Y ++  +      +  ++  FA L +
Sbjct: 561 AVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVH 620

Query: 706 KMY---MNGG--CTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            MY   ++G    ++ P  F   C  +    +    QQD QEF  F+L+ LH++L NQ  
Sbjct: 621 MMYKEQVDGSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQCG 678

Query: 761 V---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
               +            K+ +      +W  +  +    S +  +FQGQ  + L+C+ C 
Sbjct: 679 SNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKVCS 736

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           + S  Y  F VLS+ +PK ++        + +EDC   FT  E L  +  W CP C
Sbjct: 737 HTSTTYQPFTVLSIPIPKKNS-----RNNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 75/169 (44%), Gaps = 40/169 (23%)

Query: 935  KLDKMERDEIEEW-HKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K + +E DE  +W      K+  + K +    LP+ LI+HL RF   L K ND V+ YP 
Sbjct: 772  KCENLEVDE--QWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFDNLLNKNNDFVI-YPF 828

Query: 994  VLNIV--------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKD 1031
            +L++               + ++E+         +Y+LY +  H G L  GHYT+ V K 
Sbjct: 829  LLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK- 887

Query: 1032 PHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                    ++ W YFDD   K  K   +         + N YVLFY RV
Sbjct: 888  ------GLKKGWLYFDDTKYKPVKNKAD-------AINSNAYVLFYHRV 923

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 111/261 (42%), Gaps = 32/261 (12%)

Query: 631 SIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPN 689
           S P   +N+N  V     GL NLGN+CY+NC++Q L  T+EL  +F+   Y+ +  +   
Sbjct: 483 SKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSK 537

Query: 690 DNKESAISNTFANLFNKMYMNGG-----------CTVVPSGFLKICNFLRPDLRIPDDQQ 738
              +  ++  F+ L + M                  V P  F   C  +    R    QQ
Sbjct: 538 LGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-SSSQQ 596

Query: 739 DTQEFLLFILNRLHDELSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANG 795
           D QEF  F+L+ LH++L NQ      +            K+ +      +W  +  +   
Sbjct: 597 DCQEFCQFLLDGLHEDL-NQCGGNPALKELSEEAEGIREKLCMRIASSIEW--ERYLTTD 653

Query: 796 LSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINM 855
            S +  +FQGQ  + L C+ CG  S  Y  F VLS+ +P  S        +  + DC   
Sbjct: 654 FSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPSGS--------KCDIIDCFKE 705

Query: 856 FTSDEVLTGENAWDCPKCGSK 876
           FT  E L  +  W CP+C  K
Sbjct: 706 FTKVETLEKDEQWSCPRCKCK 726

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 74/165 (44%), Gaps = 36/165 (21%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++ +E+DE     + K K+  T K I    LP+ L+IHL RF  +L  KN+  VSYP  
Sbjct: 708  KVETLEKDEQWSCPRCKCKQPST-KKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHT 765

Query: 995  LNIV-----------------LKNEEIV---RYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034
            L++                  L     V    Y LY++  H G L  GHYTS V+K    
Sbjct: 766  LDLTPFWANDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDK---- 821

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
                 +  W YFDD   +  K+ G       +  + + YVLFY R
Sbjct: 822  ---GDKAGWCYFDDTSWRKAKSQG-------ECITLSAYVLFYHR 856

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 61/136 (44%), Gaps = 20/136 (14%)

Query: 387 ITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKD 446
           I+  EL S+L         LLIDLR   + + +HI    ++ I+P +  D+      Y D
Sbjct: 164 ISPSELQSLLG----AQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDS------YSD 213

Query: 447 TILEQR--LNNP-----LFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSG--KH 497
           T + +R  + +P     LF  R K+DYIV Y+D      F       L  LL      K 
Sbjct: 214 TEITRRSLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKP 273

Query: 498 LS-SVPTALLGGYEKW 512
           L  ++   L GG+E W
Sbjct: 274 LQRTIILTLQGGFENW 289

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  104 bits (259), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 110/236 (46%), Gaps = 18/236 (7%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
             GL NLGN+CY+NC++Q +  T+EL  +F+   Y ++  +      +  ++  FA L +
Sbjct: 562 AVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVH 621

Query: 706 KMYM-----NGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            MY      +   ++ P  F   C  +    +    QQD QEF  F+L+ LH++L NQ  
Sbjct: 622 MMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQCG 679

Query: 761 V---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
               +            ++ +      +W  +  +    S +  +FQGQ  + L+C+ C 
Sbjct: 680 SNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTCN 737

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           + S  Y  F VLS+ +PK ++       ++ +EDC   FT  E L  +  W CP C
Sbjct: 738 HTSTTYQPFTVLSIPIPKKNS-----QNKITIEDCFKEFTKCENLEIDEQWLCPHC 788

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 74/171 (43%), Gaps = 39/171 (22%)

Query: 934  EKLDKMERDEI-EEW-HKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSY 991
            ++  K E  EI E+W      K+  + K +    LP+ LIIHL RF   L K ND  V Y
Sbjct: 769  KEFTKCENLEIDEQWLCPHCEKRQPSTKQLTITRLPRNLIIHLKRFDNLLNKNND-FVKY 827

Query: 992  PLVLNIV--------------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVN 1029
            P +L++               + ++E+         +Y+LY +  H G L  GHYTS V 
Sbjct: 828  PFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVK 887

Query: 1030 KDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            K          + W YFDD   +  K         T   + N YVLFY RV
Sbjct: 888  K-------GLSRGWLYFDDTKYRPAKNQ-------TDAINSNAYVLFYHRV 924

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 109/254 (42%), Gaps = 22/254 (8%)

Query: 634 TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNK 692
            I  NS  +    + GL N+GN CY+NC+LQ L  T++L  +F+   Y  +         
Sbjct: 450 AIFNNSQAFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGS 509

Query: 693 ESAISNTFANLFNKMYMNGG--------CTVVPSGFLKICNFLRPDLRIPDDQQDTQEFL 744
           +  ++  +A L + M+ +G           V    F K+C  +   +     QQD QEF 
Sbjct: 510 KGLLAKNYATLVHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN-SIYSDSMQQDCQEFC 568

Query: 745 LFILNRLHDELSNQVNV--IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGV 802
            F+L+ LH++L+       +             M + K    +W  +  +    S +  +
Sbjct: 569 QFLLDGLHEDLNQNGGKKHLKQLSEQEERMRESMSIRKASALEW--ERFLLTDFSAIIDL 626

Query: 803 FQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVL 862
           FQGQ  + LQCQ C + S  Y TF VLS+ +P+             + DC   FT  E L
Sbjct: 627 FQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRIRT--------CNILDCFREFTKCEKL 678

Query: 863 TGENAWDCPKCGSK 876
             +  W C KC  K
Sbjct: 679 GVDEQWSCSKCLKK 692

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 82/166 (49%), Gaps = 37/166 (22%)

Query: 935  KLDKMERDEIEEWHKMKS-KKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K +K+  DE  +W   K  KK  + K +    LPK LII+L RF   + K N+  V YP 
Sbjct: 674  KCEKLGVDE--QWSCSKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPC 730

Query: 994  VLNIV-----------LKNEEI--------VRYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034
             L++            + NE+I         RY+LY +  H+G+L  GHYTS V K P  
Sbjct: 731  FLDLTPYWARDFNHESIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-- 788

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                 ++ WY+FDD V    + +   D+ IT     N YVLFYER+
Sbjct: 789  -----QKGWYFFDDSVYCPIRFN---DEFIT----PNAYVLFYERI 822

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 4/121 (3%)

Query: 405 LLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLK 463
           +L+ID+R     +  HI   N++ I+P +  D+  +  + K ++     +   LF+ R  
Sbjct: 179 ILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDLFSNRDT 238

Query: 464 YDYIVYYSDMKTYMNFEYDYSFILFYLLTTSG--KHLSSVPTALLG-GYEKWKKVMNTYV 520
           + YIV Y+D + Y +F    + IL  +L      K L      +L  G+  W K+   Y 
Sbjct: 239 FKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVKLGGAYQ 298

Query: 521 S 521
           S
Sbjct: 299 S 299

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 112/239 (46%), Gaps = 18/239 (7%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFN 705
           + GL+N+GN+CY+NC++Q L  T+EL  +F++  Y R   +      +  ++  FA L +
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 706 KMYMNGGCT-----VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            M+ +         V P+ F K+       L     QQD QEF  F+L+ LH++L NQ  
Sbjct: 618 LMHNHANPKLKNNYVRPAQF-KMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDL-NQCG 675

Query: 761 V---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
               +            K+ +      +W  +  +    S +  +FQGQ  + LQC+ C 
Sbjct: 676 SNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCEVCK 733

Query: 818 YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
           + S  Y  F VLS  +P P  P   K  +V + DC   FT  E+L  +  W CP C  K
Sbjct: 734 HTSTTYQPFSVLS--VPIPRVP---KGVKVNILDCFKDFTKLELLDTDEQWLCPTCKKK 787

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (48%), Gaps = 39/168 (23%)

Query: 935  KLDKMERDEIEEW-HKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            KL+ ++ DE  +W      KK  + K +    LP+ LIIHL RF  +   KN+  + YP 
Sbjct: 769  KLELLDTDE--QWLCPTCKKKQRSTKKLTITRLPRNLIIHLKRFD-NNLNKNNNFIDYPF 825

Query: 994  VLNI-------------------VLKNEEI--VRYKLYSIVNHTGNLISGHYTSLVNKDP 1032
            +L++                   + K  +I   +YKLY + +H G+L  GHYT+ V+K P
Sbjct: 826  ILDLTQFWVDDFDGKLPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGP 885

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             H        WYYFDD   ++ K   N ++ IT     + Y+LFY R+
Sbjct: 886  KHG-------WYYFDDTNYRSIK---NKNEPIT----SSAYLLFYHRI 919

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 66/141 (46%), Gaps = 4/141 (2%)

Query: 376 QGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLW 435
           Q L  ++  S+I++ +L  +L    +   +LLID+R       +HI    ++ ++P +  
Sbjct: 154 QELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFK 213

Query: 436 DNEANSPIYKDTILEQRLNN-PLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS 494
           D+ ++  + K +++        LFN R ++++I+ Y++ K    +     F+   L  + 
Sbjct: 214 DSYSDEEVAKKSLITSPNEEIDLFNKRNEFEFIILYTNDKEKAYYNQQMVFLEILLTHSF 273

Query: 495 GKHLSSVPTALL---GGYEKW 512
            K L S  T +L    G   W
Sbjct: 274 AKPLDSWKTKVLILENGISSW 294

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 113/262 (43%), Gaps = 33/262 (12%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNKM 707
           GL NLGN+CY+NC++Q L  T EL  +F+   Y+ +  +      +  ++  F+ L + M
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

Query: 708 YM-------------NGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
                          N    V P  F   C  +    +    QQD QEF  F+L+ LH++
Sbjct: 117 QQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQDCQEFCQFLLDGLHED 175

Query: 755 LSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
           L NQ      +            K+ +      +W  +  +    S +  +FQGQ  + L
Sbjct: 176 L-NQCGGNPALKELSEEAEAIREKLCMRIASSIEW--ERYLTTDFSVIVDLFQGQYASQL 232

Query: 812 QCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCP 871
            C+ CG  S  Y  F VLS+ +P        +  R  L DC   FT  E L  +  W CP
Sbjct: 233 MCKVCGRTSTTYQPFSVLSVPVP--------RGARCNLLDCFEEFTKIETLEKDEQWSCP 284

Query: 872 KCGSKAVEPRFTSRTSTQTILP 893
           +C  K  +P  +++  T T LP
Sbjct: 285 RC--KVKQP--STKKITITRLP 302

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 75/166 (45%), Gaps = 38/166 (22%)

Query: 935  KLDKMERDEIEEWHKMKSK-KLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K++ +E+DE  +W   + K K  + K I    LP+ LIIHL RF  +L  KN+  VSYP 
Sbjct: 271  KIETLEKDE--QWSCPRCKVKQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPH 327

Query: 994  VLNIV--------------------LKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
             L++                             Y LY++  H G L  GHYT+ VNK+  
Sbjct: 328  TLDLTPFWANDFDGSLPKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-- 385

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
                  +  W YFDD   +  K+    D+ IT     + YVLFY R
Sbjct: 386  -----DKNGWCYFDDTCWRKAKSE---DECIT----TSAYVLFYHR 419

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  102 bits (254), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 113/251 (45%), Gaps = 36/251 (14%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFN 705
           + GL+N+GN+CY+NC++Q L  T+EL  +F++  +  Y  +      +  ++   + L +
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 706 KMY------MNGGCTVVPSGFLKICNFLRP-----------DLRIPDDQQDTQEFLLFIL 748
            MY       NG  T   SG     NF++P           +L     QQD QEF  F+L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSG----NNFIKPIQFRMACGSINNLFKNCSQQDCQEFCQFLL 861

Query: 749 NRLHDELSNQVNV---IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQG 805
           + LH++L NQ      +            K+ +      +W  +  +    S +  +FQG
Sbjct: 862 DALHEDL-NQCGSNPPLKELSTKAESMREKLSLRIASSIEW--ERYLTTDFSVIVDLFQG 918

Query: 806 QMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGE 865
           Q  + LQC+ C + S  Y  F VLS+ +P        K   + L DC   FT  E L  +
Sbjct: 919 QYASRLQCKTCIHTSTTYQPFSVLSVPIP--------KKKNLNLLDCFKDFTKIENLEVD 970

Query: 866 NAWDCPKCGSK 876
             W CP C SK
Sbjct: 971 EQWFCPNCKSK 981

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 77/167 (46%), Gaps = 37/167 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLV 994
            K++ +E DE       KSK+  T K +    LP+ LIIHL RF  +   KN+ ++ YP +
Sbjct: 963  KIENLEVDEQWFCPNCKSKQPST-KKLTITRLPRNLIIHLKRFD-NNLNKNNNLIDYPFI 1020

Query: 995  LNI-------------------VLKNEEI--VRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
            L++                   + K  +I   +Y+LY    H G+L  GHYT+ VNK   
Sbjct: 1021 LDLTQFWADDFDGELPPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNK--- 1077

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                     WYYFDD   +  K   N  + I    S N YVLFY R+
Sbjct: 1078 ----GIRNGWYYFDDTNYRPIK---NEREPI----SSNAYVLFYHRI 1113

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  101 bits (252), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 119/269 (44%), Gaps = 26/269 (9%)

Query: 621 PRNQTLTRKFSIPTIEKNSNPYVAYSVT-GLRNLGNTCYINCMLQSLFATNELKNLFISG 679
           P   TL RK S P    + N  +  S T GL N+GN+CYINC++Q +FAT EL  +F++G
Sbjct: 498 PIPSTLIRKNS-PEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNG 556

Query: 680 KYREYQMKPND-NKESAISNTFANLFNKMYMNGGCTVVPS--GFLKICNFLRPDLRIPD- 735
            Y ++  K +    +  +S+ FA L   MY       +    G +K   F      +   
Sbjct: 557 TYAKHINKQSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSL 616

Query: 736 ----DQQDTQEFLLFILNRLHDELSNQVNV---IXXXXXXXXXXXXKMMVDKEKYKKWFD 788
                QQD  EF  F+L+ LH++L NQ      +             + +      +W  
Sbjct: 617 FKDASQQDCLEFCQFLLDGLHEDL-NQCGANPPLKELSPEAEKMRENLSLRVASSIEW-- 673

Query: 789 KTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGR-V 847
           +  +    S +  +FQGQ  + L+C+ C   S  Y  F VLS+ +P         SG+  
Sbjct: 674 ERYLTTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVP---------SGKSC 724

Query: 848 KLEDCINMFTSDEVLTGENAWDCPKCGSK 876
            L DC   FT  E L  +  W CP C  K
Sbjct: 725 GLLDCFIEFTKTENLEVDEQWFCPSCKKK 753

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 75/168 (44%), Gaps = 39/168 (23%)

Query: 935  KLDKMERDEIEEWHKMKSKK-LVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K + +E DE  +W     KK   + K +    LP+ LIIHL RF  ++  KN+  V YP 
Sbjct: 735  KTENLEVDE--QWFCPSCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQ 791

Query: 994  VLNIV--------------LKNEEIVR-------YKLYSIVNHTGNLISGHYTSLVNKDP 1032
            +L++               + +E   R       Y+LY    H G L  GHYTS V+K P
Sbjct: 792  ILDLTPFWANDSDGKLPPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGP 851

Query: 1033 HHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                   E+ W YFDD V +  +          +  S + YVLFY R+
Sbjct: 852  -------EKGWIYFDDTVYRPVRFQN-------EFISPSAYVLFYHRI 885

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 54/98 (55%), Gaps = 3/98 (3%)

Query: 385 SIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIY 444
           S I+  EL S++   E+   LLLID+R      A+HI   N++ I+P +  ++ ++  I 
Sbjct: 188 SGISCSELLSLMKMKED--SLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIE 245

Query: 445 KDTILEQ-RLNNPLFNGRLKYDYIVYYSDMKTYMNFEY 481
           K +++   +    LF  R ++ YI+ Y+D++   NF +
Sbjct: 246 KTSMIPSPKHEIQLFQRRSEFQYIILYTDLEEKSNFYF 283

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  100 bits (249), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 114/265 (43%), Gaps = 36/265 (13%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNKM 707
           GL NLGN+CY+NC++Q L  T+EL  +F++  Y+ +         +  ++  F+ L + M
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 708 YMNGGCT----------------VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRL 751
           Y     T                V P  F   C  +    R    QQD QEF  F+L+ L
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-DCSQQDCQEFCQFLLDGL 642

Query: 752 HDELSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808
           H++L NQ      +            K+ +      +W  +  +    S +  +FQGQ  
Sbjct: 643 HEDL-NQCGGNPRLKELSEEAEKIREKLSMRIASSIEW--ERYLTTDFSVIVDLFQGQYA 699

Query: 809 NALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAW 868
           + L+CQ CG  S  Y  F VLS+ LP   +          + DC   FT  E L  +  W
Sbjct: 700 SQLKCQVCGRTSTTYQPFSVLSVPLPSLKS--------CNILDCFQEFTKVETLEKDEQW 751

Query: 869 DCPKCGSKAVEPRFTSRTSTQTILP 893
            CP C  K  +P  +++  T T LP
Sbjct: 752 SCPDC--KKRQP--STKKITITRLP 772

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 80/167 (47%), Gaps = 38/167 (22%)

Query: 935  KLDKMERDEIEEWHKMKSKKLV-TIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPL 993
            K++ +E+DE  +W     KK   + K I    LP+ LIIHL RF  ++  KN+  VSYP 
Sbjct: 741  KVETLEKDE--QWSCPDCKKRQPSTKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPH 797

Query: 994  VLNIV--LKNEEIVR------------------YKLYSIVNHTGNLISGHYTSLVNKDPH 1033
             L++     N+   R                  YKLY++ +HTG L  GHYT+ V+K   
Sbjct: 798  TLDLTPFWANDFDGRLPPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHK--- 854

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                 +++ W YFDD       T+    +   +  + N YVLFY RV
Sbjct: 855  ----GSQRGWCYFDD-------TNWRRSRSDNECITSNAYVLFYHRV 890

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 4/121 (3%)

Query: 396 LSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQ-RLN 454
           L N      +LLIDLR     + +HI +P+V+ I+P +  D  ++  + K +++      
Sbjct: 167 LQNLMAASSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNCE 226

Query: 455 NPLFNGRLKYDYIVYYS--DMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALL-GGYEK 511
             LF+ R  + +IV Y+  D +T    +     +   L  +  K L  V   +L GG+E+
Sbjct: 227 IELFSKRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSRSFDKPLDKVKVLILEGGFEE 286

Query: 512 W 512
           W
Sbjct: 287 W 287

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 100/242 (41%), Gaps = 21/242 (8%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFN 705
           + GL N+ N+CY+NC++Q L +  EL  + ++  + +   M+     +  I   FA L  
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 706 KMYMNGGCT--------VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
            M+     T        V    F   C  +   +     QQD QEF  F+L+ LH++L N
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVS-SIYSGSQQQDCQEFCEFLLDGLHEDL-N 545

Query: 758 QVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQ 814
           Q                    + +       W  +  + N  S +  +F GQ  + L+C 
Sbjct: 546 QCGGNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLIIDLFAGQYGSQLRCC 603

Query: 815 RCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            C Y S  Y  F +LS+ +P  S     +  R  + DC   FT  E L  +  W CP+C 
Sbjct: 604 VCQYTSTTYQPFTLLSVPVPLSS-----RVSRCSIIDCFQEFTKCERLDKDEEWFCPQCK 658

Query: 875 SK 876
            K
Sbjct: 659 RK 660

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 80/171 (46%), Gaps = 39/171 (22%)

Query: 934  EKLDKMER-DEIEEWHKMKSK-KLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSY 991
            ++  K ER D+ EEW   + K K  + K +    LPK LIIH  RF  ++  KN+  + Y
Sbjct: 638  QEFTKCERLDKDEEWFCPQCKRKQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQY 696

Query: 992  PLVLNI--------------------VLKNEEI--VRYKLYSIVNHTGNLISGHYTSLVN 1029
            P  L++                    + K  ++   +Y+L ++  H G L SGHYT+ VN
Sbjct: 697  PYELDLTPFWVNDFNGELPLGMTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVN 756

Query: 1030 KDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            K P       +  WYYFDD       +   + K  T+  + + Y+LFY RV
Sbjct: 757  KGP-------DVGWYYFDD-------SSHRIVKIATEYMNPDAYLLFYHRV 793

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 375 IQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNL 434
           ++G   L     +T P+L +ILS  +++  +LLID+R       +HI +  V+ +DP + 
Sbjct: 148 VEGGHNLPSGPFLTVPQLQTILS--DQKISVLLIDVRKRYEFEFSHINSVAVLPLDPISF 205

Query: 435 WDNEANSPIYKDTILEQ--RLNNP-----LFNGRLKYDYIVYYS 471
                  P Y    LE+   +N+P     LF  R +YD IV Y+
Sbjct: 206 ------KPTYTIDQLEKISFINSPMHELQLFQKRNEYDVIVLYT 243

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 121/289 (41%), Gaps = 41/289 (14%)

Query: 612 KLPIHALHSPRNQTLTRK--FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFAT 669
           +LP+   ++P+  + T K  ++ PT+           + G++N GN CY+NC++Q L   
Sbjct: 317 QLPLFTGNNPQTLSNTHKPNYTSPTV-----------IKGIQNEGNCCYMNCIIQCLLCF 365

Query: 670 NELKNLFISGKY-REYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLR 728
            E  N F+   Y     +      +  +   +A +    +      + P+  + I  F  
Sbjct: 366 PEFTNKFLDNAYLGTINVNSRLGHQGLVVKNWAKIIQAFFQVSQENIQPA--VSITEFRE 423

Query: 729 PDLRI-PD----DQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKY 783
               + P+     Q D  EF L +L  +H++ SN                  M VD   Y
Sbjct: 424 QWANLFPEYGKYQQHDCSEFCLRLLEEIHED-SNW--------GRPQNSDAAMQVD--DY 472

Query: 784 KKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYK 843
           ++ ++     N    VD  F+GQ+++ L CQ C  +S NY  F +L+L +P  S    Y 
Sbjct: 473 REAWNLYRKGNSSYIVD-TFKGQIKSQLTCQVCQTQSNNYEPFSILNLPIPLVSMCHIY- 530

Query: 844 SGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTIL 892
                  DC+       VLTG++ W C  C +K      T+ T+   +L
Sbjct: 531 -------DCMKELFKVHVLTGDDRWYCSTCKTKTHSTLGTTITNVPEVL 572

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 23/141 (16%)

Query: 945  EEWH--KMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNE 1002
            + W+    K+K   T+ T    ++P+VLIIH +RF  +L  K +  V YP +L++   N 
Sbjct: 546  DRWYCSTCKTKTHSTLGT-TITNVPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNG 603

Query: 1003 EI----VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHG 1058
             +    V YKL ++  HTG L SGHYT+   K       N+E  WY+FDD   K      
Sbjct: 604  LLGKCDVPYKLVAVACHTGTLFSGHYTAYCFK-------NSENGWYHFDDTQCKP----- 651

Query: 1059 NVDKGITKVSSKNVYVLFYER 1079
             V  G  +  S++ Y+LFY++
Sbjct: 652  -VSNG--ECISQSAYLLFYQK 669

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 88/203 (43%), Gaps = 26/203 (12%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND-NKESAISNTFANLFN 705
            TGL NLGN+CY+N  LQ L    ELK+ F+ G Y E     N    +  ++  FA L  
Sbjct: 333 TTGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIK 392

Query: 706 KMY---MNGGCTVVPSGFLKI--------CNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
            ++    +      P  F  I          FL         QQD+QEFL F+L+ LH++
Sbjct: 393 SLFDERSSSAFAFSPREFKSIIGQQNSMFAGFL---------QQDSQEFLAFLLDGLHED 443

Query: 755 LSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
           L+  +    V             + ++ +   K W DK  + N    +D +F G  ++ L
Sbjct: 444 LNRIIEKPFVEKPELSPDEDVNNREVIHRLASKTW-DKHKLRNDSVILD-LFVGLYKSTL 501

Query: 812 QCQRCGYESVNYSTFYVLSLALP 834
            C  C   SV +  +  L+L LP
Sbjct: 502 TCPVCDKTSVTFDPYSDLTLPLP 524

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV-LNIV--LKNEEIVRYKLYSIV 1013
            K I   + P +L IHL RF   +  + K   VV +P+  LN+   L  E+  +  LY +V
Sbjct: 937  KQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLV 996

Query: 1014 ---NHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
               NH G L  GHYT+   K+P       + KWYYFDD  V       +V        S 
Sbjct: 997  AVDNHYGGLGGGHYTAFA-KNP------VDGKWYYFDDSRVSETDPETSV--------SG 1041

Query: 1071 NVYVLFYER 1079
              Y+LFY R
Sbjct: 1042 AAYLLFYRR 1050

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSP 896
           R+ L DC+ +F+  EVL+  ++W CP C       R   + + Q  L NSP
Sbjct: 902 RISLFDCLKLFSKPEVLSAADSWYCPTC-------REHRQATKQIQLWNSP 945

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 90/203 (44%), Gaps = 21/203 (10%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK--------ESAISN 698
           +TGL NLGNTCY+N  LQ L    EL++ F+   Y  ++ + N N           A S 
Sbjct: 292 ITGLYNLGNTCYMNSALQCLVHIPELRDYFL---YNCFEDEINCNNPLGYQGYVARAFSG 348

Query: 699 TFANLFNKMYMNGGCTVVPS----GFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
              NLF    ++ G T+ P+    GF          +     QQD+QEF+ F+L+ LH++
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHED 407

Query: 755 LSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
           L+  V+   +               ++ +     W  K  +    S +  +F G  E+ L
Sbjct: 408 LNRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTW--KLHLQRNDSVITDLFVGLYESTL 465

Query: 812 QCQRCGYESVNYSTFYVLSLALP 834
           QC  C   S+ +  +  L+L LP
Sbjct: 466 QCPECNNVSITFDPYNDLTLPLP 488

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV---LNIVLKNEEIVRYKLYSIV 1013
            K I     P VL+IHL RF      + K D VV +P+    ++  L N+   R  +Y +V
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 1014 ---NHTGNLISGHYTSLV-NKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSS 1069
               NH G L  GHYT+   N D        + KWYYFDD  V    T    ++GI    +
Sbjct: 974  AVDNHYGGLGGGHYTAYAKNVD--------DSKWYYFDDSRV----TETTPERGI----A 1017

Query: 1070 KNVYVLFYER 1079
             + Y+LFY R
Sbjct: 1018 SSAYLLFYVR 1027

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKC 873
           ++ L DC+ +F+  EVL   ++W CP C
Sbjct: 879 KITLHDCLKLFSKREVLGMNDSWYCPSC 906

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 93/208 (44%), Gaps = 18/208 (8%)

Query: 639 SNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAIS 697
           +NP     + GL NLGNTCY+N  LQ L    +L++ F  G Y +E  +         ++
Sbjct: 280 NNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVA 339

Query: 698 NTFANLFNKMY-----MNGGCTVVPSGF---LKICNFLRPDLRIPDDQQDTQEFLLFILN 749
             F NL   +Y          +  P+ F   L   N +         QQD+QEFL F+L+
Sbjct: 340 TAFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYM----QQDSQEFLAFLLD 395

Query: 750 RLHDELSNQVN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806
            LH++L N+++    I                 K+  KK +D  +  N  S ++ +F G 
Sbjct: 396 SLHEDL-NRIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARND-SVINDLFVGM 453

Query: 807 MENALQCQRCGYESVNYSTFYVLSLALP 834
            ++ L+C  C   S+ +  +  L+L LP
Sbjct: 454 YKSTLKCPTCKNISITFDPYNDLTLPLP 481

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 28/144 (19%)

Query: 945  EEWHKMKSKK-LVTIKTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPL-------- 993
            + W+  K K+     K +   + P++L+IHL RF      + K DAVV +P+        
Sbjct: 864  DSWYCPKCKEHRQATKQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPY 923

Query: 994  VLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
            V++ V+++  I  Y L+++ NH G L  GHYTS V         N + +WYYFDD  V +
Sbjct: 924  VVDSVVEDGCI--YDLFAVDNHYGGLGGGHYTSYVK-------NNIDNRWYYFDDSRVSS 974

Query: 1054 EKTHGNVDKGITKVSSKNVYVLFY 1077
                 +V        + + Y+LFY
Sbjct: 975  TDPKKSV--------AGSAYLLFY 990

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 847 VKLEDCINMFTSDEVLTGENAWDCPKC 873
           + L+ C+ +F+  EVL   ++W CPKC
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 89/200 (44%), Gaps = 18/200 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN-----DNKESAISNTFA 701
           +TGL NLGNTCY+N  LQ L    EL++ F+   +       N      N   A S    
Sbjct: 301 ITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLVK 360

Query: 702 NLFNKMYMNGGCTVV-PSGFLKI---CNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
           +LF   Y +       P+ F  I   CN +         QQD+QEFL F+L+ LH++L N
Sbjct: 361 SLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDGLHEDL-N 415

Query: 758 QVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL---SPVDGVFQGQMENALQCQ 814
           +V+                + D++  KK  + T   + L   S V  +F    E+ L+C 
Sbjct: 416 RVHDKPYIEKPSLSPNSD-VTDRDTIKKLAEDTWKMHLLRNDSIVTDLFVALYESTLECP 474

Query: 815 RCGYESVNYSTFYVLSLALP 834
            C   S+ +  +  L+L LP
Sbjct: 475 ECRNVSITFDPYNDLTLPLP 494

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 24/128 (18%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNEEIVRYKLYS 1011
            K I   S P VL+IHL RF      + K D  V +P     +  ++V ++     Y L +
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 1012 IVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            + NH G L  GHYT+ V          T  KW+YFDD  V   K   ++        + +
Sbjct: 964  VDNHFGGLGGGHYTAYV---------KTNDKWFYFDDSRVTETKPESSI--------AGS 1006

Query: 1072 VYVLFYER 1079
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 847 VKLEDCINMFTSDEVLTGENAWDCPKC 873
           + L DC+ +F+  EVL+  ++W CP C
Sbjct: 870 ISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (44%), Gaps = 8/192 (4%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFNKM 707
           GL NLGNTCY+N  LQ L    E K+ F+   Y +E  ++     +  I+  FA++   +
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 708 Y---MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN--VI 762
           +    +   +  P  F      L   +     QQD+QEFL F+L+ LH++L+  +    +
Sbjct: 407 FGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLNRIIEKPYV 465

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                       +  V K+     + K  + N  S +  +F G  ++ L C  C   SV 
Sbjct: 466 EKPELTSTDDTAEFKVIKKLADDTWGKHKLRND-SVITDLFVGLYKSTLICPVCKKTSVT 524

Query: 823 YSTFYVLSLALP 834
           +  +  L+L LP
Sbjct: 525 FDPYNDLTLPLP 536

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 24/129 (18%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNEEIVR-YKLY 1010
            K I   + P +L+IHL RF      + K    V +P     +   +V KNE+    Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V         N + KWYYFDD  V       ++        + 
Sbjct: 1056 AVDNHYGGLGGGHYTAYVK--------NIDGKWYYFDDSRVSETLPERSI--------AG 1099

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1100 SAYLLFYRR 1108

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKC 873
           ++ L DC+ +F++ EVL   ++W CP C
Sbjct: 961 KITLHDCLTLFSTPEVLGATDSWFCPNC 988

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 117/490 (23%), Positives = 196/490 (40%), Gaps = 115/490 (23%)

Query: 623  NQTLTRKFSI--PTIEKNSNPYVA-YSVTGLRNLGNTCYINCMLQSLFATNELKN-LF-- 676
            N+ +T + SI    I KN  P  A     GL N G TCY N  +Q++     +++ LF  
Sbjct: 414  NEIITDEGSIIPSNIIKNWGPVFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDI 473

Query: 677  ISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRI--- 733
            + GKY+   + PN     ++S T A    +M+++        G  K+  +  P+  I   
Sbjct: 474  LRGKYK--NIDPN-----SVSYTLAETTRRMWLSNK-----KGNKKVIAYYNPNELIERL 521

Query: 734  --------PDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKK 785
                    P +Q+D+ E+ + ++++L +   N V +             + M +      
Sbjct: 522  DDINWSMNPYNQEDSHEYFMSLMSKLQE---NSVPI------------GRNMTE------ 560

Query: 786  WFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLAL-PKPSAPAFYKS 844
                       S +  +F G +E  + C+ CG  S     FY LSL L  K + PA    
Sbjct: 561  -----------SIIYDIFGGLLEQTVTCKSCGGVSKTEQEFYDLSLDLNGKRNNPAKDVQ 609

Query: 845  GRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVE------PRFTSRTSTQTILPNSPHH 898
               +     +  + D     E++ +      K V+      PR     S Q I+P     
Sbjct: 610  QSQEQVQSDHHHSDDGNDAEEDSDNGIAENGKNVQQPNAIIPR---SQSPQEIIP----- 661

Query: 899  HKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTI 958
             K++K       KAI      F    LL        K+DK ++  + E     +K    I
Sbjct: 662  -KQTKARKYTIEKAIRD----FFNPELL--------KVDKNDKGYVCE---KCNKTTNAI 705

Query: 959  KTINFISLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNIVLKNEEI-----VRYKLYS 1011
            K    +  P+ L++HL +F ++   + K    VSYP+ L+I    E        +Y+L S
Sbjct: 706  KRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQLLS 765

Query: 1012 IVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            +V H G +L SGHY +   +         +  W  +DDE++       N    +  ++  
Sbjct: 766  VVVHEGRSLSSGHYIAHCRQ--------PDGTWATYDDELI-------NKISELKLLTEP 810

Query: 1071 NVYVLFYERV 1080
            N Y L Y R+
Sbjct: 811  NAYYLVYTRL 820

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 93/217 (42%), Gaps = 28/217 (12%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND-NKESAISNTFANLFN 705
           + GL NLGN+CY+N  LQ L    EL++ F+ G + +     N    +  I+  FA L  
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALVK 356

Query: 706 KMYMNGGCTV---VPSGFLKI--------CNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
            ++ +    +    P  F  I          FL         QQD+QE L F+L+ LH++
Sbjct: 357 SLFDDKASALQAFSPRAFKSIIGHHNGMFAGFL---------QQDSQELLAFLLDGLHED 407

Query: 755 LSNQVN--VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
           L+  +    +             + V +      ++K  + N    VD +F G  ++ L 
Sbjct: 408 LNRIMKKPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNESVIVD-LFVGLYKSTLT 466

Query: 813 CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKL 849
           C  C   SV +  F  L+L LP  S    + S +V++
Sbjct: 467 CPACDRVSVTFDPFSDLTLPLPVES----FWSAKVRI 499

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 78/186 (41%), Gaps = 44/186 (23%)

Query: 920  FRKLGLLE--KHEGKQEK--------LDKMERDEI----EEWHKMKSKK-LVTIKTINFI 964
             R + L E  KH  +QEK        L+   + E+    + W+    K+     K I   
Sbjct: 852  LRNMALEEAQKHRSEQEKGHISLTDCLELFSKSEVLGAADSWYCPNCKEHRQATKQIQLW 911

Query: 965  SLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV-LNIVLKNEEIV--------RYKLYSIV 1013
            + P +L IHL RF   +  + K   VV +P+  L++   +E +V         Y L ++ 
Sbjct: 912  NTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDM---SEHLVCHDPNQNSMYDLIAVD 968

Query: 1014 NHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVY 1073
            NH G L  GHYT+ V           + KWYYFDD  V   +          +  S   Y
Sbjct: 969  NHYGGLGGGHYTAYVK-------NFMDGKWYYFDDSRVSETEAE--------RAISGAAY 1013

Query: 1074 VLFYER 1079
            +LFY R
Sbjct: 1014 LLFYRR 1019

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 845 GRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           G + L DC+ +F+  EVL   ++W CP C
Sbjct: 870 GHISLTDCLELFSKSEVLGAADSWYCPNC 898

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 24/208 (11%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYR-EYQMKPNDNKESAISNTFANLFNK 706
            GL NLGNTCY+N  LQ L     +++ F  G Y+ E  +      +  I+N F+ L   
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQN 457

Query: 707 MYMNG---GCTVVPSGF-LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS------ 756
           +Y N      +  PS F L I ++ +  +     QQD+QEFL F+L+ LH++L+      
Sbjct: 458 LYKNQFIPSASYAPSQFKLTIGHYNQ--MFSGYFQQDSQEFLAFLLDGLHEDLNRIKDKP 515

Query: 757 --NQVNVIXXXXXXXXXXXXKMMVDK-EKYKKWFDKTVVANGLSPVDGVFQGQMENALQC 813
              + ++             ++  D  E + K  D  ++         +F G  ++ L+C
Sbjct: 516 YVEKPSLADGSDVNDYNIIARLAADTLEAHLKRNDSIII--------DLFVGLYKSTLKC 567

Query: 814 QRCGYESVNYSTFYVLSLALPKPSAPAF 841
             C + S+ +  +  L+L +P  S   F
Sbjct: 568 PVCNHVSITFDPYCDLTLPIPVESVWNF 595

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 77/166 (46%), Gaps = 28/166 (16%)

Query: 927  EKHEGKQEKLDKMERDEI----EEWHKMKSKK-LVTIKTINFISLPKVLIIHLSRFYY-- 979
            EK+   ++ L+  ER E+    + W+  K K      K I   S P +L IHL RF    
Sbjct: 959  EKNITLEDSLNLFERAEVLGINDSWYCPKCKHHRQASKQIQLWSTPDILTIHLKRFETQG 1018

Query: 980  DLTKKNDAVVSYP-----LVLNIVLKN-EEIVRYKLYSIVNHTGNLISGHYTSLVNKDPH 1033
              + K D VV +P     L  +I+ K+  ++  Y L ++ NH G L  GHYT+ +     
Sbjct: 1019 SFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLIAVDNHYGGLGGGHYTAYI----- 1073

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
             NL   + KWYYFDD  V       +V        + + Y+LFY R
Sbjct: 1074 KNL--IDNKWYYFDDSRVSETVPERSV--------AGSAYLLFYMR 1109

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 847 VKLEDCINMFTSDEVLTGENAWDCPKC 873
           + LED +N+F   EVL   ++W CPKC
Sbjct: 962 ITLEDSLNLFERAEVLGINDSWYCPKC 988

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 85/201 (42%), Gaps = 13/201 (6%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND-NKESAISNTFAN 702
           A   TGL NLGNTCY+N  LQ L    +L++ F+   Y +   + N       ++  F++
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSD 419

Query: 703 LFNKMY------MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS 756
           L  K++      M       PS F          +     QQD+QEFL F+L+ LH++L+
Sbjct: 420 LVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLN 478

Query: 757 NQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTV---VANGLSPVDGVFQGQMENALQC 813
             +                 + D    KK  D T    +    S +  +F G  ++ L C
Sbjct: 479 RIIK--KEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKSTLYC 536

Query: 814 QRCGYESVNYSTFYVLSLALP 834
             C   S+ +  +  ++L LP
Sbjct: 537 PECQNVSITFDPYNDVTLPLP 557

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNE-EIVRYKLY 1010
            K I   + P +L+IHL RF      + K DA V++P     L   +V K++   + Y LY
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLY 1055

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V           + KWYYFDD  V       ++        + 
Sbjct: 1056 AVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPENSI--------AG 1100

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1101 SAYLLFYIR 1109

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 92/196 (46%), Gaps = 16/196 (8%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN-DNK---ESAISNTFANLF 704
           GL NLGNTCY+N  LQ L    +L++ F+   Y+ ++ + N DN    +  ++ +FA L 
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL---YKVFEKEINLDNPLGYQGHVARSFAILI 399

Query: 705 NKMYMNG---GCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNV 761
             ++ +      +  P+ F          +     QQD+QEF+ F+L+ LH++L+   N 
Sbjct: 400 QNLFKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITN- 457

Query: 762 IXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL---SPVDGVFQGQMENALQCQRCGY 818
                          + ++E  KK  D T  ++ L   S +  +F G  ++ L C  C  
Sbjct: 458 -KPVVEKPSLKPEDDVSNQEVIKKLADDTWNSHLLRNDSIITDIFVGLYKSTLHCPECDN 516

Query: 819 ESVNYSTFYVLSLALP 834
            SV +  +  L+L LP
Sbjct: 517 LSVTFDPYNDLTLPLP 532

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV-LNI---VLKNEEI--VRYKLY 1010
            K +   S P +L+IHL RF      + K D  V +P+  L++   V+ N+E     Y L 
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            S+ NH G L  GHYT+ V           ++KWYYFDD  V       ++        + 
Sbjct: 1003 SVDNHYGGLGGGHYTAYVK-------NFVDKKWYYFDDSRVTETVPERSI--------AG 1047

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1048 SAYLLFYMR 1056

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKC 873
           ++ L+DC+N+F   EVL   ++W CP C
Sbjct: 908 KITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 88/212 (41%), Gaps = 27/212 (12%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK--------ESA 695
           A    GL NLGNTCY+N  LQ L    +L++ F+   Y  Y+ + N +           A
Sbjct: 319 AKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFL---YSAYEAELNTDNLIGYKGYVAKA 375

Query: 696 ISNTFANLFNKMYMNGGC--TVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHD 753
            S+   NLF       G   +  P+ F          +     QQD+QEFL F+L+ LH+
Sbjct: 376 FSSLVQNLFGDTITKQGTNSSFGPNHFKSTVGHFN-SMFSGYLQQDSQEFLAFLLDSLHE 434

Query: 754 ELSNQVN-------VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQ 806
           +L+  +N        +            K + D    + W  K  +    S +  +F G 
Sbjct: 435 DLNRIINKPSTEKPSLKEGDDYNDPAVIKSLAD----ETW--KMHLLRNDSVITDLFVGM 488

Query: 807 MENALQCQRCGYESVNYSTFYVLSLALPKPSA 838
            ++ L+C  C   S+ +  +  L+L LP  S 
Sbjct: 489 YKSTLECPECTNVSITFDPYSDLTLPLPVDST 520

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 62/129 (48%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP---LVLNIVLKNEEIVR---YKLY 1010
            K I   + P VL+IHL RF      + K DA V++P   L ++  L +++  R   Y LY
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKDDPRGTVYDLY 965

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V           + KWYYFDD  V       +V        S 
Sbjct: 966  AVDNHYGGLGGGHYTAYVK-------NFIDNKWYYFDDSRVYETDPEKSV--------SG 1010

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1011 SAYLLFYLR 1019

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKC 873
            + L DC+N+F+  EVL   ++W CP C
Sbjct: 871 EITLNDCLNLFSKREVLGLNDSWYCPHC 898

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 84/195 (43%), Gaps = 10/195 (5%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPNDNKESAISNTFANLFN 705
             GL NLGNTCY+N  LQ L    E K+ F+   Y +E  +      +  I+  F  L  
Sbjct: 348 TVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQ 407

Query: 706 KMYM---NGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
            ++    N   +  P  F      L   +     QQD+QEFL F+L+ LH++L+  V+  
Sbjct: 408 SLFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDLNRIVD-- 464

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL---SPVDGVFQGQMENALQCQRCGYE 819
                         + + E  KK  D T + + L   S +  +F G  ++ L C  C   
Sbjct: 465 KPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSVILDLFVGLYKSTLICPTCKKV 524

Query: 820 SVNYSTFYVLSLALP 834
           S  +  +  L+L LP
Sbjct: 525 STTFDPYNDLTLPLP 539

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV-LN----IVLKNEEI-VRYKLY 1010
            K I   + P +L+IHL RF      + K   +V +P+  L+    +V K+++    Y L 
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLI 1030

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V           + KWYYFDD  V       ++        + 
Sbjct: 1031 AVDNHYGGLGGGHYTAYVK-------NFLDNKWYYFDDSRVNETVPERSI--------AG 1075

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1076 SAYLLFYRR 1084

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 846 RVKLEDCINMFTSDEVLTGENAWDCPKC 873
           ++ L DC+ +F++ EVL   ++W CP C
Sbjct: 936 KITLHDCLTLFSTPEVLGATDSWYCPSC 963

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 69/157 (43%), Gaps = 37/157 (23%)

Query: 945  EEWHKMKSKKLV-TIKTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV------- 994
            + W+    KKL    + I   S P++L++HL RF  +Y  T K +  V +PL        
Sbjct: 952  DSWYCPACKKLRQATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPH 1011

Query: 995  ----------LNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWY 1044
                             E +  Y L ++ NH G L SGHYT+ V K+P       + KWY
Sbjct: 1012 LPCRDGDGDGDGDDGGRENV--YDLIAVDNHFGGLGSGHYTAYV-KNP------VDDKWY 1062

Query: 1045 YFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
             FDD  V+       VD     V+S   Y+LFY R D
Sbjct: 1063 LFDDSEVR------EVDA--ESVASSFGYLLFYRRRD 1091

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 84/205 (40%), Gaps = 28/205 (13%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFI-SGKYREYQMKPNDNKESAISNTFANLFNKM 707
           GL NLG+TC+IN +LQ L    EL++ F+ +G   E   + +      ++  FA +   +
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQAL 411

Query: 708 YMNGGC---TVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQ------ 758
           + +      T   S F     + RP L  P  QQD+ E + F+L  LH++L+        
Sbjct: 412 FGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRAPEGPRV 470

Query: 759 ----------VNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808
                      +V             ++  D     K  + +V+ +       +F G ++
Sbjct: 471 GQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSVITD-------LFAGMLK 523

Query: 809 NALQCQRCGYESVNYSTFYVLSLAL 833
           + L C  C   SV +     L++ L
Sbjct: 524 STLTCLTCRRSSVTFDPCTELAVPL 548

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 4/35 (11%)

Query: 843 KSGRVK----LEDCINMFTSDEVLTGENAWDCPKC 873
           ++GR K    LEDC+++FT+ EVL   ++W CP C
Sbjct: 925 RAGRQKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 88/216 (40%), Gaps = 47/216 (21%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLF-ISGKYREYQMKPNDNKESAISNTFANLFNKM 707
           GL NLGNTCY+N  LQ L    +    F ++G  +E  +      +  ++N F  L +K+
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 708 YMN--------------------------GGCTVVPSGFLKICNFLRPDLRIPDDQQDTQ 741
           +                            G C  + SG+L               QQD+Q
Sbjct: 475 FEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL---------------QQDSQ 519

Query: 742 EFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVAN---GLSP 798
           EFL FIL+ LH++L N++ +                 D +  KK  D T  A+     S 
Sbjct: 520 EFLAFILDGLHEDL-NRI-LKKPFVEKPSLPENSNYKDYKVIKKLADDTWEAHLKRNDSI 577

Query: 799 VDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALP 834
           V  +F G  ++ LQC  C   SV +  +  L+L LP
Sbjct: 578 VTDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLP 613

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 62/129 (48%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNEEIVR-YKLY 1010
            K I   + P +L+IHL RF      + K DAVV++P     L  +IV  ++E    Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V           +QKWYYFDD  V       ++        S 
Sbjct: 1164 AVDNHYGGLGGGHYTAYVK-------NFVDQKWYYFDDSRVSLADPQRSI--------SG 1208

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1209 SAYLLFYVR 1217

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 841  FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
            F K   + L+DC+ +F+  E+L  +++W CP C
Sbjct: 1064 FEKEKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 88/205 (42%), Gaps = 21/205 (10%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK----ESAISNT 699
           A   TGL NLGNTCY+N  LQ L    +L++ F+   Y  Y+ + N+         ++  
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL---YDGYENEINEENPLGYHGYVARA 416

Query: 700 FANLFNKMY------MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHD 753
           F++L  K++      M       PS F          +     QQD+QEFL F+L+ LH+
Sbjct: 417 FSDLIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHE 475

Query: 754 ELSNQVNVIXXXXXXXXXXXXKMMVDKEK-YKKWFDKTV---VANGLSPVDGVFQGQMEN 809
           +L+    +I               VD     KK  D T    +    S +  +F G  ++
Sbjct: 476 DLN---RIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHLKRNCSVITDLFVGMYKS 532

Query: 810 ALQCQRCGYESVNYSTFYVLSLALP 834
            L C  C   S+ +  +  ++L LP
Sbjct: 533 TLYCPECKNVSITFDPYNDVTLPLP 557

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 62/129 (48%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNEEIVR-YKLY 1010
            K I   + P +L+IHL RF      + K DA V++P     L  N+V K++     Y LY
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLY 1051

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V      N  N   KWYYFDD  V       ++        + 
Sbjct: 1052 AVDNHYGGLGGGHYTAYV-----KNFAN--NKWYYFDDSRVTETVPENSI--------AG 1096

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1097 SAYLLFYIR 1105

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 843 KSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           K   + L+DC+ +F+  E+L   ++W CP C
Sbjct: 954 KERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 86/201 (42%), Gaps = 19/201 (9%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK----ESAISNTFAN 702
            TGL NLGNTCY+N  LQ L    +L++ F+   Y  Y+ + N+         ++  F++
Sbjct: 363 TTGLVNLGNTCYMNSALQCLVHIPQLRDYFL---YNGYESEINEENPLGYHGYVARAFSD 419

Query: 703 LFNKMY------MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS 756
           L  K++      M       PS F          +     QQD+QEFL F+L+ LH++L+
Sbjct: 420 LVQKLFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLN 478

Query: 757 NQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTV---VANGLSPVDGVFQGQMENALQC 813
             +                 + D    KK  D T    +    S +  +F G  ++ L C
Sbjct: 479 RIIK--KAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNCSVITDLFVGLYKSTLYC 536

Query: 814 QRCGYESVNYSTFYVLSLALP 834
             C   S+ +  +  ++L LP
Sbjct: 537 PECKNVSITFDPYNDVTLPLP 557

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLVL-----NIVLKNEEIVR-YKLY 1010
            K I   + P +L++HL RF      + K DA V++P+       ++V K++     Y LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V      N  ++  KWYYFDD  V       ++        S 
Sbjct: 1058 AVDNHYGGLGGGHYTAYV-----KNFADS--KWYYFDDSRVTETVPENSI--------SG 1102

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1103 SAYLLFYIR 1111

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 847 VKLEDCINMFTSDEVLTGENAWDCPKC 873
           + L+DC+ +F+  E+L   ++W CP C
Sbjct: 964 ITLDDCLQLFSKPEILGLNDSWYCPTC 990

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 65/138 (47%), Gaps = 22/138 (15%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIV--LKNEE 1003
            ++++LV +K      LP  L +HL RF Y   K+N  +     + YPL LN+   + +E 
Sbjct: 545  EAERLVGLK-----QLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEV 598

Query: 1004 IVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
              +Y+L  IV H G     GHY SL     H   G     W  FDDE V+A K    ++ 
Sbjct: 599  CQKYELAGIVVHMGGGPQHGHYVSLCK---HQKFG-----WLLFDDETVEAVKEETVLEF 650

Query: 1063 GITKVSSKNVYVLFYERV 1080
                 +    YVLFY+ V
Sbjct: 651  TGESANMATAYVLFYKAV 668

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFI--------SGKYREYQMKPN 689
           V G  N GNTCY N +LQ L+  + L+   +        SG  R+ +M+ N
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIESGHPRKNEMRGN 189

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 90/199 (45%), Gaps = 21/199 (10%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK----ESAISNTFANLF 704
           GL NLGNTCY+N  LQ L    ++++ F+   Y  ++ + N N     +  ++ +F  L 
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV---YNGFEKEINVNNPLGFQGHMARSFHGLI 378

Query: 705 NKMYMNGGCTVVP-SGFLKICNFLRPDLRIPD-----DQQDTQEFLLFILNRLHDELSNQ 758
             ++   G ++ P   ++   +F    +          QQD+QEFL F+L+ LH++L+  
Sbjct: 379 QSLF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLHEDLNRI 435

Query: 759 VN---VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
           V    V                + K   + W  K+ +    S +  +F G  ++ L+C  
Sbjct: 436 VEKPYVEKPSLKPGDDINDFDTIKKLANETW--KSHLMRNDSIITDIFVGMYKSTLECPE 493

Query: 816 CGYESVNYSTFYVLSLALP 834
           C   S+ +  +  L+L LP
Sbjct: 494 CSNVSITFDPYNDLTLPLP 512

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP---LVLNIVLKNEEIVR---YKLY 1010
            K I   + P V +IHL RF      + K DA + +P   L ++  L  ++  R   Y L 
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLI 986

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G +  GHYT+ V      NL  T+Q WYYFDD  V       ++        + 
Sbjct: 987  AVDNHYGGMGGGHYTAYV-----KNL--TDQNWYYFDDSRVSKTSPEKSI--------AG 1031

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1032 SAYLLFYLR 1040

 Score = 36.6 bits (83), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 849 LEDCINMFTSDEVLTGENAWDCPKC 873
           L+DC+N+F+  EVL   ++W CP C
Sbjct: 895 LKDCLNLFSKKEVLGMSDSWYCPNC 919

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 87/203 (42%), Gaps = 26/203 (12%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK----ESAISNTFAN 702
           + GL NLGNTCY+N  LQ L    EL   F+   Y+ Y+ + N N     +  +++ F +
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFL---YKGYEREININNPLGHKGDVAHAFGH 394

Query: 703 LFNKMYMN--GGCTV-VPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS--- 756
           L   ++    G  T   P  F          L     QQD+QEFL F+L+ LH++L+   
Sbjct: 395 LLYSLFAPSYGQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLNRVI 453

Query: 757 -----NQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811
                N+                 +  +   Y K  + +V+ +       +F G  ++ L
Sbjct: 454 EKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMD-------LFVGLYKSTL 506

Query: 812 QCQRCGYESVNYSTFYVLSLALP 834
            C  C + S+ +  +  L+L LP
Sbjct: 507 VCPNCNHVSITFDPYNDLTLPLP 529

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 57/130 (43%), Gaps = 25/130 (19%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPL-------VLNIVLKNEEIVRYKL 1009
            K I   + P +L+IHL RF      + K DA V +P+        L+   + E  V Y L
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDV-YDL 994

Query: 1010 YSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSS 1069
             ++ NH G L  GHYT+             + KWYYFDD  V       ++        +
Sbjct: 995  IAVDNHYGGLGGGHYTAYCR-------NFIDGKWYYFDDSRVNEVSPENSI--------A 1039

Query: 1070 KNVYVLFYER 1079
             + Y+LFY R
Sbjct: 1040 GSAYLLFYRR 1049

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 87/203 (42%), Gaps = 17/203 (8%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK----ESAISNT 699
           A   TGL NLGNTCY+N  LQ L    +L++ F+   Y  Y+ + N+         ++  
Sbjct: 357 ASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFL---YNGYEKEINEENPLGYHGYVARA 413

Query: 700 FANLFNKMYMNGGCTVVPSGFLKICNFLRP-----DLRIPDDQQDTQEFLLFILNRLHDE 754
           F++L  K++ N    +  +G      F         +     QQD+QEFL F+L+ LH++
Sbjct: 414 FSDLIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHED 473

Query: 755 LSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTV---VANGLSPVDGVFQGQMENAL 811
           L+  +                 + D    KK  D T    +    S +  +F G  ++ L
Sbjct: 474 LNRIIK--KAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNRSVITDLFVGMYKSTL 531

Query: 812 QCQRCGYESVNYSTFYVLSLALP 834
            C  C   S  +  +  ++L LP
Sbjct: 532 YCPECKDVSTTFDPYNDVTLPLP 554

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYP-----LVLNIVLKNE-EIVRYKLY 1010
            K I   + P +L+IHL RF      + K D  V++P     L  ++V K++     Y LY
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYDLY 1054

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+ V           + KWYYFDD  V       +V        + 
Sbjct: 1055 AVDNHYGGLGGGHYTAYVK-------NFMDNKWYYFDDSRVTETVPENSV--------AG 1099

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1100 SAYLLFYIR 1108

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 843 KSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           K   + L DC+ +F+  E+L   ++W CP C
Sbjct: 957 KERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
            YPL072W
          Length = 494

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 99/398 (24%), Positives = 160/398 (40%), Gaps = 100/398 (25%)

Query: 648  TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            TGL N GN C+IN  +Q+L   ++L   ++S    + +        + ++     L  + 
Sbjct: 76   TGLVNPGNDCFINSSIQALVPLDKLTT-YLSATLEDEKTASTLPLHNGLATMLLEL--QQ 132

Query: 708  YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
              +   +V    F++    +    +I   Q D  EF   IL RL++E             
Sbjct: 133  LRSDPKSVSSKRFIQQLETIFGG-KISRQQNDAHEFTQLILERLNEE------------- 178

Query: 768  XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYES-VNYSTF 826
                    + +D        D TV           F+G + N L C +CG  S VN   F
Sbjct: 179  -------NLTLDHA------DLTVP----------FKGIVGNHLVCLQCGRTSHVNEQPF 215

Query: 827  YVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRT 886
            Y+  L LP+         G VKL D +N    +++ T EN + C  C + A         
Sbjct: 216  YIYELTLPQ--------QGSVKLSDLVN---GEQMETIEN-YSCMYCKTVA--------- 254

Query: 887  STQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGK------QEKLDKME 940
                +L N     +KS          +SR+ +   +L +L+  +GK       E+L +  
Sbjct: 255  ----MLTN--EREEKSN---------VSRTDA---ELNILKFLKGKLSTLLINEELPEHI 296

Query: 941  RDEIEEWHK----MKSKKLVTIKTINFISLPKVLIIHLSRFYYDLT--KKNDAVVSYP-- 992
               I  ++K        K V ++   F   P++ +IHLSR  ++     +N   V +   
Sbjct: 297  THYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEE 356

Query: 993  -LVLNIVLKNE-----EIVRYKLYSIVNHTGNLISGHY 1024
             L+   +LK+      E V+YKL SIV HTG+   GHY
Sbjct: 357  ILLPRQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 32/144 (22%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNI--VLKNEE 1003
            ++++L+ IK      LPK L++HL RF Y   +KN  +     V+YP  LNI  V  +  
Sbjct: 530  EAERLIGIK-----ELPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSI 583

Query: 1004 IVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
              +Y+L SIV H G     GHY +L     H + G     W  +DDE V+A       D+
Sbjct: 584  SKKYELNSIVVHIGESPQLGHYVTLC---KHKSYG-----WLIYDDETVQAVS-----DE 630

Query: 1063 GITKV-----SSKNVYVLFYERVD 1081
             ++++      S   Y+LFYE VD
Sbjct: 631  LVSRILNNEQRSATAYLLFYEEVD 654

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 639 SNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS-GKYREYQMKPNDNKESAIS 697
           SN  V   V G +N G TCY N +LQ+LF     ++  I      E+Q+K    +++   
Sbjct: 97  SNYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIGPASIGEFQLKNISMRKNTEL 156

Query: 698 NTFANL 703
           +T AN+
Sbjct: 157 DTNANI 162

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 105/462 (22%), Positives = 184/462 (39%), Gaps = 121/462 (26%)

Query: 649  GLRNLGNTCYINCMLQSLFATNELKN-LF--ISGKYREYQMKPNDNKESAISNTFANLFN 705
            GL N G TCY N  +Q++     +++ LF  + GKY +  + P     +++S   A    
Sbjct: 334  GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYSD-TISP-----TSVSTVLAETSR 387

Query: 706  KMYMNGGCTVVPSGFLK--ICNFLRPD---LRIPD--------DQQDTQEFLLFILNRLH 752
            +M+        P+  LK  I  ++ P+    R+ D         Q+D+ E+ + +++RL 
Sbjct: 388  RMWF-------PNEILKKKIGTYIDPNKLICRLDDINCMMSEWQQEDSHEYFMSLMSRLQ 440

Query: 753  DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
            ++                    KM                    S +  +F G ++ A+ 
Sbjct: 441  ED--------------SVPKGHKMTE------------------SIIYDIFGGLLKQAVT 468

Query: 813  CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPK 872
            C+ CG  S     FY LSL L   +      +      +  N  T+ +  T EN      
Sbjct: 469  CKSCGSISKTEQPFYDLSLHLKGKNKSDLNINSEANTSNGGN--TTQDSSTTEN------ 520

Query: 873  CGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGK 932
             GS  V      + +TQ +   +       KF       +I +S   F    L+      
Sbjct: 521  -GSLEV---GNGKAATQQVSAQAKQLAVNRKF-------SIEKSIKDFFNPELI------ 563

Query: 933  QEKLDKMERDEI-EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVV 989
              ++D  ++  + E+ HK  +      K  + +  P+ L++HL +F ++ T   K    V
Sbjct: 564  --RVDNEQKGYVCEKCHKTTN----AAKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAV 617

Query: 990  SYPLVLNIVL--------KNEEI--VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGN 1038
            SYP+ L++          K +++  V+Y+L S+V H G +L SGHY +   K P      
Sbjct: 618  SYPMFLDLTKYCDKEATPKGQDVLPVKYQLISVVVHEGRSLSSGHYIAHC-KQP------ 670

Query: 1039 TEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             +  W  +DDE +  + T  +V      +   N Y L Y R+
Sbjct: 671  -DGSWSTYDDEYIN-KITERDV------LRESNAYYLVYTRL 704

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 89/196 (45%), Gaps = 10/196 (5%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND-NKESAISNTFANLFNKM 707
           GL NLGNTCY+N  LQ +      ++ F+ G +++   + N    +  ++  F++L   +
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSL 390

Query: 708 Y---MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXX 764
           +   +       PS F          +     QQD+QEFL F+L+ LH++L N+++    
Sbjct: 391 FGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL-NRIDKKPY 448

Query: 765 XXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL---SPVDGVFQGQMENALQCQRCGYESV 821
                      +  D +  K+  D T  A+ L   S +  +F    ++ L+C  C   SV
Sbjct: 449 VEKPSLPLTANLN-DFDVVKRLADDTWKAHLLRNDSVITDLFVAMYKSTLKCPECQNTSV 507

Query: 822 NYSTFYVLSLALPKPS 837
            +  +  L+L LP  S
Sbjct: 508 TFDPYNDLTLPLPVAS 523

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDAV--VSYPLV---LNIVLKNEEIVR---YKLY 1010
            K I   + P +L+IHL RF    +  +  V  V +P+    ++  L  +E  R   Y L 
Sbjct: 973  KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLI 1032

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+             + KWYYFDD  V       ++        + 
Sbjct: 1033 AVDNHYGGLGGGHYTAYAK-------NANDNKWYYFDDSRVSVTAPEKSI--------AG 1077

Query: 1071 NVYVLFYER 1079
            + Y+LFY R
Sbjct: 1078 SAYLLFYVR 1086

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%)

Query: 847 VKLEDCINMFTSDEVLTGENAWDCPKC 873
           + L+DC+ +F+  E+L+  ++W CP C
Sbjct: 939 ITLDDCLKLFSKPEILSSNDSWYCPHC 965

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNI--VLKNEEIVRYKLYSI 1012
            +++    LP  L +HL RF Y  TK ++      V YPL L++     N    +Y+L  I
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G     GHY SL   D   N G     W  FDDE V++      +D      +   
Sbjct: 664  VVHMGGGPQHGHYVSLCKND---NFG-----WLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1072 VYVLFYERV 1080
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 50/137 (36%), Gaps = 34/137 (24%)

Query: 737 QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            QD  EFL F+LN L D L+N                 K   D E++   F         
Sbjct: 494 HQDAHEFLNFLLNELSDYLNNGA---------------KSGKDDEEHSLNF--------- 529

Query: 797 SPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMF 856
             +  +FQG + N ++C  C   +     F    + +P  S           ++  +  F
Sbjct: 530 --IKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDS--------ETDIQALLQNF 579

Query: 857 TSDEVLTGENAWDCPKC 873
              E+L+G N + C  C
Sbjct: 580 DQREMLSGPNKFYCNVC 596

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 65/138 (47%), Gaps = 22/138 (15%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIV--LKNEE 1003
            ++++LV +K      LP  L +HL RF Y   K+N  +     + YPL LN+   + +E 
Sbjct: 548  EAERLVGLK-----QLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEV 601

Query: 1004 IVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
              +Y+L  IV H G     GHY SL     H   G     W  FDDE V+A K    ++ 
Sbjct: 602  CQKYQLAGIVVHMGGGPQHGHYVSLCK---HEKFG-----WLLFDDETVEAVKEETVLEF 653

Query: 1063 GITKVSSKNVYVLFYERV 1080
                 +    YVLFY+ +
Sbjct: 654  TGESPNMATAYVLFYKAM 671

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 632 IPTIEKNSNPYVAYS--VTGLRNLGNTCYINCMLQSLFATNELKNLFI--------SGKY 681
           + TI   S PY   S  V G  N GNTCY N +LQ L+  + L+   +        S + 
Sbjct: 123 LATIASESMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIESNQS 182

Query: 682 REYQMKPN 689
           R++ MK N
Sbjct: 183 RKHDMKGN 190

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 66/139 (47%), Gaps = 22/139 (15%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIVLKNEEIV 1005
            ++++LV +K     SLPK L +HL RF Y   +KN  V     + YPL+LN     +  V
Sbjct: 554  EAERLVGLK-----SLPKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSV 607

Query: 1006 --RYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
               Y+L  +V H GN    GHY SL     H  L      W  FDDE V++      +D 
Sbjct: 608  SKSYRLQGVVVHMGNGPHHGHYVSLC----HTELFG----WLLFDDETVESVDESYVLDF 659

Query: 1063 GITKVSSKNVYVLFYERVD 1081
              +  S    YVLFY  +D
Sbjct: 660  VGSHESPTTAYVLFYSEID 678

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND---NKESAISNTFANL 703
           V G  N GNTCY N +LQ L+   E +   +     EY  KP +   +++ A+      L
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFRLRVL-----EYPEKPEEQERHRKRAMVGKHPRL 214

Query: 704 FNK 706
           F +
Sbjct: 215 FTR 217

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 22/136 (16%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIV--LKNEE 1003
            ++++LV +K      LP  L +HL RF Y   K+N  +     + YPL LN+   + +E 
Sbjct: 547  EAERLVGLK-----QLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEV 600

Query: 1004 IVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
              +Y+L  IV H G     GHY SL     H   G     W  FDDE V+A K    ++ 
Sbjct: 601  CQKYELSGIVVHMGGGPQHGHYVSLCK---HEIFG-----WLLFDDETVEAVKEEAVLEF 652

Query: 1063 GITKVSSKNVYVLFYE 1078
                 +    YVLFY+
Sbjct: 653  TGESPNMATAYVLFYK 668

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 113/503 (22%), Positives = 190/503 (37%), Gaps = 151/503 (30%)

Query: 607  IRPPAKLPIHALHSPRNQTLTRKFSI--PTIEKNSNP-YVAYSVTGLRNLGNTCYINCML 663
            + PP+ +P  +     N+    K  +   +I K+  P Y      GL N G TCY N  +
Sbjct: 341  VTPPSTIPDISEFYQFNENFDDKGCLENSSIVKSWGPTYSKLKPKGLLNHGVTCYTNAAV 400

Query: 664  QSLF---ATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGF 720
            Q+L    A     N  ++GKY            +++S+  A    +M+ N G     SG 
Sbjct: 401  QALLHIPAMQHYLNDILAGKYSSTISS------NSVSHVLAETSRRMWHNDG---KKSGN 451

Query: 721  LKICNFLRPDLRIP--DD---------QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXX 769
                +++ P   I   DD         Q+D+ E+ + I++RL ++               
Sbjct: 452  ----SYINPKKLIARLDDINCMMSEWQQEDSHEYFMSIMSRLQED--------------S 493

Query: 770  XXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVL 829
                 KM                    S +  +F G ++  + C+ CG  S     FY L
Sbjct: 494  VPKGHKMTE------------------SIIYDIFGGSLKQTVTCKSCGEVSTTEQPFYDL 535

Query: 830  SLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQ 889
            SL L           G+   E+ +N                     K+     T  + +Q
Sbjct: 536  SLHL----------KGKKTDENTVNQ-------------------EKSSSQSETKDSDSQ 566

Query: 890  TILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEI-EEWH 948
            T           S++       +I +S   F    L+        K+DK ++  + E+ H
Sbjct: 567  T-----------SRY-------SIEKSIRDFFNPELI--------KVDKEKKGYVCEKCH 600

Query: 949  KMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIVLKNEEI-- 1004
            K  +     +K  + +  P+ L++HL +F ++ T   K    VSYP+ L++    EE   
Sbjct: 601  KTTN----ALKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKK 656

Query: 1005 ---VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNV 1060
               V+Y+L S+V H G +L SGHY +   K P       +  W  +DDE +         
Sbjct: 657  MLPVKYELLSVVVHEGRSLSSGHYIAHC-KQP-------DGSWATYDDEYINK------- 701

Query: 1061 DKGITK---VSSKNVYVLFYERV 1080
               IT+   +  +N Y + Y R+
Sbjct: 702  ---ITEREVLKERNAYYVLYTRL 721

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 89/212 (41%), Gaps = 38/212 (17%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFI-SGKYREYQMKPNDNKESAISNTFANLFN 705
           +TGL NLGNTCY+N  LQ +      +  F+ SG  +E         +  ++  F+ L  
Sbjct: 320 ITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSELIR 379

Query: 706 KMYMN-----------------GGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFIL 748
            ++ +                 G    + SG+L               QQD+QEFL F+L
Sbjct: 380 CLFGDKLVQFSAYAPNHFKATIGHFNSMFSGYL---------------QQDSQEFLAFLL 424

Query: 749 NRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL---SPVDGVFQG 805
           + LH++L N+++               +  D    KK  D T  A+ L   S +  +F G
Sbjct: 425 DSLHEDL-NRIDKKPYVEKPSLPSTADLN-DFRIVKKLADDTWKAHLLRNDSVITDLFVG 482

Query: 806 QMENALQCQRCGYESVNYSTFYVLSLALPKPS 837
             ++ L+C  C   S+ +  +  L+L LP  S
Sbjct: 483 LYKSTLECPECQNISITFDPYNDLTLPLPVKS 514

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 959  KTINFISLPKVLIIHLSRF--YYDLTKKNDAVVSYPLV-----LNIVLKNEEIVR-YKLY 1010
            K I   + P VL+IHL RF      + K D VV +P+       ++V K++     Y L 
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLI 989

Query: 1011 SIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            ++ NH G L  GHYT+           +T+ KWYYFDD  V    T    +  IT  +  
Sbjct: 990  AVDNHYGGLGGGHYTAYAK-------NSTDGKWYYFDDSRV----TETVAENSITGAA-- 1036

Query: 1071 NVYVLFYER 1079
              Y+LFY R
Sbjct: 1037 --YLLFYLR 1043

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 843 KSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           K+  + L DC+N+F+  E+L+  ++W CP C
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 114/272 (41%), Gaps = 46/272 (16%)

Query: 606 YIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQS 665
           Y+     L I  +  P +  ++++ S+PT  +    Y      GL NLG+TC+++ +LQS
Sbjct: 103 YVAGCETLDIAGV--PWDSAMSKQVSLPTSLRRDGLY------GLLNLGSTCFMSSILQS 154

Query: 666 LFATNELKNLFI-SGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKI- 723
           L     ++  F+ SG  R   ++   +  S IS     + ++ Y +       +GFL + 
Sbjct: 155 LIHNTYIQYWFLNSGHARRCALR---DPSSCISCALDRIISECYGSLSERNDHAGFLSLL 211

Query: 724 -CNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEK 782
            C++          QQD  EFL F+LN+LH +   +                   VD++K
Sbjct: 212 TCSWKINQNFAGYSQQDAHEFLQFLLNQLHCDYKRE-----------------RQVDEDK 254

Query: 783 YKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYES-VNYSTFYVLSLALPKPSAPAF 841
             +     +       V   FQG + +++ C  C  +S      F  LSL +        
Sbjct: 255 EVRSSSSQLCH---CIVHSSFQGTLRSSIVCPECQDDSKTMLDPFLDLSLDIK------- 304

Query: 842 YKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
              G+  L DC++ F   E L  +  + CP+C
Sbjct: 305 ---GQRTLYDCLDSFHRREQLH-DFDYHCPRC 332

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 19/108 (17%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDLTKKNDAV---VSYPLVLNI---VLKNEEI--VRYKL 1009
            IK +    L   L++ L RF +  + +N  +   V +PL L++       E    + Y+L
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 1010 YSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDD---EVVKAE 1054
              +V+H+G +  GHYT+++  +          +W+ F+D    VV AE
Sbjct: 399  SGVVSHSGTVNEGHYTAVLQLNS--------GEWFKFNDSMISVVSAE 438

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 109/257 (42%), Gaps = 52/257 (20%)

Query: 646 SVTGLRNLGNTCYINCMLQSLFATNE-LKNLFISGKYREYQMK-PNDNKESAISNTFANL 703
            ++GL N+G+TCY++C++Q L      LK+ F    Y+E +++ P      A+ +    L
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDPVSCLSCALDSVVFEL 194

Query: 704 FNKMY------MNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
           + K         NGG   + +   KI      DL +   QQD  EF  F++NR+H E   
Sbjct: 195 YGKTQKKAVDDKNGGLIDILNCTWKI----NEDL-VGYSQQDAHEFWQFLMNRIHSEYKL 249

Query: 758 QVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
             N I               V K+ ++       + N +     VFQG +E+ ++C  C 
Sbjct: 250 NNNTIE--------------VPKDTHQ-------LCNCI--YHKVFQGFLESTIECANCR 286

Query: 818 YESVNYSTFYV-LSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
            ES   +  Y+ LSL L            +  L +C+N F   E L  +  + C  CG  
Sbjct: 287 KESKTTTEAYMDLSLDLKD----------KKTLYECLNSFHMKEELK-DFTFHCSNCGG- 334

Query: 877 AVEPRFTSRTSTQTILP 893
              P+   +  T + LP
Sbjct: 335 ---PQGALKQLTISKLP 348

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 25/111 (22%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDL----TKKNDAVVSYPLVLNI-----VLKNEEI--- 1004
             +K +    LP VL++ L RF + L    +K ND++  YP  L +        NE I   
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSI-EYPPYLRMNDYCQTSSNETIDSP 396

Query: 1005 ----VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
                + Y+L  ++ HTG +  GHY           L N +  W  F+D ++
Sbjct: 397  DDSDIIYELIGVICHTGTVNEGHYICSC------KLANNQ--WVKFNDSMI 439

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 21/107 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKND------AVVSYPLVLNIVLKNE---EI 1004
            K + F S PKVL + L RF YD     L K ND      ++   P +   VLKNE   E 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 1005 VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
              YKL+ ++ HTG++ +GHY +++  D    LG+   +WY FDDE V
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPD----LGD---QWYRFDDERV 485

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 83/227 (36%), Gaps = 55/227 (24%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L       E   KPND+   A+   F  L    
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDE--EKPNDSVPLALQRAFYQL---- 262

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   L++      D      Q D QE    +++RL   +            
Sbjct: 263 ----QVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKG---------- 308

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFY 827
                                 T V   LS    +F G+M++ ++C+   YES     F+
Sbjct: 309 ----------------------TKVEGKLSE---LFVGKMKSYIKCKNVDYESSRVEEFW 343

Query: 828 VLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            + L +         K+ +   E+ I +    E++ GEN +  P  G
Sbjct: 344 DIQLNVKD------LKNLQQSFENYIEV----ELMDGENQYAAPDFG 380

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 15/130 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    LP++L +HL RF Y   +  +      ++YPL L +  K +  V  +Y+L  +
Sbjct: 541  RVVGLKKLPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGV 600

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G     GHY S+   D   N G     W +FDDE V+       ++      +S  
Sbjct: 601  VLHMGGGPQHGHYVSVCKTD---NFG-----WLFFDDETVETLDEPQVLNFTGDTTTSTT 652

Query: 1072 VYVLFYERVD 1081
             YVLFY+  D
Sbjct: 653  AYVLFYKETD 662

 Score = 35.4 bits (80), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKN 674
           + G  N GNTCY N +LQ LF   E +N
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRN 140

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
            (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 124/311 (39%), Gaps = 81/311 (26%)

Query: 732  RIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTV 791
            RI   QQD  E    +L  L +EL                         E  KK+ ++  
Sbjct: 165  RITGGQQDANELTQIVLEVLQNEL-------------------------ESLKKYVNRME 199

Query: 792  VANGLSPVDGVFQGQMENALQCQRCGYESV-NYSTFYVLSLALPKPSAPAFYKSGRVKLE 850
            ++  +      F+G++ + L C  CG  S+ N STF +L +  P+  +         +LE
Sbjct: 200  LSIEVPRFP--FEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQEYSA--------ELE 249

Query: 851  DCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG--LP 908
            + I     D++      + C  C + A+         T     N+   H+  K+    LP
Sbjct: 250  EIIYGNQIDQI----TDYSCLVCQTNAI----LKNEKTNGHKGNTTDEHEIVKYLEDVLP 301

Query: 909  TGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHK--MKSK--KLVTIKTINFI 964
              +                      E+LD    + I+ ++K  MKS   K   IK  + I
Sbjct: 302  VLRI--------------------NEELDSKTLNYIKYYNKYGMKSGNIKSTIIKKNSII 341

Query: 965  SLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNIVL-----KNE----EIVRYKLYSIV 1013
              PK+L+IHLSR  Y+  +  +N   V +   ++I       KNE    E+V Y+L SI+
Sbjct: 342  ETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVDYQLQSII 401

Query: 1014 NHTGNLISGHY 1024
             HTG   SGHY
Sbjct: 402  KHTGTHNSGHY 412

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 119/295 (40%), Gaps = 65/295 (22%)

Query: 802  VFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDC-INMFTSDE 860
            +F G ++  + C+ CG  S     FY LSL L           G+ KL     N+ T+  
Sbjct: 569  IFGGLLKQLVTCKSCGEVSKTEQPFYDLSLHLK----------GKRKLHSSEENVGTTTN 618

Query: 861  VLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPF 920
             L   ++ +  +     V    +S+T++ T    +          GL    +I +S   F
Sbjct: 619  ALADTDSSNAKQTQDNLVANSISSKTTSDTNTSFASQE-------GLTRRFSIEKSIRDF 671

Query: 921  RKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYD 980
                L+        K+DK ++  + E     +K     K    +  P+ L+IHL +F ++
Sbjct: 672  FNPELI--------KVDKEKKGYVCE---KCNKTTNATKRSTILRAPETLLIHLKKFRFN 720

Query: 981  LT--KKNDAVVSYPLVLNIV----LKNEEI--VRYKLYSIVNHTG-NLISGHYTSLVNKD 1031
             T   K    VSYP+ L++        + I  V+Y+L S+V H G +L SGHY +   K 
Sbjct: 721  GTSSSKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQLLSVVVHEGRSLSSGHYIAHC-KQ 779

Query: 1032 PHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK------NVYVLFYERV 1080
            P       +  W  +DDE              I K+S +      N Y L Y R+
Sbjct: 780  P-------DGSWATYDDEY-------------INKISEREMLKEPNAYYLLYTRL 814

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 22/136 (16%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIV--LKNEE 1003
            ++++LV +K      LP  L +HL RF Y   K+N  +     + YPL LN+   + ++ 
Sbjct: 545  EAERLVGLK-----QLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKV 598

Query: 1004 IVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK 1062
              +Y+L  IV H G     GHY SL     H   G     W  FDDE V+A K    ++ 
Sbjct: 599  CQKYELAGIVVHMGGGPQHGHYVSLCK---HEKFG-----WLLFDDETVEAVKEETVLEF 650

Query: 1063 GITKVSSKNVYVLFYE 1078
                 +    YVLFY+
Sbjct: 651  TGESPNMATAYVLFYK 666

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 92/235 (39%), Gaps = 49/235 (20%)

Query: 646 SVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK--ESAISNTFANL 703
            + GL N+G+TC+++ ++Q++          +S K+       +  K    A+     + 
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVSCALDEIACDF 190

Query: 704 FNKMYMNGGCTVVPSGFLKICNFLRPDLRI-----PDDQQDTQEFLLFILNRLHDELSNQ 758
           +      G  + V  GF+   N L     I        QQD  E+  F+LN+LH +    
Sbjct: 191 YGNGPGTGKSSSVSKGFV---NLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTD---- 243

Query: 759 VNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGY 818
                                   + + F  +   +       +FQG ++N LQC +CG+
Sbjct: 244 ------------------------HARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGF 279

Query: 819 ESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
                    ++ L+L   + P        KLEDC++ F  +E LT +  ++C  C
Sbjct: 280 SKTTIDP--IMDLSLEIKNNP--------KLEDCLDHFQREETLT-DFHYECQSC 323

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 80/176 (45%), Gaps = 35/176 (19%)

Query: 919  PFRKLGLLEKHEGKQEK-LDKMERDEI-----EEWHKMKSKKLVTIKTINFISLPKVLII 972
            P   L L  K+  K E  LD  +R+E       E    K  + V +K +     P VL+I
Sbjct: 286  PIMDLSLEIKNNPKLEDCLDHFQREETLTDFHYECQSCKQNQGV-VKQLTLHKAPNVLVI 344

Query: 973  HLSRFYYDL----TKKNDAVVSYPLVLNI-----VLKNEEI--VRYKLYSIVNHTGNLIS 1021
             L RF + L     K ND V  +PL LN+      +++E I  + Y L ++V+H G +  
Sbjct: 345  QLKRFEHQLNGQSAKLNDRV-QFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQGTVDQ 403

Query: 1022 GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFY 1077
            GHYT++   +        + +W+ F+D VV +            +V  +  Y+LFY
Sbjct: 404  GHYTTVSKTE--------DGQWFKFNDSVVTSVTE--------EQVLEQQAYLLFY 443

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 112/255 (43%), Gaps = 37/255 (14%)

Query: 626 LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           ++ + SIPT+ +      A+ + GL N+G+TCY++ +LQ L       +L + G +  Y 
Sbjct: 121 ISNETSIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYC 174

Query: 686 MKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD-----QQDT 740
              +  K   +S    N+ ++ Y N   T    G + I   L    R+  +     QQD 
Sbjct: 175 KIQDPMK--CMSCAIDNIISETYGNKK-TTPNEGLVDI---LNCSWRVNKNLAGYTQQDA 228

Query: 741 QEFLLFILNRLHDELSNQVNVIX-XXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPV 799
            EFL FILN++H++   ++N I             K MV+    K+      + N L   
Sbjct: 229 HEFLQFILNQMHNDY--KLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLH---LCNCLPHT 283

Query: 800 DGVFQGQMENALQCQRCGYESVNYSTFYV-LSLALPKPSAPAFYKSGRVKLEDCINMFTS 858
             +FQG +++ + C  C  +S      Y+ LSL +           G+  L +C+  F  
Sbjct: 284 --IFQGFLKSIISCSECKAQSQTTIDPYMDLSLDV----------KGKSTLYECLESFHR 331

Query: 859 DEVLTGENAWDCPKC 873
            E L  +  ++C KC
Sbjct: 332 TERL-HDFTYNCKKC 345

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 32/116 (27%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLT----KKNDAVVSYPLVLNI----------------- 997
            + ++ + L  +++I L RF + +T    K ND  V +PL LN+                 
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKIND-FVEFPLHLNMKSFCTAPTPDTDPTNLN 411

Query: 998  --VLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
                K+   + Y+L  IV H G +  GHY +             +  WY F+D VV
Sbjct: 412  EKTNKSTPDMIYELTGIVTHRGTVNEGHYITYTK--------TADGVWYQFNDSVV 459

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 160/395 (40%), Gaps = 117/395 (29%)

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q+D +EFL  +L++LH+EL                                        +
Sbjct: 580  QEDAEEFLTHLLDQLHEEL----------------------------------------I 599

Query: 797  SPVDGVFQGQMENALQCQRCGYESVN---YSTFYVLSLALPKPSAPAFYKSGRVKLEDCI 853
            S +DG+   +++N LQ       S+N      F++ +L+  +     F K+   +L++ I
Sbjct: 600  SAIDGLTDNEIQNMLQ-------SINDEQLKIFFIRNLS--RYGKAEFIKNASPRLKELI 650

Query: 854  NMF-TSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG------ 906
              +   ++  T EN W      SK  +   T+   T  I+P SP     SK FG      
Sbjct: 651  EKYGVINDDSTEENGWHEVSGSSKRGKKTKTAAKRTVEIVP-SP----ISKLFGGQFRSV 705

Query: 907  --LPTGK-AISRSKSPFRKLGLLEKHEGKQEKLDKMER--DEIEEWH----KMKSKKLVT 957
              +P  K + S +  PF+ + L    +     ++ +E    +  E+     K  S   V 
Sbjct: 706  LDIPNNKESQSITLDPFQTIQL----DISDSSVNDLETAFKKFSEYELLPFKSSSGNDVE 761

Query: 958  IKTINFI-SLPKVLIIHLSRF-YYDLTKKNDAVVSY------------------PLVL-- 995
             K   FI  LP+VL+I L RF + +   K++A+ +Y                   L++  
Sbjct: 762  AKKQTFIDKLPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPE 821

Query: 996  ----NIVLKNE----EIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYF 1046
                +I LKN     +  RYKL  ++ H G +   GHYT+ V    H+       KWY  
Sbjct: 822  ESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADVYHKEHN-------KWYRI 874

Query: 1047 DDEVVKAEKTHGNVDKGITKVS-SKNVYVLFYERV 1080
            DD V   E    +V KG  + S S+  Y+L Y++V
Sbjct: 875  DD-VNITELEDDDVLKGGEEASDSRTAYILMYQKV 908

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 101/467 (21%), Positives = 169/467 (36%), Gaps = 130/467 (27%)

Query: 649  GLRNLGNTCYINCMLQSLFATNELKNLFI-----SGKYREYQMKPNDNKESAISNTFANL 703
            GL N G TCY N  +Q++     +++        +  Y    +KPN     ++S   +  
Sbjct: 304  GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRNNKDYITDIIKPN-----SVSYILSQT 358

Query: 704  FNKMYMNGGCTVVPSGFLKICNFLRPDLRIPD-----------DQQDTQEFLLFILNRLH 752
              KM+         +      N++ P   I              Q+D+ E+ + +++RL 
Sbjct: 359  SKKMWWKDSKKTSKTS----ANYIDPKKLIAALEQINCMMSEWQQEDSHEYFMSLMSRLQ 414

Query: 753  DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
            ++                    K M +                 S +  +F G ++  + 
Sbjct: 415  ED---------------SVPKGKKMTE-----------------SIIYDIFGGLLKQEVT 442

Query: 813  CQRCGYESVNYSTFYVLSLAL----------PKPSAPAFYKSGRVKLEDCINMFTSDEVL 862
            C+ CG  S     FY LSL L             SA   Y +G        N    +E  
Sbjct: 443  CKSCGEISKTEQPFYDLSLHLKGKHNRHQTNSTDSATTNYPAG--------NSNKIEESS 494

Query: 863  TGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRK 922
            T E A D     +  + P             N       S+F       +I +S   F  
Sbjct: 495  TKEGAADSVNNANNQLNPE------------NGIQDASTSRF-------SIEKSIGDFFN 535

Query: 923  LGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLV-TIKTINFISLPKVLIIHLSRFYYD- 980
              L+        K+DK ++  + E    K KK    +K    +  P+ L++HL +F ++ 
Sbjct: 536  PELI--------KMDKEKKGYVCE----KCKKTTNAVKRNTILRAPETLLVHLKKFRFNG 583

Query: 981  -LTKKNDAVVSYPLVLNIV-----LKNEEIVRYKLYSIVNHTG-NLISGHYTSLVNKDPH 1033
              + K    VSYP+ L++       K++ +V Y+L S+V H G +L SGHY +   K P 
Sbjct: 584  QSSSKMKQAVSYPMFLDLTSYCDKTKSKLLVMYQLISVVVHEGRSLSSGHYIAHC-KQP- 641

Query: 1034 HNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                  +  W  +DDE       + N+      +   N Y L Y R+
Sbjct: 642  ------DGTWATYDDE-------YTNIISERNVLKEPNAYYLVYTRL 675

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 71/154 (46%), Gaps = 36/154 (23%)

Query: 942  DEIEEWHKMKSKKLV-TIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIV 998
            D  E +   K KK+   +K+   I  P+ L++HL +F ++ T   K    VSYP+ L++ 
Sbjct: 566  DNKEGYTCEKCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLT 625

Query: 999  -LKNEEI----VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVK 1052
               +E I    VRY+L S+V H G +L SGHY +   K P       +  W  +DDE   
Sbjct: 626  EYCHESISSLPVRYQLISVVVHEGRSLSSGHYIAHC-KQP-------DGSWATYDDEY-- 675

Query: 1053 AEKTHGNVDKGITKVSSK------NVYVLFYERV 1080
                       I K+S K      N Y L Y R+
Sbjct: 676  -----------INKISEKQLLKEPNAYFLVYTRL 698

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 153/389 (39%), Gaps = 107/389 (27%)

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q+D +EFL  +L++LH+EL                                        +
Sbjct: 583  QEDAEEFLTHLLDQLHEEL----------------------------------------I 602

Query: 797  SPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLA-LPKPSAPAFYKSGRVKLEDCINM 855
            S +DG+   +++N LQ       S+N     V  +  L +     F K+   +L++ I  
Sbjct: 603  SAIDGLTDNEIQNMLQ-------SINDEQLKVFFIRNLSRYGKAEFIKNASPRLKELIEK 655

Query: 856  F-TSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG-------- 906
            +   ++  T EN W      SK  +   T+   T  I+P SP     SK FG        
Sbjct: 656  YGVINDDSTEENGWHEVSGSSKRGKKTKTAAKRTVEIVP-SP----ISKLFGGQFRSVLD 710

Query: 907  LPTGK-AISRSKSPFRKLGLLEKHEGKQE---KLDKMERDEIEEWHKMKSKKLVTIKTIN 962
            +P  K + S +  PF+ + L     G  +      K    E+  + K  S   V  K   
Sbjct: 711  IPNNKESQSITLDPFQTIQLDISDAGVNDLETAFKKFSEYELLPF-KSSSGNDVEAKKQT 769

Query: 963  FI-SLPKVLIIHLSRF-YYDLTKKNDAVVSY------------------PLVL------N 996
            FI  LP+VL+I   RF + +   K++A+ +Y                   L++      +
Sbjct: 770  FIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSS 829

Query: 997  IVLKNE----EIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            I LKN     +  RYKL  ++ H G +   GHYT+ V    H+       KWY  DD V 
Sbjct: 830  ITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADVYHSEHN-------KWYRIDD-VN 881

Query: 1052 KAEKTHGNVDKGITKVS-SKNVYVLFYER 1079
              E    +V KG  + S S+  Y+L Y++
Sbjct: 882  ITELEDDDVLKGGEEASDSRTAYILMYQK 910

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 116/487 (23%), Positives = 188/487 (38%), Gaps = 130/487 (26%)

Query: 648  TGLRNLGNTCYINCMLQSLFATNELK---NLFISG----KYREYQMKPNDNKESAISNTF 700
            TGL N GN CY N ++Q+L + +      N F+ G    +     ++  D +   +    
Sbjct: 72   TGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGIDENEISSAGLEKTDTEALLLHRAL 131

Query: 701  ANLFNKMYMNGGCTVVPSG-----FLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDEL 755
            A+L  K+ M       P+       + +  + +   R+   Q D  EFL  +L +LH EL
Sbjct: 132  ADLLRKLQM---VIFEPTNADIKHLVSVLEW-KVSGRLSRAQNDAHEFLQVLLEQLHVEL 187

Query: 756  SNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
            SN                                   ++  S     F G +  + +C +
Sbjct: 188  SN-----------------------------------SHKTSSCKFPFAGTIIESYKCLQ 212

Query: 816  CGYESV-NYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            C +E+    STF +    LP+           + L D + M  S+E++   + + C  C 
Sbjct: 213  CQHETAPKKSTFNIFEAPLPQKY--------EIDLNDVL-MRNSNEII---DDYKCMVCL 260

Query: 875  SKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHE---G 931
             ++V            I     H      F G  T ++I        KL  LEK      
Sbjct: 261  IRSV------------ITLERAH-----GFSG--TAESIKG------KLLALEKKLPDIT 295

Query: 932  KQEKLDKMERDEIEEWHKMKSKKLVTIKTI----NFISLPKVLIIHLSRFYYD---LTKK 984
              E+ D   ++ ++ + K   K  V  ++I     F++ P + +IHLSR  Y+    T+ 
Sbjct: 296  INEEFDIELQNYLDTYCKYGFKNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRN 355

Query: 985  N------DAVVSYPLVLNIVLKNE--EIVRYKLYSIVNHTGNLISGHYTSLVNK------ 1030
                   + + ++  V      NE  + VRY+L SIV HTG+  SGHY  L  K      
Sbjct: 356  GCKVHFGETLDAFETVACSTSSNEFTKRVRYRLKSIVIHTGSHYSGHYQVLRRKPIIMKS 415

Query: 1031 ---DPHHNLGNT--EQKWYYFDDEVVKAEKT---------HGNV-DKGITKV--SSKNVY 1073
                   N G T  E+K    D    + + T           NV +K I+ +    K+VY
Sbjct: 416  KVSGDIVNTGTTIGEKKPTVMDSNFRRMKSTTIYPFWLISDTNVKEKRISDIVNEQKSVY 475

Query: 1074 VLFYERV 1080
            +LFYER+
Sbjct: 476  MLFYERI 482

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNI--------VLKNEEIV 1005
            K + F S P +L + L RF YD     L K ND    +P  +++        + +N+E  
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRY-EFPESIDVSPYMDKKALRENKESC 442

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            +Y L+ ++ HTG++ +GHY +++  D        + +WY FDDE V
Sbjct: 443  KYTLHGVLVHTGDISTGHYYAMIKPD-------LQDQWYRFDDEKV 481

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 83/241 (34%), Gaps = 73/241 (30%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM-----KPNDNKESAISNTFAN 702
            G RN G TCY+N +LQS F T   + L        YQ+      PND+   A+   F  
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YQIPTENESPNDSVPLALQRAFYQ 259

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
           L          + +P   L++      D      Q D QE    +++RL + +       
Sbjct: 260 L--------QVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKG----- 306

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGY 818
                                             +PV+G    +F G+M++ ++C    Y
Sbjct: 307 ----------------------------------TPVEGKLNELFVGKMKSYIKCINVDY 332

Query: 819 ESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAV 878
           ES     F+ L L +               LE+    +   E++ GEN +     G +  
Sbjct: 333 ESSRVEDFWDLQLNVKNLKG----------LEESFKNYIEIELMNGENQYAAQDFGLQDA 382

Query: 879 E 879
           E
Sbjct: 383 E 383

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 15/130 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            +T+    LPK+L +HL RF Y    +++      + YPL L +  K++ IV   Y+L  I
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGI 642

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G     GHY ++     H   G     W  +DDE V++            +     
Sbjct: 643  VIHMGGGPQHGHYVAICK---HDMFG-----WLLYDDETVESIDEETVFKFVGDEKDMTT 694

Query: 1072 VYVLFYERVD 1081
             YVLF++ VD
Sbjct: 695  AYVLFFKEVD 704

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 14/84 (16%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYRE-----------YQMKPNDNKESA 695
           V GL N GNTCY N +LQ LF  +EL+   +    R+             +KP    E+ 
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELRTNILMYPIRKDPASRKPKLDVVGLKPRVFTEAG 191

Query: 696 ISNTFANLFNKMYMNGGCTVVPSG 719
           ++ + +  F+K   NG  TV  +G
Sbjct: 192 LACSHSPCFSK---NGNSTVTDAG 212

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 72/185 (38%), Gaps = 44/185 (23%)

Query: 697 SNTFANLFNKMYMNGGCTVVPSGFL------KICNFLRPDLRIPDD--QQDTQEFLLFIL 748
           SNT  NL++ +     C V     L      ++ N LR +  + D    QD  EF  F++
Sbjct: 427 SNTEPNLYSSLKDVFECIVESRSMLGVVSPVQLVNVLRKENILFDSTMHQDAHEFFNFLM 486

Query: 749 NRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQME 808
           N L + +  Q+                            ++T      + V  +FQG M 
Sbjct: 487 NSLGEFIQRQL----------------------------EQTQTEIPENFVQSLFQGTMI 518

Query: 809 NALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAW 868
           N+++C  C  ++V  S    L  A+P        +   V ++D ++ F   E+L G N +
Sbjct: 519 NSIKCLTC--DNVTSSDELFLDFAIP------VNEDEEVNIQDMLSNFNQREMLNGANKF 570

Query: 869 DCPKC 873
            C  C
Sbjct: 571 YCDSC 575

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 90/390 (23%), Positives = 147/390 (37%), Gaps = 85/390 (21%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNK 706
           + GL N GNTC++N +LQSL ++ EL   F+            D K +        + NK
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELA-AFLDNVIENGSENNGDIKFTETLRELLLILNK 115

Query: 707 MYMNGGCTVVPSGFLK-ICNFLRPDLRIPDDQQDTQEFLLFILNRL-------------- 751
            Y         +  LK + N    ++ +  DQ+D QEF   IL+ L              
Sbjct: 116 KYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKEE 175

Query: 752 ----------------HDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANG 795
                            D+L+N V  +                D++ Y  +         
Sbjct: 176 RNNIKESDLPDDALLGQDDLNN-VGTVYIPTEQIEPNSVLENPDQKLYSPF-------KL 227

Query: 796 LSPVDGVFQGQMENALQCQRCGYE-SVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCIN 854
           ++P+DG+   +    + C  CG    + YS F  LSL LP  S         +KL + +N
Sbjct: 228 ITPLDGITAER----IGCLTCGENGGIRYSVFSGLSLNLPSES----LNQSTLKLSELLN 279

Query: 855 MFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAIS 914
            +   E++ G    +C +C   AV      +    TI                P    I+
Sbjct: 280 EWVKPEIIEG---VECNRCSLNAVRSHLQDQIQNDTI----------------PEKLKIA 320

Query: 915 RSKSPFRKLGLLEKHEGKQEKLDK--MERDEIEEWH-KMKSKKLVTIKTINFISLPKVLI 971
            ++    +L LL       E L K  +E D+ +++H +   +K    K I     P  L 
Sbjct: 321 INQ----RLNLL------TEILSKPVIEEDDYKKYHTENMVRKCSKSKQILISRPPPFLS 370

Query: 972 IHLSRFYYD----LTKKNDAVVSYPLVLNI 997
           IH++R  +D    + +KN+A V +   LN+
Sbjct: 371 IHINRSVFDPRTYMIRKNNARVLFKTRLNL 400

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKND----AVVSYPLVL--NIVLKNEEIVRYKLYSI 1012
            + +    LP  LI+HL RF Y   + ++    + V YPL+L  N   K  + ++Y+L  I
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY +L   + +         W ++DDE V++      +     + +   
Sbjct: 571  VIHVGDGPQMGHYVALCKTEKY--------GWLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1072 VYVLFYERV 1080
             YVLFY+++
Sbjct: 623  AYVLFYKKL 631

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 73/189 (38%), Gaps = 50/189 (26%)

Query: 698 NTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD--QQDTQEFLLFILNRLHDEL 755
           NT  +LF  +  +   T + S  ++  N LR +  + D    QD  EFL F+LN   D L
Sbjct: 369 NTLKDLFECITEHSSLTGIVSP-VQFVNMLRRENVLFDSMMHQDAHEFLNFMLNDFSDRL 427

Query: 756 SNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
                                  D++   K F           ++ +FQG + N ++C  
Sbjct: 428 -----------------------DRDNQAKNF-----------INEIFQGTLTNKVRCLT 453

Query: 816 CGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC-- 873
           C   +     F  L + + +        +G   ++  +  ++  E+L G N ++C +C  
Sbjct: 454 CDNVTSREEAFLDLPIEVKE--------NGDTDIQRVLKYYSQREMLNGSNKFNCSQCCA 505

Query: 874 ---GSKAVE 879
                +AVE
Sbjct: 506 LQEAERAVE 514

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDAV----VSYPLVLNIVLK-NEEIVR-YKLYSI 1012
            + +    LPK L +HL RF Y   + ++      VSYPL L +    N  I + Y+L  I
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGI 618

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G     GHY SL          N +  W  FDDE V+A      +     K +   
Sbjct: 619  VVHMGGGPQHGHYISLCK--------NEKFGWLLFDDETVEAISEQAVLQYTGDKDTMTT 670

Query: 1072 VYVLFYE 1078
             YVLFY+
Sbjct: 671  AYVLFYQ 677

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 89/223 (39%), Gaps = 38/223 (17%)

Query: 660 NCMLQSLFATNEL--KNLFISGKYREYQMKPNDNKESAISNTFANLFNKM----YMNGGC 713
           N  L+S   TNE   K+  I+G       + + + ES + N   ++F  +    Y+ G  
Sbjct: 358 NIHLKSEHLTNEQRKKSALINGPIVNVDHQIDSSAESNLYNGLKDIFECITEHSYLTG-- 415

Query: 714 TVVPSGFLKIC---NFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXX 770
            V PS F+++    N L   +      QD  EFL+F+LN + D L  Q            
Sbjct: 416 VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLLNEISDFLDKQ------------ 459

Query: 771 XXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLS 830
               K  ++ + Y     +       + V  +FQG + N ++C  C   +     F    
Sbjct: 460 ---NKNALNSKIYDSSQGRRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDEPFLDFP 516

Query: 831 LALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           + +         ++  + +++ +  F   E+L G N + C +C
Sbjct: 517 IEV--------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 19/84 (22%)

Query: 613 LPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYS--VTGLRNLGNTCYINCMLQSLFATN 670
           LP   LH+P   T   + +         PY   S  + G  N GNTCY N +LQ L+   
Sbjct: 122 LPSEHLHNPILNTERTELT---------PYGDGSNKIFGYENFGNTCYCNSVLQCLYNLP 172

Query: 671 ELKNLFI--------SGKYREYQM 686
           E +N  +        SGK R+ +M
Sbjct: 173 EFRNDMLRYPLGQPKSGKSRKLEM 196

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV-LKNEEIVR------ 1006
            K + F S P+VL + L RF YD     L K ND    +P  +++    ++E+++      
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRF-EFPETIDLSPYMDKEVLKKQKGPN 494

Query: 1007 -YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ HTG++ +GHY +++          T+ KWY FDDE V
Sbjct: 495  NYNLHGVLVHTGDISTGHYYAMIKP-------TTDDKWYRFDDEKV 533

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 79/232 (34%), Gaps = 65/232 (28%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM-----KPNDNKESAISNTFAN 702
            G RN G TCY+N +LQS F T   ++L        YQ+      PND+   A+   F  
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV-------YQIPTADENPNDSVALALQRAFYQ 311

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
           L    Y        P   L++      D      Q D QE    +++RL   +       
Sbjct: 312 LQVSNY--------PLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKG----- 358

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                                      T V   L+    VF G+M++ ++C    YES  
Sbjct: 359 ---------------------------TSVEGKLT---DVFVGKMKSYIKCVNIDYESSR 388

Query: 823 YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
              F+ + L +           G   L +    +   E++ GEN +     G
Sbjct: 389 VEDFWDIQLNV----------KGLEGLANAFENYIEVELMDGENQYAAQDYG 430

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 98/460 (21%), Positives = 178/460 (38%), Gaps = 133/460 (28%)

Query: 649  GLRNLGNTCYINCMLQSLFATNELKN-LF--ISGKYREYQMKPNDNKESAISNTFANLFN 705
            GL N G TCY N  +Q++     +++ LF  + G ++      N  K  +++   A    
Sbjct: 312  GLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLRGSHK------NTIKADSVTQVLAETSK 365

Query: 706  KMYM-----NGGCTVVPSGF---LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSN 757
            KM+      N    + P      L   N +  + +    Q+D+ E+ + +++RL +    
Sbjct: 366  KMWWRDKKHNKSTYINPKKLISRLDDINCMMSEWQ----QEDSHEYFMSLMSRLQE---- 417

Query: 758  QVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG 817
                                 D     +   +++V +       VF G ++  + C+ CG
Sbjct: 418  ---------------------DSVPKGRKMTESIVYD-------VFGGMLKQIVTCKSCG 449

Query: 818  YESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKA 877
              S      Y LSL L           G+ K           + + G+++          
Sbjct: 450  SVSKTEQPIYDLSLHL----------KGKRK-----------QTIDGDSSVPPSPIQQNQ 488

Query: 878  VEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHEGKQEKLD 937
               +FT++    T   N    ++K+KF        I ++   F    L+        K+D
Sbjct: 489  NNGKFTNQNQGPTHSGN--EENEKNKF-------TIEKAIRDFFNPELI--------KVD 531

Query: 938  KMERDEI-EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYD--LTKKNDAVVSYPLV 994
            K +   + E+ HK  +     IK  + +  P+ L++HL +F ++   + K    V+YP+ 
Sbjct: 532  KEKGGYVCEKCHKTTN----AIKCNSILRAPETLLVHLKKFRFNGQSSSKMKQAVAYPMF 587

Query: 995  LNIVL------KNEEI-VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYF 1046
            L++        K E++ V+Y+L S+V H G +L SGHY +   +         +  W  +
Sbjct: 588  LDLTEYCEDPEKGEKLPVKYQLISVVVHEGRSLSSGHYIAHCRQ--------PDGSWAIY 639

Query: 1047 DDEVVKAEKTHGNVDKGITKVSSKNV------YVLFYERV 1080
            DDE              I K+S +NV      Y L Y R+
Sbjct: 640  DDEY-------------INKISERNVLKEPNAYYLIYTRL 666

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 97/435 (22%), Positives = 165/435 (37%), Gaps = 136/435 (31%)

Query: 635  IEKNSNPYVA-YSVTGLRNLGNTCYINCMLQSLFATNELKN-LF--ISGKYREYQMKPND 690
            I KN  P ++     GL N G TCY N  +Q++     +++ LF  + G ++   + P  
Sbjct: 348  IVKNWGPQLSQLKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHK-TTISPQ- 405

Query: 691  NKESAISNTFANLFNKMYM---NGGCTVVPS---GFLKICNFLRPDLRIPDDQQDTQEFL 744
                +++   A    +M+    N    + P    G L   N +  + +    Q+D+ E+ 
Sbjct: 406  ----SVTQVLAETSKRMWSPEPNKNTYINPKKLIGRLDDINCMMSEWQ----QEDSHEYF 457

Query: 745  LFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQ 804
            + +++RL +                         D         ++++ +       +F 
Sbjct: 458  MSLMSRLQE-------------------------DSVPRGHKLTESIIYD-------IFG 485

Query: 805  GQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTG 864
            G +   + C+ CG  S     FY LSL L           G+ K         SDE +  
Sbjct: 486  GLLHQKVTCKSCGGVSKTEQPFYDLSLHL----------KGKKK---------SDETVP- 525

Query: 865  ENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLG 924
            EN  D P       + R+                             +I +S S F    
Sbjct: 526  ENQEDVP-------QRRY-----------------------------SIEKSISDFFNPE 549

Query: 925  LLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK- 983
            L+        K+DK +    E+ HK  +     IK  + +  P+ L+IHL +F ++ T  
Sbjct: 550  LI--------KVDKKDGYVCEKCHKTTN----AIKRNSILRAPETLLIHLKKFRFNGTSS 597

Query: 984  -KNDAVVSYPLVLNIVLKNEE-----IVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNL 1036
             K    VSYP+ L++    E+      V+Y+L S+V H G +L SGHY +   K P    
Sbjct: 598  SKMKQAVSYPMFLDMSEYCEDQQKTLPVKYQLISVVVHEGRSLSSGHYIAHC-KQP---- 652

Query: 1037 GNTEQKWYYFDDEVV 1051
               +  W  +DDE +
Sbjct: 653  ---DGSWATYDDEYI 664

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (45%), Gaps = 19/127 (14%)

Query: 959  KTINFISLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNI--VLKNEEIVRYKLYSIVN 1014
            KT+ F  LPK L +HL RF  D  +  K    + YPL L +     N     Y+L  +V 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 1015 HTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA---EKTHGNVDKGITKVSSK 1070
            H G +   GHY S+     H   G     W  +DDE +++   E    +V +    +++ 
Sbjct: 591  HVGASPTHGHYVSICK---HEKYG-----WLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 1071 NVYVLFY 1077
              YVLFY
Sbjct: 642  --YVLFY 646

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 64/179 (35%), Gaps = 32/179 (17%)

Query: 695 AISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDE 754
           A+ +    +    Y++G   V P+ F+K+     P L     QQD  EFL F+LN + D 
Sbjct: 377 ALKDIMECITENRYLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLNFLLNNISDF 433

Query: 755 LSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQ 814
                                    K  Y K  ++         V   F+G + N ++C 
Sbjct: 434 AGKY---------------------KSNYLKSSNEEECEISHDFVKDQFEGVLLNRIKCL 472

Query: 815 RCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
            C   S N   F    + +    A        + ++D    F   E+L G N + C +C
Sbjct: 473 TCDCVSANEEPFLDFPIEIQNDEA--------INIQDTFRSFYQREILCGPNKFYCNEC 523

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 68/162 (41%), Gaps = 41/162 (25%)

Query: 954  KLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIVLKNE------EIV 1005
            K   I+     + P +L +HLSR  ++     +N   V YP  L IVL+ +      E +
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERI 373

Query: 1006 RYKLYSIVNHTGNLISGHYTS---------------LVNKDP-----------HHNLGNT 1039
             Y+L S++ HTG   SGHY                  VN+ P                 +
Sbjct: 374  TYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKS 433

Query: 1040 EQKW-YYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             ++W Y+F  + V  E   G + +      SK VY+LFYERV
Sbjct: 434  VRRWPYWFISDAVVRESNAGKMLR-----ESKYVYMLFYERV 470

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 23/132 (17%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIVLKNEEI-----VRYKL 1009
             IK    +  P+ L++HL +F ++ T   K    VSYPL +++     E      V+Y+L
Sbjct: 581  AIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQL 640

Query: 1010 YSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVS 1068
             S+V H G +L SGHY +   K P       +  W  +DDE +  + T  NV K +    
Sbjct: 641  ISVVVHEGRSLSSGHYIAHC-KQP-------DGTWATYDDEYIN-KITERNVLKEV---- 687

Query: 1069 SKNVYVLFYERV 1080
              N Y L Y R+
Sbjct: 688  --NAYYLVYTRL 697

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    LP  L +HL RF Y   +  +      V YPL L++    +  +  +Y+L  +
Sbjct: 534  RIVGLKQLPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGV 593

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G     GHY SL   D     G     W  FDDE V++      ++      +   
Sbjct: 594  VIHMGGSPQHGHYVSLCKND---KFG-----WLLFDDETVESVTEKTVLEFTGDSSNQAT 645

Query: 1072 VYVLFYERVD 1081
             YVLFY+ +D
Sbjct: 646  AYVLFYKELD 655

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELK 673
           V G  N GNTCY N +LQ L+   EL+
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIVR--YKLYSI 1012
            + +    LP +L +HL RF Y   K  +      V YPL LN+    +  +   Y+L  +
Sbjct: 638  RIVGLKQLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGV 697

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY SL   D     G     W  FDDE V++      ++      +   
Sbjct: 698  VIHMGSSPQHGHYVSLCKND---KFG-----WLLFDDETVESVSESTVLEFTGDPNNQAT 749

Query: 1072 VYVLFYERV 1080
             YVLFY+ +
Sbjct: 750  AYVLFYKEI 758

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 65/183 (35%), Gaps = 53/183 (28%)

Query: 694 SAISNTFANLFNKMYMNGGCTVVPSGFLKIC---NFLRPDLRIPDDQQDTQEFLLFILNR 750
           +++ + F ++    Y+ G   V P+ F+KI    N L   +     QQD+ EFL F+LN 
Sbjct: 498 NSLKDIFESITENRYLTG--IVAPTEFVKILKKENVLFNSMM----QQDSHEFLNFLLNE 551

Query: 751 LHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENA 810
           L D L +  N                                      +  +FQG + N 
Sbjct: 552 LRDYLPSTTNNF------------------------------------ITNLFQGILTNQ 575

Query: 811 LQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDC 870
           ++C  C   +     F    + +               +E  +  + + E+L G N + C
Sbjct: 576 IKCLTCDNITSRDEPFLDFPIGVKDDE--------ETNIETLLRNYHTREMLNGSNKFYC 627

Query: 871 PKC 873
            +C
Sbjct: 628 NQC 630

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 99/432 (22%), Positives = 164/432 (37%), Gaps = 97/432 (22%)

Query: 647  VTGLRNLGNTCYINCMLQSLFA-----------------TNELKNLFI----SGKYREYQ 685
             TGL N  N C+ N  +Q+L +                 T +   L +    +  + ++ 
Sbjct: 83   TTGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRSTRQALGLLVPRDDAADFSDHG 142

Query: 686  MKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLR--------IPDDQ 737
              P+    S  ++  A   N    NG     P G     + L PDLR        I + Q
Sbjct: 143  GMPSKKSASPFTDPAAVSANCAAANGK---EPEGNHVTPDLLLPDLRMHEALSIMIHNLQ 199

Query: 738  QDTQEF-------LLFILNRLHD-ELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDK 789
            Q  + +       LL  L ++H+ ++S+  N              K   ++   K + +K
Sbjct: 200  QPVKNYTQTSLQPLLHTLEQIHNAKISSGQNDAHEFSQILFETLEK---ERLALKTFLEK 256

Query: 790  TVVANGLSPVDGVFQGQMENALQCQRCGYES-VNYSTFYVLSLALPKPSAPAFYKSGRVK 848
              +++   P +  FQG +   L C RC   S VN   F + SL +P+ S+          
Sbjct: 257  QQLSDIRIP-EFPFQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQMSS--------AS 307

Query: 849  LEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLP 908
            L+D   M   ++  T E  + C  C  +A+      R            +H  S+     
Sbjct: 308  LKD---MMFDNQTETIE-GYSCISCRLRAILNNERQR-----------DYHNVSQ----- 347

Query: 909  TGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHK----MKSKKLVTIKTINFI 964
                    ++    L  L       + L +     ++ +HK    + S K   +K    +
Sbjct: 348  ------EERAKLDDLAKLLPRICINDDLPEPLELYVKSYHKDGCHIPSLKSRILKRTVVV 401

Query: 965  SLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIVLKNEEI----------VRYKLYSI 1012
            S PKVL++HLSR  +D     KN   V +P   +++L  +EI          VRYKL ++
Sbjct: 402  SSPKVLLLHLSRSVFDGVTYTKNSCNVLFPE--DLILNEQEIKEDRCIAVHCVRYKLQAM 459

Query: 1013 VNHTGNLISGHY 1024
            + HTG    GHY
Sbjct: 460  IKHTGTHFQGHY 471

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 78/157 (49%), Gaps = 30/157 (19%)

Query: 935  KLDKMERDEI-EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSY 991
            K+DK ++  + E+ HK  +     +K    +  P+ L++HL +F ++ T   K    VSY
Sbjct: 595  KVDKEQKGYVCEKCHKTTN----AVKRNTILRAPETLLVHLKKFRFNGTSSSKMKQAVSY 650

Query: 992  PLVLNIVL-----KNEEI--VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKW 1043
            P+ L++        N++I  V+Y+L S+V H G +L SGHY +   K P       +  W
Sbjct: 651  PMFLDLTEYCDNEGNKKILPVKYQLISVVVHEGRSLSSGHYVAHC-KQP-------DGLW 702

Query: 1044 YYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
              +DDE +     +   DK + + +  N Y L Y R+
Sbjct: 703  ATYDDEYI-----NKISDKEVLRET--NAYYLVYSRL 732

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 79/201 (39%), Gaps = 61/201 (30%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKN-LF--ISGKYREYQMKPNDNKESAISNTFANLFN 705
           GL N G TCY N  +Q++     +++ LF  + GKY +  + P+     ++S   A    
Sbjct: 369 GLLNHGVTCYTNAAVQAMLHIPAVQHYLFDILRGKYNDI-ISPD-----SVSTVLAETSK 422

Query: 706 KMYMNGGCTVVPSGFLKICN--FLRPDLRIP--DD---------QQDTQEFLLFILNRLH 752
           KM++       P+  LK  N  F+ P   I   DD         Q+D+ E+ + +++RL 
Sbjct: 423 KMWL-------PNNQLKEKNVTFINPKKLISRLDDINCMMSEWQQEDSHEYFMSLMSRLQ 475

Query: 753 DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
           ++                           K KK  +  +          +F G ++  + 
Sbjct: 476 ED------------------------SVPKGKKLIESVIY--------DIFGGLLKQIVT 503

Query: 813 CQRCGYESVNYSTFYVLSLAL 833
           C+ CG  S      Y LSL L
Sbjct: 504 CKSCGGISKTEQPIYDLSLHL 524

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 22/117 (18%)

Query: 638 NSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAI- 696
           +SNP       GL+N+GNTCY+N  LQ+LF  + +++L ++  Y   +  P D     I 
Sbjct: 103 DSNP------IGLQNMGNTCYMNATLQALFRVDSIRDLILN--YDPAKASPQDEMHHKIV 154

Query: 697 ---SNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFL 744
                 F NL NK Y     +V+P   L +     P     D       QQD +E  
Sbjct: 155 LEMKRCFENLENKSYK----SVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELF 207

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  I+ H G N  SGHY + +  +   N      KWY F+D+   VV+ EK       
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDEN------KWYKFNDDKVSVVEKEKIEALAGG 477

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 478  G----ESDSALILMYK 489

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV-LKNEEIVR------ 1006
            K + F S P VL + L RF YD     L K ND    +P  +++    ++E+++      
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRY-EFPDKIDLAPYMDKELLKKTPGPK 439

Query: 1007 -YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             YKL+ ++ HTG++ +GHY +++           E +WY FDDE V
Sbjct: 440  NYKLHGVLVHTGDISTGHYYAMIKP-------TLEDQWYRFDDEKV 478

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 84/231 (36%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLF----ISGKYREYQMKPNDNKESAISNTFANL 703
            G RN G TCY+N +LQS F T   + L      +G+       PND+   A+   F  L
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGE------NPNDSVPLALQRAFYQL 257

Query: 704 FNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIX 763
                     +  P   L++      D      Q D QE    +++RL + +        
Sbjct: 258 --------QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKG------ 303

Query: 764 XXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNY 823
                                         N    ++ +F G+M++ ++C+   YES   
Sbjct: 304 -----------------------------TNVEGKLNEIFVGKMKSYIRCKNVDYESSRV 334

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ + L +        +KS +   E+ I +    E++ GEN +  P  G
Sbjct: 335 EDFWDIQLNVKN------FKSLQESFENYIEV----ELMNGENQYAAPDFG 375

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV--LKNEEIVR----- 1006
            K + F S P VL + L RF YD     L K ND    +P  +++   + +E + +     
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRY-EFPDSIDLAPYMDSEALEQNPGPK 438

Query: 1007 -YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             YKL+ ++ HTG++ +GHY +L+         +T+ +WY FDD+ V
Sbjct: 439  IYKLHGVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRV 477

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 81/232 (34%), Gaps = 65/232 (28%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM-----KPNDNKESAISNTFAN 702
            G RN G TCY+N +LQS + T   + L        YQ+      PND+   A+   F  
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLV-------YQIPTEGENPNDSVTLALQRAFYQ 255

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
           L          +  P   +++      D      Q D QE    +++RL   +       
Sbjct: 256 L--------QVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRM------- 300

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                                     K     G   ++ +F G+M++ ++C    Y+SV 
Sbjct: 301 --------------------------KGTSVEG--KINELFVGKMKSYIRCINVDYQSVR 332

Query: 823 YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
              F+ + L +         K+ R  L+     +   E++ GEN +     G
Sbjct: 333 TEDFWDIQLNV---------KNMR-DLQTSFENYIEVELMDGENQYAAQGHG 374

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 62/141 (43%), Gaps = 30/141 (21%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNI--VLKNEEI 1004
            ++++LV +K      LPK L +HL RF Y   K  +      + YP  L +     ++  
Sbjct: 502  EAERLVGLK-----RLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLS 556

Query: 1005 VRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDK- 1062
             RY+L S V H G+    GHY SL   +           W  FDDE V+A      VD+ 
Sbjct: 557  KRYELASAVIHLGDGPQYGHYISLCKTETF--------GWLLFDDETVEA------VDEQ 602

Query: 1063 ---GITKVSSKNVYVLFYERV 1080
                 T  +S   YVLFY  V
Sbjct: 603  TVLSFTGENSDTAYVLFYNEV 623

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 8/131 (6%)

Query: 628 RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687
           R+F     E     +++ +  GL+NLGNTCY+N  LQ+L+    L++  ++  Y+  + K
Sbjct: 40  RRFIEDLDEGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLN--YKVPREK 97

Query: 688 PNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD------QQDTQ 741
           P++ +   + +     F ++      +V P   L +     P     D       QQD +
Sbjct: 98  PSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAE 157

Query: 742 EFLLFILNRLH 752
           E    I N L 
Sbjct: 158 ELFTQIFNSLR 168

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 14/75 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY S +  +   N      KWY F+D+   +++ EK       
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDEN------KWYRFNDDKVSIIEKEKIESLAGG 433

Query: 1063 GITKVSSKNVYVLFY 1077
            G     S +  +L Y
Sbjct: 434  G----ESDSALILIY 444

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            +T+    LP  L +HL RF Y      +      + YPL LN+       +  +YKL  I
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 1013 VNHTGNL-ISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY ++   D +         W  FDDE          +     + S   
Sbjct: 678  VVHMGSSPQQGHYVAICKTDKY--------GWLLFDDETASWINEEEVLSFIGDEKSQNT 729

Query: 1072 VYVLFYERV 1080
             YVLFYE V
Sbjct: 730  AYVLFYEEV 738

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 118/308 (38%), Gaps = 57/308 (18%)

Query: 618 LHSPRNQTLTRKFSIPTIEKNSNPYVAYS--------------VTGLRNLGNTCYINCML 663
           LH+P +  +TR F +  + +       YS              V GL N GNTC++N +L
Sbjct: 23  LHTPTSSKITR-FVLKMVNQAKRMTSYYSAPSMDDVILKRGGFVAGLVNDGNTCFMNSVL 81

Query: 664 QSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKI 723
           QSL ++ EL + F+     E +   N+   S    T  +  N  Y        P+  LK 
Sbjct: 82  QSLASSRELAH-FLDDIIEESEPNKNELNFSVAFKTLLDKLNAKYGRNRKYYRPNALLKT 140

Query: 724 C-NFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXK------- 775
             +    ++ +  DQ+D QEF   I+++L  +L  +                +       
Sbjct: 141 MESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTDGDFKKEESVQPSSEDDKTPIL 200

Query: 776 -------MMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMEN-----------------AL 811
                   ++++E  +K     +    + P   + +G+ E+                  +
Sbjct: 201 ESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEHESFYTPYKLLTPLDGIIAERI 260

Query: 812 QCQRCGYE-SVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDC 870
            C  CG    + YS    LSL LP  +  A      +KL + ++ +   E++ G    DC
Sbjct: 261 GCLNCGENGGIRYSVSSGLSLNLPNENIGA-----TLKLSELLDKWVEPEIIEG---VDC 312

Query: 871 PKCGSKAV 878
            +C  +AV
Sbjct: 313 NRCALEAV 320

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 17/115 (14%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYRE-YQMKPNDNKE----SAISNTFANL 703
           GL N+GNTCY+N  LQ+L+  + L+++ +  KY+E   ++P D       S +   F NL
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVL--KYKEQANVQPGDELHYKLISELKRCFENL 167

Query: 704 FNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD------QQDTQEFLLFILNRLH 752
             K Y     +V+P  FL +     P     D+      QQD +E    + + L+
Sbjct: 168 QKKSYE----SVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY S +  +   N      KWY F+D+   VV+ EK       
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDEN------KWYKFNDDKVSVVEREKIEALAGG 480

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 481  G----ESDSALILIYK 492

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 22/107 (20%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV---------LKNEEI 1004
            K + F S P VL + L RF YD     L K ND    +P  +++          L N+E 
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPETIDVSPYIEKGSEQLSNKEA 438

Query: 1005 VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
              Y L+ ++ H G++ +GHY +++             +WY FDD+ V
Sbjct: 439  CIYNLHGVLVHAGDISTGHYYTMIRP-------GVSDEWYRFDDDKV 478

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
            Anc_8.540 YPL072W
          Length = 482

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 151/400 (37%), Gaps = 91/400 (22%)

Query: 648  TGLRNLGNTCYINCMLQSLFATNE----LKNLFISGKYREYQMKPNDNK-----ESAISN 698
            TGL N GN C+IN  LQ L  +      L ++    K+     K   N+        ++ 
Sbjct: 69   TGLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNENPKQEGNRYALPLHQVMAE 128

Query: 699  TFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQ 758
               +L    ++N   TV  S  + +        ++   Q D QEF   +L  LH+E    
Sbjct: 129  FIYDLQAPTFLN---TVESSDKIIVTMESIFKQKMSRRQNDAQEFTQLLLEVLHNEYQEL 185

Query: 759  VNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGY 818
            + ++                             + N L      F+G+  + L C +CG 
Sbjct: 186  IRLM---------------------------NFITNNLDIPTYPFEGKYCHELTCLKCGR 218

Query: 819  ES-VNYSTFYVLSLALP-KPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSK 876
             S V    F +L+L LP +PS                   + DE+++G N        S 
Sbjct: 219  NSEVKMFDFDILTLNLPAQPS------------------ISLDELISGSN--------SD 252

Query: 877  AVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRS-KSPFRKLGL-LEKHEGKQE 934
             +E    +      IL  +  H+        P  +++ +S K  F +L +  E  E    
Sbjct: 253  VIEGFSCTVCKVSAILGGTGTHN--------PNTRSLIKSLKEIFPELKINTELDEPLNS 304

Query: 935  KLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSY- 991
             +D    D +      ++ K   +K   F+ +P +L+IHL+R  ++     +N   ++Y 
Sbjct: 305  FVDSYSHDGV----ITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYD 360

Query: 992  -------PLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHY 1024
                    LV++ V      ++Y L S + H+G+   GHY
Sbjct: 361  EKLLLEHQLVMDGVSVMRNNIQYTLSSAIKHSGSHSMGHY 400

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 52/113 (46%), Gaps = 21/113 (18%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDA--------VVSYPLVLNIVLKNEEIV 1005
            K + F S P VL + L RF YD     L K ND         V SY   +          
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE-VVKAEKTH 1057
             YKL+ ++ H G++ +GHY +++         +TE +WY FDDE V K  KT 
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKP-------STEDQWYRFDDEKVWKVTKTQ 475

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 88/247 (35%), Gaps = 67/247 (27%)

Query: 638 NSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM-----KPNDNK 692
           NS     Y   G +N G TCY+N +LQS F T   + L        YQ+      PN++ 
Sbjct: 185 NSKKVTGY--VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENDSPNNSV 235

Query: 693 ESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLH 752
             A+   F  L          +  P   L++      D      Q D QE    +++RL 
Sbjct: 236 PLALQRAFYQL--------QVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLE 287

Query: 753 DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
           +++                                  T V + L+    +F G+M++ ++
Sbjct: 288 NKMKG--------------------------------TPVEDKLNE---IFVGRMKSYIK 312

Query: 813 CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPK 872
           C    YES     F+ L + +         K  +   E+ I +    E++ GEN +    
Sbjct: 313 CINVDYESSRVEEFWDLQMNVKN------LKDLKSSFENYIEI----ELMNGENQYAAQD 362

Query: 873 CGSKAVE 879
            G +  E
Sbjct: 363 YGLQDAE 369

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 52/106 (49%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNI-------VLKNEEIVR 1006
            K + F S P VL + L RF YD     L K ND    +P  +++       VL+     R
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRY-EFPERIDLSPYMDKDVLEANPGPR 438

Query: 1007 -YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ HTG++ +GHY +L+           E +WY FDDE V
Sbjct: 439  WYGLHGVLVHTGDISTGHYYALIKP-------GLEDQWYRFDDERV 477

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 77/227 (33%), Gaps = 55/227 (24%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L    +    Q  P D+   A+   F  L    
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVY--QIPTSQENPKDSVVLALQRAFYQLQVSQ 260

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
           Y        P   +++      D      Q D QE    +++RL   +            
Sbjct: 261 Y--------PLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKG---------- 302

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFY 827
                                 T V N L+    +F G+M++ ++C    YES     F+
Sbjct: 303 ----------------------TTVENKLNE---IFVGKMKSFIKCINVDYESARTEDFW 337

Query: 828 VLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            + + +               L+D    +   E++ GEN +     G
Sbjct: 338 DIQMNVKNLKG----------LKDSFENYIEVELMDGENQYAAQDYG 374

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIVL--------KNEEIV 1005
            K + F S P +L + L RF YD     L K ND    +P   +            N E  
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRY-EFPESFDTSPYMEKKEDGSNNEPC 436

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ HTG++ +GHY +++  D        E +WY FDDE V
Sbjct: 437  IYNLHGVLVHTGDISTGHYYAMIKPD-------LEDQWYRFDDEKV 475

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 80/236 (33%), Gaps = 63/236 (26%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L    K       PN +   A+   F  L    
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY--KIPTESETPNSSVPLALQRAFYQL---- 254

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   L++      D      Q D QE    +++RL + +            
Sbjct: 255 ----QVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMLG---------- 300

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        +PV+G    +F G+M++ ++C    YES   
Sbjct: 301 -----------------------------TPVEGKLSELFVGKMKSYIKCVNVEYESSRV 331

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVE 879
             F+ L L +               L+D    +   E++ GEN +     G +  E
Sbjct: 332 EDFWDLQLNVKNLKC----------LKDSFENYIEIELMNGENQYAAQDFGLQDAE 377

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 56/130 (43%), Gaps = 17/130 (13%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLN--IVLKNEEIVRYKLYSI 1012
            + +    LP  L +HL RF Y   +  +      + YPL L+      +    +Y+L  I
Sbjct: 561  RKVGLKQLPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGI 620

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGIT-KVSSK 1070
            V H G     GHY SL   D   N G     W  FDDE V+A      V K I  + S  
Sbjct: 621  VVHMGGGPQHGHYVSLCKND---NFG-----WLLFDDETVEAVH-ESTVSKFIGDRDSLT 671

Query: 1071 NVYVLFYERV 1080
              YVLFY+ +
Sbjct: 672  TAYVLFYKEI 681

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK 687
           V G  N GNTCY N +LQ L+   E + L +    R+ ++K
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLLQHLERDPKIK 163

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 78/212 (36%), Gaps = 36/212 (16%)

Query: 664 QSLFATNELKNL-FISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLK 722
           Q +F++ + K    I G         N++K S + N+  ++F  +  N   T V S    
Sbjct: 376 QKVFSSEQRKKAALIRGPILNVDHLLNESKVSNLYNSLKDIFECITENHSLTGVVSPISF 435

Query: 723 ICNFLRPDLRIPDD-QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKE 781
           +    R +L       QD  EFL F+LN L + +   ++ I                  +
Sbjct: 436 VETLKRENLLFNTTMHQDAHEFLNFLLNELSEYIQKDIDSIQDPA--------------K 481

Query: 782 KYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAF 841
           KY  +            ++G+FQG +   ++C  C   +     F    + +        
Sbjct: 482 KYDNF------------INGLFQGTLTYRIKCLTCDNVTSRDEPFLDFPIEVQDDE---- 525

Query: 842 YKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
                  ++  +  +   E+L+G N + C +C
Sbjct: 526 ----ETDIQALLRSYQQREMLSGSNKFYCDEC 553

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 37/160 (23%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRFYY--DLTKKN-------------------- 985
            K  S K V  K   FI  LP+VL+I L RF +  ++ K N                    
Sbjct: 927  KSSSGKDVEAKKQTFIDKLPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKIN 986

Query: 986  ---DAVVSYPLVLNIVLKNEEIVR-YKLYSIVNHTGNLI-SGHYTS-LVNKDPHHNLGNT 1039
               + +V    V + +LKN E  R YKL ++V H G+    GHYT+ + NKD        
Sbjct: 987  YNHELLVPVESVSSAILKNNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKD-------- 1038

Query: 1040 EQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
             +KW+  DD  +   +    V+ G   + ++  Y+L YE+
Sbjct: 1039 LKKWFMIDDVNITELEDADVVNGGDNGLDTRTAYILMYEK 1078

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 101/259 (38%), Gaps = 58/259 (22%)

Query: 628 RKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNEL-KNLFISGKYREYQM 686
           R  S PT+           + G  N+G+TC+++ +LQ L     + +N      Y   ++
Sbjct: 107 RNISFPTVTNRD------GLHGFVNMGSTCFMSSILQVLIHNPFIVQNSMSQSHYSSCKI 160

Query: 687 K-PNDNKESAISNTFANLFNKM--YMNGG-CTVVPSGFLKICNFLRPDLRIPDD-----Q 737
           + PN+    A+    A  +     Y NG        GF+ +   L    +I D+     Q
Sbjct: 161 RNPNNCISCALDEIIAESYGNFVKYNNGKPINQYHDGFISM---LNCSWKINDNFAGYSQ 217

Query: 738 QDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLS 797
           QD  EFL FILNRLH                          D +    + + T   + L 
Sbjct: 218 QDAHEFLQFILNRLHR-------------------------DYKLTSTYTNNTDSCSCL- 251

Query: 798 PVDGVFQGQMENALQCQRCGYESVNYSTFYV-LSLALPKPSAPAFYKSGRVKLEDCINMF 856
            +  +FQG++++++ C  C   S   +  Y+ LSL +            +  L  C++ F
Sbjct: 252 -IHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKD----------KATLYQCLDSF 300

Query: 857 TSDEVLTGENAWDCPKCGS 875
              E L   N + CP C +
Sbjct: 301 HKKETLHDYN-YHCPNCDT 318

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 16/104 (15%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNI-----VLKNEEIVRYKL 1009
            IK +    LP VL++ L RF +    +N   +A + +P  LN+       +N   + Y+L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 1010 YSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
              +++H G +  GHY + +  D           W+ F+D +V +
Sbjct: 383  NGVISHIGTVNEGHYIATLKLDS--------NNWFKFNDSMVTS 418

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 78/194 (40%), Gaps = 49/194 (25%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ---MKPNDNKESAIS--NTFAN 702
            GL NLGN+CY+N +LQ LF    +K   + G  +++    + P +N +  +   N    
Sbjct: 323 CGLINLGNSCYLNSVLQCLF-NGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK 381

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
           +  + Y  G   + P  F K       +      QQD+ EFL ++++ L           
Sbjct: 382 VEPQNYPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL----------- 426

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                                    DK +  NG +P D + +  ME+ LQC  CG   V 
Sbjct: 427 -------------------------DKKIFKNGSNPND-LMKFTMEDRLQCTNCG--KVK 458

Query: 823 YSTFYVLSLALPKP 836
           YS+    SL LP P
Sbjct: 459 YSSEAAESLQLPMP 472

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 98/396 (24%), Positives = 154/396 (38%), Gaps = 121/396 (30%)

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q+D +EFL  +L++LH+EL                                        +
Sbjct: 581  QEDAEEFLTHLLDQLHEEL----------------------------------------I 600

Query: 797  SPVDGVFQGQMENALQCQRCGYESVN---YSTFYVLSLALPKPSAPAFYKSGRVKLEDCI 853
            S +DG+   +++N LQ       S+N      F++ +L+  +     F K+   KL++ I
Sbjct: 601  SAIDGLSDNEIQNMLQ-------SINDEQLKIFFIRNLS--RYGKAEFIKNATPKLKELI 651

Query: 854  ---NMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG---- 906
                M   D   T EN W      SK  +   T+   T  I+P SP     SK FG    
Sbjct: 652  ETHGMINDDS--TEENGWHEVSGSSKRGKKTKTAAKRTVEIVP-SP----ISKLFGGQFR 704

Query: 907  ----LPTGK-AISRSKSPFRKLGLLEKHEGKQEKLDKMER--DEIEEWH----KMKSKKL 955
                +P  K + S +  PF+ + L    +     ++ +E    +  E+     K  S   
Sbjct: 705  SVLDVPNNKESQSITLDPFQTIQL----DISDSSVNDLETAFKKFSEYELLPFKSSSGND 760

Query: 956  VTIKTINFI-SLPKVLIIHLSRF-YYDLTKKNDAVVSY------------------PLVL 995
            V  K   FI  LP+VL+I   RF + +   K++A+ +Y                   L++
Sbjct: 761  VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELII 820

Query: 996  ------NIVLKNEEIVR----YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWY 1044
                  +I LKN         YKL  ++ H G     GHYT+ V    H+       KWY
Sbjct: 821  PEESMSSITLKNHTSGADDRIYKLTGVIYHHGVGSDGGHYTADVYHSEHN-------KWY 873

Query: 1045 YFDDEVVKAEKTHGNVDKGITKVS-SKNVYVLFYER 1079
              DD V   E    +V KG  + S S+  Y+L Y++
Sbjct: 874  RIDD-VNITELEDDDVLKGGEEASDSRTAYILMYQK 908

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNI-VLKNEEIVR-YKLYSI 1012
            + +    LP+ LI+HL RF Y   + ++      ++YPLVL +    N +I + Y L  I
Sbjct: 513  RIVGLKKLPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGI 572

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            V H G     GHY S+          N +  W  FDDEVV
Sbjct: 573  VLHLGGGPQHGHYVSICK--------NEKYGWLLFDDEVV 604

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNK 692
           V G  N GNTCY N +LQ L+   EL++  I     +Y M PN+ K
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRDNVI-----KYPMVPNEQK 151

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 24/29 (82%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFI 677
           GL+N+GNTCY+N  LQ+LF  +ELK+L +
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLIL 138

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+ V
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDEN------KWYKFNDDKV 465

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKND------AVVSYPLVLNIVLK------- 1000
            K + F S P VL + L RF YD     + K ND       +   P V   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 1001 NEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            N     Y L+ ++ H+G++ +GHY +L+           E +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKP-------GVEDQWYRFDDERV 485

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 86/231 (37%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L +     E++  PN++   A+   F  L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL-VYEIPTEHE-SPNNSVPLALQRAFYQL---- 258

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   L++      D      Q D QE    +++RL + +            
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKG---------- 304

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        +PV+G    +F G+M++ ++C    YES   
Sbjct: 305 -----------------------------TPVEGKLNEIFVGRMKSYIKCINVDYESSRV 335

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ L + +        +K+ +   ++ I M    E++ GEN +     G
Sbjct: 336 EDFWDLQMNVKN------FKNLQESFDNYIEM----ELMNGENQYAAQDYG 376

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 21/159 (13%)

Query: 908  PTGKAISRS-KSPFRKLGL-LEKHEGKQEKLD---KMERDEIEEWHKMKSKKLV-TIKTI 961
            P  K  S++ K PF  L L ++      E LD   KME+     +H  +       IK +
Sbjct: 293  PECKMDSKTTKDPFMDLSLDIKDKSNLYECLDSFHKMEQLHDFNYHCDRCNTTQNAIKRL 352

Query: 962  NFISLPKVLIIHLSRFYYDL---TKKNDAVVSYPLVLNI--VLKNEEI--VRYKLYSIVN 1014
                LP VL++ L RF + L   + K + +V +PL LN+      +++  + ++L  I+ 
Sbjct: 353  IIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFELIGIIA 412

Query: 1015 HTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
            H G +  GHY +       H        W+ F+D +V +
Sbjct: 413  HRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSS 443

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 18/106 (16%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAV-----VSYPLVLNIVLKNEEIVRYK 1008
            + + F S P VL + L RF YD     L K ND       +     L+     +    Y 
Sbjct: 373  QKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYI 432

Query: 1009 LYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE-VVKA 1053
            L+ ++ H+G++ +GHY +++  D H +       WY FDD+ V+KA
Sbjct: 433  LHGVLVHSGDISTGHYYAMIQPDAHGS-------WYRFDDDRVIKA 471

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLN--------IVLKNEEIV 1005
            K + F S P VL + L RF YD     L K ND    +P  ++        I   N +  
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEISSSNADSY 441

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ HTG++ +GHY +++         + E +WY FDD+ V
Sbjct: 442  IYDLHGVLVHTGDISTGHYYTMIKP-------SIEDQWYRFDDDKV 480

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 81/231 (35%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G +N G TCY+N +LQS F T   + L        YQ+ P D KES  +N+      + 
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV-------YQI-PTD-KESP-NNSVPLALQRA 255

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
           +     +  P   L++      D      Q D QE    +++RL +++            
Sbjct: 256 FFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKG---------- 305

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        + VDG    VF G+M + ++C    YES   
Sbjct: 306 -----------------------------TDVDGKLNEVFVGKMRSYIKCVNVDYESSRV 336

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ + L +               L++    +   E++ GEN +     G
Sbjct: 337 EDFWDIQLNVKNLRG----------LQESFKNYIEVEMMDGENQYAAQGYG 377

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 42/175 (24%)

Query: 923  LGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVT----IKTINFISLPKVLIIHLSRFY 978
            LG+ +KH    E LD   + E    +    KK       IK      LP VL++ L RF 
Sbjct: 303  LGIKDKHT-LTECLDNFHKKEQLHDYDFFCKKCQAQQNPIKQFTINKLPPVLVLQLKRFE 361

Query: 979  YDLTKKNDAV---VSYPLVLNI--VLKNEE------IVRYKLYSIVNHTGNLISGHYTSL 1027
            + ++  N  +   + +P +L++   LK+ +       + Y+L  I++HTG++  GHY + 
Sbjct: 362  HLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIISHTGSVNEGHYVAF 421

Query: 1028 VNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNV-----YVLFY 1077
                    + N E  W+ F+D +V             TK+  K+V     Y+LFY
Sbjct: 422  C------KIENGE--WFKFNDSMV-------------TKILEKDVLKEQAYLLFY 455

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 21/136 (15%)

Query: 631 SIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKY-REYQMKPN 689
           ++PT+++         + GL N+G+TCY++ ++Q +     +   F+  ++     +K  
Sbjct: 126 NVPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMA 179

Query: 690 DNKES-AISNTFANLFNKMYMNG-----GCTVVPSGFLKICNFLRPDLRIPDD-----QQ 738
            N  S AIS+  A+ +     N             GF+   N L    ++ ++     QQ
Sbjct: 180 SNCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFI---NLLTCSWKVNENLAGYSQQ 236

Query: 739 DTQEFLLFILNRLHDE 754
           D  E+  FILN +H +
Sbjct: 237 DAHEYWQFILNHIHQD 252

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 30/157 (19%)

Query: 935  KLDKMERDEI-EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLT--KKNDAVVSY 991
            ++DK ++  + E+ HK  +      K  + +  P+ L++HL +F ++ T   K    VSY
Sbjct: 613  RVDKEKKGYVCEKCHKTTN----ATKRSSILRAPETLLVHLKKFRFNGTTSSKMKQAVSY 668

Query: 992  PLVLNIVLKNEEI-------VRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKW 1043
            P+ L++    E         V+Y+L S+V H G +L SGHY +   +         +  W
Sbjct: 669  PMYLDMTEYCETPSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQ--------PDGSW 720

Query: 1044 YYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
              +DDE +       N    +  +   N Y L Y R+
Sbjct: 721  ATYDDEYI-------NKISELNVLKEANAYYLLYTRL 750

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 7/103 (6%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPNDNKESAISNTFANLFNKM 707
           G +N+GNTCY+N  LQSLF  ++L+ L ++   + +  + P D     +     + F  +
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHHKLILELKHCFESL 168

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFL 744
                 +V+P   + +   + P     D       QQD +E  
Sbjct: 169 KQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELF 211

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 16/97 (16%)

Query: 963  FISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNIVLKNEEI-----VRYKLYSIVNH 1015
             +  P+ L++HL +F ++ T   K    VSYP+ L++    E       V+Y+L S+V H
Sbjct: 344  LLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLISVVVH 403

Query: 1016 TG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             G +L SGHY +   K P       +  W  +DDE +
Sbjct: 404  EGRSLSSGHYIAHC-KQP-------DGSWSTYDDEYI 432

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 7/109 (6%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           GL+NLGNTCY+N  LQ LF    L+ + ++ K +   + P D     I     N F+ + 
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYK-QSSSVSPADEVHQKIVLELRNCFDSLD 168

Query: 709 MNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFLLFILNRL 751
                 V+P   L +     P     D       QQD +E    + + L
Sbjct: 169 KKKFQAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSL 217

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKND------AVVSYPLVLNIVLK------- 1000
            K + F S P VL + L RF YD     + K ND       +   P V   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 1001 -NEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             ++    Y L+ ++ H+G++ +GHY +L+           E +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKP-------GVEDQWYRFDDERV 486

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 82/231 (35%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L            PN++   A+   F  L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTE--HESPNNSVPLALQRAFYQL---- 258

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   L++      D      Q D QE    +++RL + +            
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKG---------- 304

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        +PV+G    +F G+M++ ++C    YES   
Sbjct: 305 -----------------------------TPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ L L +        +K+ +   ++ I M    E++ GEN +     G
Sbjct: 336 EDFWDLQLNVKN------FKNLQESFDNYIEM----ELMNGENQYAAQDYG 376

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 47/118 (39%), Gaps = 6/118 (5%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           G +N+GNTCY+N  LQ+LF  + LK++ ++ K     + P D     I       F  + 
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNNISPEDELHHKIVIELKKCFETLD 169

Query: 709 MNGGCTVVPSGFLKICNFLRPDLRIPDD------QQDTQEFLLFILNRLHDELSNQVN 760
                 V+P   L +     P     D       QQD +E    +   L     ++ N
Sbjct: 170 GKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTLKIVFGDKFN 227

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYF-DDEVVKAEK 1055
            Y L  I+ H G N  SGHY S +  +      N E KWY F DD+V + EK
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDE------NDEDKWYKFNDDKVSEYEK 480

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 28/113 (24%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV-LKNEEIVR------ 1006
            K + F S P VL + L RF YD     + K ND    +P  +++    +++++R      
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKY-EFPETIDLSPFVDKDVLRKTLDSG 440

Query: 1007 --------YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
                    Y L+ ++ H+G++ +GHY +L+           E +WY FDDE V
Sbjct: 441  DKDKNPYIYNLHGVLVHSGDISTGHYYTLIKP-------GVEDQWYRFDDERV 486

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 82/231 (35%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L            PN++   A+   F  L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTE--HESPNNSVPLALQRAFYQL---- 258

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   +++      D      Q D QE    +++RL + +            
Sbjct: 259 ----QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKG---------- 304

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        +PV+G    +F G+M++ ++C    YES   
Sbjct: 305 -----------------------------TPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ L L +        +++ +   ++ I M    E++ GEN +     G
Sbjct: 336 EDFWDLQLNVKN------FENLQGSFDNYIEM----ELMNGENQYAAQDYG 376

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 28/113 (24%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV-LKNEEIVR------ 1006
            K + F S P VL + L RF YD     + K ND    +P  +++    ++E+++      
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKY-EFPETIDLSPFVDKEVLKKSLDSG 440

Query: 1007 --------YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
                    Y L+ ++ H+G++ +GHY +L+           E +WY FDDE V
Sbjct: 441  DKSRNPYVYNLHGVLVHSGDISTGHYYTLIKP-------GVEDQWYRFDDERV 486

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 82/231 (35%), Gaps = 63/231 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            G RN G TCY+N +LQS F T   + L            PN++   A+   F  L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTE--HESPNNSVPLALQRAFYQL---- 258

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
                 + +P   +++      D      Q D QE    +++RL + +            
Sbjct: 259 ----QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKG---------- 304

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDG----VFQGQMENALQCQRCGYESVNY 823
                                        +PV+G    +F G+M++ ++C    YES   
Sbjct: 305 -----------------------------TPVEGKLSEIFVGKMKSYIKCVNVDYESARV 335

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
             F+ L L +        +K+ +   ++ I M    E++ GEN +     G
Sbjct: 336 EDFWDLQLNVKN------FKNLQESFDNYIEM----ELMNGENQYAAQDYG 376

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 18/104 (17%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKND------AVVSYPLVLNIVLKNEEIVRY 1007
            K + F S P VL + L RF YD     + K ND       +   P + +   + E    Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 1008 KLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             L+ ++ H G++ +GHY +L+           E +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKP-------GLEDQWYRFDDERV 476

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 84/237 (35%), Gaps = 65/237 (27%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM-----KPNDNKESAISNTFAN 702
            G RN G TCY+N +LQS F T   + L        YQ+      PN++   A+  +F  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENESPNNSVPLALQRSFYQ 255

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
           L          +  P   L++      D      Q D QE    +++RL + +       
Sbjct: 256 L--------QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM------- 300

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                                     K     G+  ++ +F G+M++ ++C    YES  
Sbjct: 301 --------------------------KGTSVEGM--LNEIFVGKMKSYIKCIDVDYESSR 332

Query: 823 YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVE 879
              F+ L L +               L++  + +   E+L GEN +     G +  E
Sbjct: 333 VEDFWDLQLNVKNMKG----------LKESFDNYIEIELLNGENQYQAQDYGLQDAE 379

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 11/138 (7%)

Query: 621 PRNQTLTRKFSIPTIEKNS-NPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISG 679
           P+N   T KF I  ++KN    +++    G+ NLGNTCY+N  LQ LF  + L+   +  
Sbjct: 78  PKN---TEKF-IEDLDKNEQGQHLSKMPMGIANLGNTCYMNATLQGLFRIDPLREQVLEF 133

Query: 680 KYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPD---- 735
             +    +  D   + +       F K+    G  + P   L+I   + P     D    
Sbjct: 134 DEKRAIKEGVDTYHAQLVRELKVTFQKLKDRKGENITPLLLLEILRRVFPQFSETDPQGG 193

Query: 736 --DQQDTQEFLLFILNRL 751
              QQD +E    + + L
Sbjct: 194 FYKQQDAEELFTQLFHTL 211

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 8/48 (16%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
            Y L  ++ H G N  SGHY + +  D        ++KWY FDD+ V A
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRDD-------ADEKWYRFDDDKVTA 455

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNI-------VLK-NEEIV 1005
            K + F S P VL + L RF YD     L K ND    +P  +++       V K   E +
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEVRKIRPESM 434

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ HTG++ +GHY +++           + KWY FDD+ V
Sbjct: 435  MYNLHGVLVHTGDISTGHYYAMIKP-------GLDDKWYRFDDDKV 473

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 44/227 (19%), Positives = 79/227 (34%), Gaps = 55/227 (24%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            GL+N G TCY+N +LQS + T   + L        Y + P D +    SN+      + 
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHI-PTDGETP--SNSVPLALQRA 248

Query: 708 YMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXX 767
           +     +  P    ++      D      Q D QE    +++RL +++            
Sbjct: 249 FYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKM------------ 296

Query: 768 XXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFY 827
                                K     G   ++ +F G+M++ ++C    YES     F+
Sbjct: 297 ---------------------KATEVEG--KLNEIFVGKMKSYIKCVNVEYESSRVEDFW 333

Query: 828 VLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            + L +           G   L      +   E++ GEN +   + G
Sbjct: 334 DIQLNV----------KGLNGLNQAFENYIEVEMMDGENQYAAQRYG 370

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLN--------IVLKNEEIV 1005
            K + F S P VL + L RF YD     L K ND    +P  ++        ++ KN    
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRY-EFPETIDLSPYLDPDVLKKNPGPC 437

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
             Y L+ ++ H+G +  GHY +++  D    +G+   +W+ FDD+ V
Sbjct: 438  VYNLHGVLVHSGEISVGHYYAMIKPD----VGD---QWFRFDDDKV 476

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 48/114 (42%), Gaps = 12/114 (10%)

Query: 590 IKLESIEESAPSDNSQYI---RPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYS 646
           I+LES++    S NS ++   R    + +  L  P    L   F       N +      
Sbjct: 148 IELESLKRRTSSKNSGFLSNGRLNVSVFVRILKDPTG-VLWHNF------MNYDSKKLTG 200

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTF 700
             GL+N G TCY+N +LQS F T   +   I  K       PND+   A+  +F
Sbjct: 201 FIGLKNQGATCYLNSLLQSYFFTKLFRK--IVYKIPSENESPNDSVLLALQRSF 252

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 25/134 (18%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLT--KKNDAVVSYPLVLNIVL---KNEE----IVRY 1007
             +K  + I  P+ L+ HL +F ++ T   K    VSYP+ L++      NE+     V+Y
Sbjct: 490  AVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTEYCESNEKDHVVPVKY 549

Query: 1008 KLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITK 1066
            +L ++V H G +L SGHY  +  K P       +  W  +DDE +  + T  +V      
Sbjct: 550  QLTTVVVHEGRSLSSGHYI-VHCKQP-------DGTWATYDDEYIN-KITERDV------ 594

Query: 1067 VSSKNVYVLFYERV 1080
            +   N Y L Y R+
Sbjct: 595  LKEPNAYYLLYTRL 608

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 52/123 (42%), Gaps = 15/123 (12%)

Query: 966  LPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIVR--YKLYSIVNHTG-N 1018
            LPK L IHL RF Y      +      + YP+ L +    +E V   Y+L  +V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 1019 LISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYE 1078
               GHY S+           ++  W  FDDE V+       +       S+   YVLFY+
Sbjct: 587  PQHGHYISVCK--------TSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAYVLFYK 638

Query: 1079 RVD 1081
             ++
Sbjct: 639  EIN 641

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 60/159 (37%), Gaps = 32/159 (20%)

Query: 715 VVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXX 774
           + P GF++I       L   D  QD  EFL F+LN + D L                   
Sbjct: 386 ISPGGFMEIVK-KENILFATDMHQDAHEFLNFLLNDVSDYL------------------- 425

Query: 775 KMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALP 834
               DK   +K  D T   N  + V+ +F+G + N ++C  C   +  Y +F    + + 
Sbjct: 426 ----DKANTEKNPDNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEVI 481

Query: 835 KPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
                       + ++  +  +   E+L G N + C  C
Sbjct: 482 GDET--------IDIQKMMISYHQKEMLQGSNKFYCGTC 512

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 645 YSVTGLRNLGNTCYINCMLQSLFATNELK-NLF-----ISGKYREYQMKPND 690
           + V GL N GNTCY N +LQ L+  NE + N+      I  K  E    PND
Sbjct: 128 HKVYGLENFGNTCYCNSILQCLYNMNEFRENILGLTPSIDAKTAEISSIPND 179

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 60/137 (43%), Gaps = 32/137 (23%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-----------LKNE 1002
             IK +    LP VL++ L RF + L   N   D  + +P  LN+              N 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 1003 EI--VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNV 1060
            ++  + Y+L  IV+H G +  GHY +            +  +W+ F+D VV +      +
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFCKI--------SGGQWFKFNDSVVTS------I 450

Query: 1061 DKGITKVSSKNVYVLFY 1077
             +G  +V  +  Y+LFY
Sbjct: 451  AQG--EVLKEQAYLLFY 465

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 26/130 (20%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDL---TKKNDAVVSYPLVLNIVLKNEEI-------VRY 1007
            IK +    LP VL++ L RF + +   + K +  ++YP  LN+     +        + Y
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 1008 KLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKV 1067
            +L ++++H G++  GHYTS+  K P         +W+ F+D ++        V     + 
Sbjct: 395  ELVAVISHEGSVNQGHYTSMC-KIP-------GGQWFRFNDSMI--------VSISEEEA 438

Query: 1068 SSKNVYVLFY 1077
              +  Y+LFY
Sbjct: 439  LRQQAYLLFY 448

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 90/233 (38%), Gaps = 41/233 (17%)

Query: 647 VTGLRNLGNTCYINCMLQSLFAT-NELKNLFISGKYREYQMKPNDNKESAISNTFANLFN 705
           + GL N+G+TC+++ ++Q+L      LK       +    ++ + +  S   +   + F 
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQVHFSRCDIQDSASCFSCALDRIVSNFY 194

Query: 706 KMYMNGGCTVVPSGF--LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIX 763
               +   T    GF  L +C++          QQD  EF  F LN+LH +         
Sbjct: 195 GPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQFFLNQLHAD--------- 245

Query: 764 XXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYES-VN 822
                       + V  +K  K  +   +++        FQG + +++ C  C   S + 
Sbjct: 246 -----------HVRVTGKKSSKPEECNCISH------SAFQGSLRSSILCTDCHDGSNIT 288

Query: 823 YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGS 875
           +     LSL +   +          KL DC+  F   E LT  N   CP CGS
Sbjct: 289 FDPMMDLSLEIKNKN----------KLVDCLKSFHEGETLTDFNH-RCPNCGS 330

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
            Anc_8.202 YER151C
          Length = 829

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 86/389 (22%), Positives = 145/389 (37%), Gaps = 114/389 (29%)

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q+D +EFL  +L++LH+EL   +N++                                  
Sbjct: 508  QEDAEEFLTHLLDQLHEELVASINLLS--------------------------------- 534

Query: 797  SPVDGVFQGQMENALQCQRCGYESVN---YSTFYVLSLALPKPSAPAFYKSGRVKLEDCI 853
                   + +++N LQ       S+N      F++ +L+  K S   F  +  V+L++ I
Sbjct: 535  -------ENEIQNILQ-------SINDQELKVFFIRNLSRFKKSE--FLNNASVQLQELI 578

Query: 854  NMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG------- 906
            + + +      E+ W       K  +   T+   T  ++P SP     SK FG       
Sbjct: 579  SKYGNASEENEEDGWHEVSSSGKRSKKNKTAAKRTVEVIP-SP----ISKLFGGQFRSVL 633

Query: 907  -LPTGKA-ISRSKSPFRKLGL------LEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTI 958
             +P  K   S +  PF+ + L      +   EG  +K  + E        +  S   V  
Sbjct: 634  DIPNNKERQSITLDPFQTIQLDISDSSVIDLEGAFKKFSEFELIPF----RTSSGTDVEA 689

Query: 959  KTINFI-SLPKVLIIHLSRFYY--DLTKKNDA------------------------VVSY 991
            K   FI  LP+VL+I L RF +  ++ K ND                         + S 
Sbjct: 690  KKQTFIDKLPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELIIPSE 749

Query: 992  PLVLNIVLKNEEIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEV 1050
             +  N  + N E   Y L  ++ H G +   GHYT+ V       L +  +KWY  DD  
Sbjct: 750  SVSSNATMSNRE---YSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRIDDVN 799

Query: 1051 VKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
            +   +    +  G     S+  Y+L Y++
Sbjct: 800  INELEEDDVLKGGEEDNDSRTAYILMYQK 828

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 11/88 (12%)

Query: 953  KKLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYP--LVLN-IVLKNEEIV-- 1005
            K  +  +T++  S P+VLI+HLSR  ++     KN   V++P  LV+N  +L+N + V  
Sbjct: 375  KSTIVKRTVSVDS-PRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGV 433

Query: 1006 ---RYKLYSIVNHTGNLISGHYTSLVNK 1030
               RYKL +++ H G    GHY    +K
Sbjct: 434  RAVRYKLCAMIKHIGTHSQGHYACFRHK 461

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (47%), Gaps = 28/132 (21%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDL---TKKNDAVVSYPLVLNI--------VLKNEEIV 1005
             I+ +    LP VL++ L RF + +   + K +  + +P  L++        V +   IV
Sbjct: 334  AIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIV 393

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGIT 1065
             Y+L  +++H G++  GHYTS+  K P         +W+ F+D +V A      +D    
Sbjct: 394  -YELIGLISHQGSVNQGHYTSIC-KIP-------GGQWFKFNDSMVTAV---AEID---- 437

Query: 1066 KVSSKNVYVLFY 1077
             V  +  Y+LFY
Sbjct: 438  -VLKEQAYLLFY 448

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 66/138 (47%), Gaps = 21/138 (15%)

Query: 626 LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           ++ K SIP++EK +       + GL N+G+TC+++ ++Q+L     + N +I  K+   Q
Sbjct: 120 VSTKSSIPSVEKRN------GLAGLVNMGSTCFMSSIIQTL-----IHNPYIL-KHSMDQ 167

Query: 686 MKPN----DNKESAISNTFANLFNKMYMNGGCTVVPS---GFLKI--CNFLRPDLRIPDD 736
           +        N  S +S     + +  Y         +   GF+ +  C++ +        
Sbjct: 168 LHSTTCDLQNSSSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYS 227

Query: 737 QQDTQEFLLFILNRLHDE 754
           QQD  EF  F+LN+LH++
Sbjct: 228 QQDAHEFWQFLLNQLHND 245

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 109/278 (39%), Gaps = 60/278 (21%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLF---ISGKYREYQMKPNDNK----------- 692
           V GL N GNTC++N +LQSL ++ EL       I  K++E + K  + +           
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 693 --ESAISNTFANLFNKM---YMNGGCTVVPSGFLK-ICNFLRPDLRIPDDQQDTQEFLLF 746
             +   S  F  L +K+   Y         +  LK + N    ++ +  DQ+D QEF   
Sbjct: 150 DVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQN 209

Query: 747 ILNRLH-----------------------DELSNQVN---VIXXXXXXXXXXXXKMMVDK 780
           IL+ L                        D +  Q N   V              ++ + 
Sbjct: 210 ILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNND 269

Query: 781 EKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPA 840
           E   K++    +   ++P+DG+   ++   LQC   G   + YS F  LSL LP  +   
Sbjct: 270 ENDTKFYTPFKL---ITPLDGISAERI-GCLQCGENG--GIRYSVFSGLSLNLPGENI-- 321

Query: 841 FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAV 878
                 +KL   +  +   E++ G    +C +CG +A+
Sbjct: 322 ---GSTLKLTGLLKEWIKPEIIEG---VECYRCGLEAI 353

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIV-LKNEEI-------V 1005
            K + F S P VL + L RF YD     L K ND    +P  +++    + E+        
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEVQEDSPANA 425

Query: 1006 RYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            +Y L+ ++ HTG++ +GHY +++           E  WY FDD+ V
Sbjct: 426  KYNLHGVLVHTGDISTGHYYAMIKP-------GLEDAWYRFDDDKV 464

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 83/230 (36%), Gaps = 61/230 (26%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKM 707
            GL+N G TCY+N +LQS + T   + L        YQ+ P + +  A S + A    + 
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YQI-PTEGETPANSVSLA--LQRA 239

Query: 708 YMNGGCTVVPSGFLKICNFLRP---DLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIXX 764
           +     +  P   L  C   R    D      Q D QE    +++RL +++         
Sbjct: 240 FFQLQRSSEP---LDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKG------- 289

Query: 765 XXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYS 824
                                    T V   L   +G+F G+M++ ++C    YES    
Sbjct: 290 -------------------------TEVEGKL---NGLFVGKMKSYIKCVNVDYESSRVE 321

Query: 825 TFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
            F+ + L +           G   L+     +   E++ GEN +     G
Sbjct: 322 DFWDIQLNV----------KGLKGLQQSFENYIEVEMMDGENQYAAQGHG 361

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 32/137 (23%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-----------LKNE 1002
             IK +    LP VL++ L RF + L   N   D  + +P  LN+            + N+
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 1003 EI--VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNV 1060
            ++  + Y+L  IV+H G +  GHY +            +  +W+ F+D +V +       
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCKI--------SGGQWFKFNDSMVSSISQ---- 452

Query: 1061 DKGITKVSSKNVYVLFY 1077
                 +V  +  Y+LFY
Sbjct: 453  ----EEVLKEQAYLLFY 465

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 106/266 (39%), Gaps = 61/266 (22%)

Query: 626 LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNE-LKNLFISGKYREY 684
           ++ K  +P +E+         ++GL N+G+TC+++ +LQ L      +K+      + + 
Sbjct: 121 VSTKTVVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKC 174

Query: 685 QMKPNDNKESAISNTFANLFNKMY---------MNGGCTVVPSGFLKICNFLRPDLRIPD 735
           +++  DN     S     + +++Y          +   T   +GF+ +   L    +I  
Sbjct: 175 KVRSPDN---CFSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYL---LTCAWKINQ 228

Query: 736 D-----QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKT 790
           +     QQD  EF  FI+N++H                       +   KE      DK 
Sbjct: 229 NLAGYSQQDAHEFWQFIINQIHQNY-----------------VLSLPSTKES-----DKE 266

Query: 791 VVANGLSPVDGVFQGQMENALQCQRCGYES-VNYSTFYVLSLALPKPSAPAFYKSGRVKL 849
            + +    V  VF+G +E+++ C  C   S      F  LSL +            + KL
Sbjct: 267 NIKHCDCIVHTVFEGSLESSIVCPSCQNNSKTTIDPFMDLSLDIKD----------KKKL 316

Query: 850 EDCINMFTSDEVLTGENAWDCPKCGS 875
            +C++ F   E+L   N + C +C S
Sbjct: 317 YECLDSFHKKELLKDFN-YHCGECNS 341

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 44/109 (40%), Gaps = 12/109 (11%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           GLRN+GNTCY N  LQ+L+    L+   ++  Y E    PN +    +     N FN   
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA--YNE----PNPDLHGQLVIQLRNCFNAFA 160

Query: 709 MNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFLLFILNRL 751
                   P   L +   + P     D       QQD +E    +L+ +
Sbjct: 161 QRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTI 209

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 17/139 (12%)

Query: 626 LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           ++ K  +P++E+         + GL NLG+TC+++ +LQ L       N  IS  +   +
Sbjct: 121 VSIKTVVPSVERRD------GLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSHS--K 172

Query: 686 MKPNDNKESAISNTFANLFNKMYMNGGCT-------VVPSGF--LKICNFLRPDLRIPDD 736
             P  + +S IS     +  + Y +   +        + SGF  L +C++   +      
Sbjct: 173 KCPIQDPKSCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYS 232

Query: 737 QQDTQEFLLFILNRLHDEL 755
           QQD  EF  F+LN+LH + 
Sbjct: 233 QQDAHEFWQFLLNQLHHDF 251

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 33/135 (24%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLT----KKNDAVVSYPLVLNI----VLKNEEI---- 1004
             IK ++   LP VL++ L RF + L     K ND  + YP  LN+       + ++    
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLND-FIEYPPYLNMRDYCSSGDSDVDVPD 400

Query: 1005 VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGI 1064
            + Y+L  +V H G +  GHY +              ++W+ F+D +V +          +
Sbjct: 401  LIYELIGVVAHKGTVNEGHYVATTKV--------AGRQWFKFNDSMVSS----------V 442

Query: 1065 TKVSSKN--VYVLFY 1077
            T+  + N   Y+LFY
Sbjct: 443  TQEEALNEQAYLLFY 457

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 93/256 (36%), Gaps = 59/256 (23%)

Query: 649 GLRNLGNTCYINCMLQSLF------ATNELKNLFISGKYREYQMKPNDNKESAISNTFAN 702
           G  NLGN+CY+N +LQ LF          L NL I  ++    + P  N +  +     N
Sbjct: 334 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANL-IGNEFPLDCVYPTTNLKCQLIKIL-N 391

Query: 703 LFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVI 762
            F     N    + P  F         + +  ++QQD  EFL F+L +L           
Sbjct: 392 AFKLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQL----------- 439

Query: 763 XXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVN 822
                                    +KT+     +P + + +  ME+ +QCQ CG    +
Sbjct: 440 -------------------------EKTLFKKDNNP-NNIMKFIMEDKIQCQSCGNVKYS 473

Query: 823 YSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENA-WDCPKCGSKAVEPR 881
           Y     + L L   + P      +  +E   N F       GEN  +DCP C    V  +
Sbjct: 474 YEPTEYIQLPLDGTNNP------QNLVETLTNFF------NGENIDFDCPTCKKTVVATK 521

Query: 882 FTSRTSTQTILPNSPH 897
                ++   L  SPH
Sbjct: 522 RQRFKTSPNTLVISPH 537

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNI--VLKNEEIVRYKLYSI 1012
            + +    LP +L +HL RF Y   +K++      + YPL L++          +Y+L  +
Sbjct: 547  RMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGV 606

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY  +          N +  W  +DDE V++ K    +           
Sbjct: 607  VIHMGSGPQHGHYVCICR--------NEKFGWLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1072 VYVLFYERV 1080
             YVLFY+  
Sbjct: 659  AYVLFYKET 667

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 90/235 (38%), Gaps = 62/235 (26%)

Query: 648 TGLRNLGNTCYINCMLQSLFA--TNELKNLFISGKYREYQMK---PNDNKESAISNTFAN 702
            GL NLGN+CY+N +LQ+LFA   ++  ++ +    +++ +    P++N    +      
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSNN----VKCQLIK 374

Query: 703 LFNKMYMNGGCTVVPSGF----LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQ 758
           L N M +N   +  P G      K C          + QQD  EFL + +N L       
Sbjct: 375 LLNAMKINP--SRYPEGIKPRSFKNCIGQNNKEFTSNKQQDALEFLSYFVNELD------ 426

Query: 759 VNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGY 818
                                    KK F K +   G      + +  ME+ LQC RC +
Sbjct: 427 -------------------------KKLFKKELTNPG-----DLMRCYMEDRLQCLRCKH 456

Query: 819 ESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
              +Y     + L L   + P         + + ++ F   EV+     ++CP C
Sbjct: 457 VKYSYQANESIQLPLKDNNEPQ-------DIRERLDAFFKGEVI----EFNCPHC 500

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGIT 1065
            YKL  +V H G  + SGHY + + K     + +  ++W  ++DE +        V    T
Sbjct: 707  YKLTGVVCHKGTSVHSGHYVAFIKK-----IVDNVERWVLYNDEKI--------VLGDDT 753

Query: 1066 KVSSKNVYVLFYERVD 1081
                KN Y+ FY RV+
Sbjct: 754  AEIKKNGYIYFYSRVE 769

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           GL N+G+TC+++ +LQ+L     + N  +   +  Y M  + N  S  S     +  + Y
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTH--YNMCQSKNPLSCTSCALDLIITEFY 195

Query: 709 M--NGGCTVVPSGFLKICNFLRPDLRIPDD-----QQDTQEFLLFILNRLHDE 754
              + G     +GF+ + N L   L++ ++     QQD  EFL FILN++H++
Sbjct: 196 ATESKGNNSSHTGFISLLNSL---LQVNENFAGYSQQDAHEFLQFILNQIHND 245

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 50/115 (43%), Gaps = 27/115 (23%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDL---TKKNDAVVSYPLVLNIVLKNEEI---------- 1004
            IK +    L  +L+  L RF + L   T K +  + YPL LN+    +            
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 1005 ------VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
                  + Y+L SI++H G +  GHY  +V  +        + +W+ F+D +V A
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVVVKVN--------DGQWFKFNDSMVSA 471

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 51/126 (40%), Gaps = 12/126 (9%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGK--YREYQMKPNDNKESAISNTFANLFNK 706
           G +N+GNTCY+N  LQ+L+ T++++ + +  K   +     P D     I       F  
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFEN 171

Query: 707 MYMNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFLLFILNRLH----DELS 756
           +      +V+P   L +     P     D       QQD +E    + +       D+ S
Sbjct: 172 LEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLFHTFSIVFGDKFS 231

Query: 757 NQVNVI 762
           N   ++
Sbjct: 232 NDFTIL 237

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  I+ H G N  SGHY + +  +      N E KWY F+D+   VV+ EK       
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDE------NDENKWYKFNDDKVTVVEKEKIEALAGG 486

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 487  G----ESDSALILMYK 498

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 26/130 (20%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-----LKNEEI--VRY 1007
            IK      LP +L++ L RF + +   N   +  V YPL LN+        N+E   + Y
Sbjct: 347  IKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIY 406

Query: 1008 KLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKV 1067
            +L  I++H G++  GHY  +        L   + +W+ F+D ++   K     D+ +   
Sbjct: 407  ELTGILSHIGSINEGHYVVV--------LKINDGRWFKFNDSMISVIKE----DEAL--- 451

Query: 1068 SSKNVYVLFY 1077
              +  Y+LFY
Sbjct: 452  -KQQAYLLFY 460

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 30/132 (22%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-------LKNEEIVRY 1007
            IK +    LP VL++ L RF + +   N   +  ++YP  LN+         ++   + Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 1008 KLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITK- 1066
            +L ++++  G++  GHYT +  K P         +W+ F+D ++ +          IT+ 
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC-KVP-------GGQWFRFNDTMIVS----------ITEE 435

Query: 1067 -VSSKNVYVLFY 1077
             V  +  Y+LFY
Sbjct: 436  DVLRQQAYLLFY 447

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 89/241 (36%), Gaps = 56/241 (23%)

Query: 646 SVTGLRNLGNTCYINCMLQSLFAT-NELKNLFISGKYREYQMKPNDNKESAISNTFANLF 704
            + GL N+G+TC+++ ++Q+L      LK       Y    ++ +       S+ F+   
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSRCDIQDS-------SSCFSCAL 186

Query: 705 NKMYMN-------GGCTVVPSGF--LKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDEL 755
           +++ MN          T    GF  L +C++          QQD  EFL F LN+LH + 
Sbjct: 187 DQIVMNFYGPTSDATFTSQQRGFVDLLLCSWKTNKNLAGYSQQDAHEFLQFFLNQLHAD- 245

Query: 756 SNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQR 815
                               + V +   K         N    +   FQG + +++ C  
Sbjct: 246 -------------------HVRVAQTNVK-------AENCNCILHTAFQGSLRSSILCTD 279

Query: 816 CGYES-VNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG 874
           C   S + +     LSL +   S           L +C+  F   E LT  N   C  CG
Sbjct: 280 CQDGSNITFDPMMDLSLDIKNKST----------LVECLQSFHKGERLTDFNH-HCSSCG 328

Query: 875 S 875
           S
Sbjct: 329 S 329

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 58/139 (41%), Gaps = 34/139 (24%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-------------LK 1000
             IK +    LP VL++ L RF + L   N   D  + +P  LN+              + 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 1001 NEEI--VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHG 1058
            N ++  + Y+L  IV+H G +  GHY +            +  +W+ F+D +V +     
Sbjct: 405  NGKVPDIIYELIGIVSHKGTVNEGHYIAFCKI--------SGGQWFKFNDSMVSSISQE- 455

Query: 1059 NVDKGITKVSSKNVYVLFY 1077
                   +V  +  Y+LFY
Sbjct: 456  -------EVLKEQAYLLFY 467

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 29/130 (22%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKES---------AISN 698
            G +N+GNTCY+N  LQ+L+  N+L+ + ++  Y   Q   N+  +           +  
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLREMILN--YNPSQGVSNNGVQDEETHKQIVIEMKR 166

Query: 699 TFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFLLFILNRLH 752
            F NL NK +     +V+P   L       P     D       QQD +E        L 
Sbjct: 167 CFENLQNKSFK----SVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAEE--------LF 214

Query: 753 DELSNQVNVI 762
            +LS+ +NV+
Sbjct: 215 TQLSHSMNVV 224

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+   VV+ EK       
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVVEKEKIESLAGG 483

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 484  G----ESDSALILMYK 495

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 62/166 (37%), Gaps = 43/166 (25%)

Query: 948  HKMKSKKLVTIKTINFIS-LPKVLIIHLSRFYY--------------------------- 979
            +K  S   V  K   FI  LP+VL+I L RF +                           
Sbjct: 679  YKADSGNDVEAKKQAFIDRLPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWI 738

Query: 980  ----DLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHH 1034
                DLT   +A+ S   +    L ++    YKL  +V H G +   GHYT+ V      
Sbjct: 739  KYDHDLTIPKEALSS---INAKFLFSDNDTSYKLTGVVYHHGLSSSGGHYTADV------ 789

Query: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             L   E+KWY  DD  V        V  G     S+  Y+L Y+R 
Sbjct: 790  -LHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTAYILIYQRA 834

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 22/114 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYD-----LTKKNDAVVSYPLVLNIVLKNEEIVR------- 1006
            K + F S P VL + L RF YD     L K ND    +P  +++    +  V+       
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRH-EFPESIDLSPYLDPDVKDNYPNTC 437

Query: 1007 -YKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE-VVKAEKTHG 1058
             Y L+ ++ H+G++ +GHY +++         N   +W+ FDD+ V K  KT  
Sbjct: 438  IYNLHCVLVHSGDISAGHYYAMIKP-------NVTDQWFRFDDDKVWKVTKTQA 484

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTF 700
           G +N G TCY+N +LQS F T   + +    K       PND+   A+  +F
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMVY--KIPSDNESPNDSVSLALQRSF 252

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 149/387 (38%), Gaps = 107/387 (27%)

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q+D +EFL  +L++LH+EL                                        +
Sbjct: 592  QEDAEEFLTHLLDQLHEEL----------------------------------------V 611

Query: 797  SPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLA-LPKPSAPAFYKSGRVKLEDCINM 855
            S +D +   +++N LQ       S+N  +  +  +  LP+     F  +   KL++ IN 
Sbjct: 612  SSIDCLTDNEIQNLLQ-------SINDESLKIFIVRNLPRYKKADFITNISPKLKELINK 664

Query: 856  F-TSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFG-------- 906
            +  +++  + +N W      SK  +   T+   T  ++P SP     S  FG        
Sbjct: 665  YGAANDDTSSDNEWFEVSGSSKKGKKNKTAAKRTVEVIP-SPI----SNLFGGQFRSVLD 719

Query: 907  LPTGK-AISRSKSPFRKLGLLEKHEGKQEKLDKMER--DEIEEWH----KMKSKKLVTIK 959
            +P  K + S +  PF+ + L    +    K++ +E    +  E+     +  +   V  K
Sbjct: 720  IPNNKESQSITLDPFQTIQL----DISDPKVNDLESAFKQFSEYELLPFRTSNGTDVEAK 775

Query: 960  TINFI-SLPKVLIIHLSRFYYDLTKKNDAVVS-----------------------YPL-- 993
               FI  LP+VL+I L RF +      D+ +S                        P+  
Sbjct: 776  KQTFIDKLPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIES 835

Query: 994  VLNIVLKNEEIVRYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVK 1052
            V +  L+++    YKL  ++ H G+    GHYT+    D  H   N   KWY  DD  + 
Sbjct: 836  VSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTA----DVFHQQTN---KWYRIDDVNIS 888

Query: 1053 AEKTHGNVDKGITKVSSKNVYVLFYER 1079
              K    +D     + ++  Y+L YE+
Sbjct: 889  ELKNDHVLDADDNDMGTRTAYILIYEK 915

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 23/30 (76%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFI 677
            G +N+GNTCY+N  LQ+L+  N+L+++ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLRDMIL 138

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+   VV+ EK       
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVVEKEKIESLAGG 483

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 484  G----ESDSALILMYK 495

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 954  KLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNI---VLKNEEIV--- 1005
            K   +K    +  P+VL+IHLSR  ++ T   +N   V++  +L +   V++N+  V   
Sbjct: 457  KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 1006 --RYKLYSIVNHTGNLISGHY 1024
               Y+L +IV H G+   GHY
Sbjct: 517  SVNYELKAIVKHAGSHSQGHY 537

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 64/162 (39%), Gaps = 37/162 (22%)

Query: 948  HKMKSKKLVTIKTINFIS-LPKVLIIHLSRF-YYDLTKKNDAVVSYPLVLNIVLKNEEIV 1005
            +K  S   V  K   F+  LP+VL+I L RF + + + +   +++Y      + K  + +
Sbjct: 635  YKADSGNDVEAKKQAFLDRLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWI 694

Query: 1006 R---------------------------YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLG 1037
            R                           Y+L  +V H G +   GHYT+ V       L 
Sbjct: 695  RYDQELTIPKEALSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV-------LH 747

Query: 1038 NTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
             T+ KWY  DD  V   +      +G     SK  Y+L Y+R
Sbjct: 748  QTQDKWYRIDDNNVTEIRQEDVFKRGDEASDSKTAYILIYQR 789

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 32/137 (23%)

Query: 957  TIKTINFISLPKVLIIHLSRFYYDLTKKN---DAVVSYPLVLNIV-----------LKNE 1002
             IK +    LP VL++ L RF + L   N   D  + +P  LN+             +N 
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENG 404

Query: 1003 EI--VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNV 1060
            ++  + Y+L  IV+H G +  GHY +            +  +W+ F+D +V +       
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCKI--------SGGQWFKFNDSMVSSISQE--- 453

Query: 1061 DKGITKVSSKNVYVLFY 1077
                 +V  +  Y+LFY
Sbjct: 454  -----EVLKEQAYLLFY 465

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    LP +L +HL RF Y   +K++      + YPL L++    +  V  +Y+L  +
Sbjct: 545  RIVGLKQLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGV 604

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY  +          N +  W  +DDE V++ +    +           
Sbjct: 605  VIHMGSGPQHGHYVCICK--------NEKFGWLLYDDETVESIREETVLQFTGHPGDQTT 656

Query: 1072 VYVLFYE 1078
             YVLFY+
Sbjct: 657  AYVLFYK 663

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 11/78 (14%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDN--KESAISNTFANLF 704
           V G  N GNTCY N +LQ L+   E +   +     +Y  KP  N  ++S +  + A +F
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFRCNIL-----QYPEKPATNRIRKSDLKGSKARIF 187

Query: 705 N----KMYMNGGCTVVPS 718
                +  +NGG T   S
Sbjct: 188 TNESFETSVNGGNTKCES 205

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 14/76 (18%)

Query: 1006 RYKLYSIVNHTGNLI-SGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGI 1064
            +YKL S+V H GN + SGHY + + K+    + N E+   Y D+++V AE          
Sbjct: 186  KYKLTSVVCHKGNSVQSGHYVAFIKKE----IENVERWVLYNDEKIVIAED--------- 232

Query: 1065 TKVSSKNVYVLFYERV 1080
             +  SKN Y+  Y RV
Sbjct: 233  LEELSKNGYIYIYSRV 248

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 34/137 (24%)

Query: 737 QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            QD  EFL ++LN L D L   +               ++  DK + K  F         
Sbjct: 400 HQDAHEFLNYLLNELSDTLKRDM---------------ELDTDKLESKPTF--------- 435

Query: 797 SPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMF 856
             ++ +F+G + N+ +C  C   +     F    + +         +   +K++D +N +
Sbjct: 436 --IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEI--------QEDEEIKIQDILNNY 485

Query: 857 TSDEVLTGENAWDCPKC 873
              E+LTG N + C KC
Sbjct: 486 KHRELLTGANKFYCDKC 502

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 46/102 (45%), Gaps = 15/102 (14%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            +T+   SLPK L IHL RF Y   +  +A     + YPL L +    +  V   Y+L  I
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 1013 V-NHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
            V +  G    GHY ++   D           W  FDDE V++
Sbjct: 570  VIHMGGGPHHGHYVAICKNDLF--------GWLLFDDETVES 603

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 25/108 (23%)

Query: 958  IKTINFISLPKVLIIHLSRFYYDL----TKKNDAVVSYPLVLNI--------VLKNEEIV 1005
            I+ +    LP VL++ L RF + +     K ND  +S+PL LN+         L     +
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKIND-YISFPLHLNMKDYCKPVDCLHPVPNM 407

Query: 1006 RYKLYSIVNHTGNLISGHYTSL--VNKDPHHNLGNTEQKWYYFDDEVV 1051
             YKL +I++H G +  GHYT++  +N D           W  F+D +V
Sbjct: 408  MYKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMV 445

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 25/34 (73%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFI 677
           A +  G +N+GNTCY+N  LQ+L+  ++L+++ +
Sbjct: 105 AETPVGFKNMGNTCYLNATLQALYRVDDLRDMIL 138

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+   VV+ EK       
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVVEKEKIESLAGG 483

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 484  G----ESDSALILMYK 495

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 25/34 (73%)

Query: 644 AYSVTGLRNLGNTCYINCMLQSLFATNELKNLFI 677
           A S  G +N+GNTCY+N  LQ+L+  ++++++ +
Sbjct: 105 AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMIL 138

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA 1053
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+ V A
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVTA 472

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELK 673
           RN TL   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+
Sbjct: 710 RNSTLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLR 761

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 28/137 (20%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNL--FISGK-------------------YREYQMK 687
           G+ N GN C+++ +LQ L       NL   IS K                   YR++  +
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 688 PNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRP--DLRIPDDQQDTQEFLL 745
             + ++++ S++  N+ + +       + P  F K  + L    DLR    Q+D +EFL 
Sbjct: 408 AFEREKASRSSSGVNISSAL----ADAIKPDDFYKTLSKLPKFKDLRW-GHQEDAEEFLT 462

Query: 746 FILNRLHDELSNQVNVI 762
            +L++LH+E  N ++ +
Sbjct: 463 HLLDQLHEEFVNSIDSL 479

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 58/160 (36%), Gaps = 35/160 (21%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLK------- 1000
            K  S   V  K   FI  LP+V +I L RF +        +V+Y      V K       
Sbjct: 629  KTSSGNNVEAKKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHY 688

Query: 1001 -------------------NEEIVRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTE 1040
                                E    YKL  +V H G   S GHYT  V ++       T 
Sbjct: 689  GHELAIPDATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQE-------TL 741

Query: 1041 QKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             KWY  DD  V+  +    +  G     S+  Y+L Y+++
Sbjct: 742  NKWYRIDDTNVQEIEKDEVLKGGEEGNDSRTAYILIYQKL 781

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGK 680
           RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+   +   
Sbjct: 710 RNSNLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLRRYIL--- 765

Query: 681 YREYQMKPNDNKESAISNT 699
             EYQ K  DN    +SN+
Sbjct: 766 --EYQ-KTLDNFNDHLSNS 781

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 98/512 (19%), Positives = 182/512 (35%), Gaps = 139/512 (27%)

Query: 645  YSVTGLRNLGNTCYINCMLQSLFAT-------NELKNLFISGKYREYQMKPNDNKESAIS 697
            Y+  GL N GN C+I   LQ+L          N +K++       E +      +E+  +
Sbjct: 55   YTTVGLINRGNDCFITSALQALAGIPRFVEYLNGIKSILQELNNPELKSFSRSTRENPTA 114

Query: 698  NTFANLFNKMYMNGGCTVVPSGFLKICNFL----------RPDL-----------RIPDD 736
            +  AN       +   T +    +++   L           P +           ++   
Sbjct: 115  DNIANDSRLENFSDSSTPLHESLMRLIADLVSVRESKMTISPKIVVNALESIFKSKMSSK 174

Query: 737  QQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGL 796
            Q D  EF + +L  L +E S  V                      K+ K      V N  
Sbjct: 175  QNDAHEFTVILLQTLQEEHSRLV----------------------KHTKHMLNVDVPNF- 211

Query: 797  SPVDGVFQGQMENALQCQRC-GYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINM 855
             P    F+G+    L C +C G   +++   ++  L++P+ S+           E+ +++
Sbjct: 212  -P----FEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQKSS-----------ENLLDI 255

Query: 856  FTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISR 915
             ++DE    E+ + C  C ++A+      R + +   P+        +   L   K  + 
Sbjct: 256  LSNDETEIIED-YSCLICRARAILAHEQYR-NFKDCAPD--------ELLILDALKDYAT 305

Query: 916  SKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLS 975
              S    L L         ++D+      ++   + + K   IK    + LPKVL+IHLS
Sbjct: 306  EASINEDLPL---------EIDQYINHYTKDKFCISNVKGKVIKRDIAVKLPKVLVIHLS 356

Query: 976  RFYYDLT-----------KKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHY 1024
            R  ++             ++   +  Y  + N+ L     + Y L S+V HTG+   GHY
Sbjct: 357  RSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSVVKHTGSHSRGHY 416

Query: 1025 TS----------------------LVNKDPHHNLGNTEQK-------------WYYFDDE 1049
                                    + N++ + N+ N   K             ++   D 
Sbjct: 417  MCYRRKGDILFDKEDESFVDSRSIITNRNHNENITNNHGKRRYKRVKSASQYPYWQISDG 476

Query: 1050 VVKAEKTHGNVDKGITKVSSKNVYVLFYERVD 1081
             +K   T   +++       K  Y+L+YERV+
Sbjct: 477  AIKQRATSTVLNE------QKYAYMLYYERVN 502

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 67/159 (42%), Gaps = 34/159 (21%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRF-YYDLTKKNDAVVSYPLVLNIVLK------ 1000
            K  S   V  K   FI  LP VL+IHL RF + + T K++++ +Y      + K      
Sbjct: 868  KSSSGADVEAKKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKIS 927

Query: 1001 -NEEIV-----------------RYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQ 1041
             N E+V                  Y+L  +V H G +   GHYT+    D +H   +   
Sbjct: 928  YNHELVIPAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTA----DIYHKEVD--- 980

Query: 1042 KWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
            KWY  DD  V   +    +  G     S+  Y+L Y+++
Sbjct: 981  KWYRIDDVTVTELEKDDVLKGGENSTDSRTAYILMYQKL 1019

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 77/200 (38%), Gaps = 49/200 (24%)

Query: 648 TGLRNLGNTCYINCMLQSLF--ATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFN 705
            GL NLGN+CY+N ++QSL           F+  ++    + P +N    +   +  L N
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANN----LKCQWIKLLN 378

Query: 706 ------KMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQV 759
                 K+Y NG   + P+ F K C     +    + QQD  EFL F+L+ L        
Sbjct: 379 AMKHEPKLYANG---IKPTTFKK-CIGKNHEEFSSNRQQDAMEFLTFLLDSLD------- 427

Query: 760 NVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYE 819
                                   + +F     + G S  + + +  ME+ LQC +CG  
Sbjct: 428 ------------------------RNFFSDN--SAGASNPNDLMRFMMEDRLQCNKCGKV 461

Query: 820 SVNYSTFYVLSLALPKPSAP 839
             +Y     + L L +   P
Sbjct: 462 KYSYEPAEAIQLPLKENDEP 481

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 71/145 (48%), Gaps = 34/145 (23%)

Query: 951  KSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDA------VVSYPLVLNIVLKNEEI 1004
            +++++V IK      LPK+L +HL RF Y  +++N+A       ++YP  L++    +  
Sbjct: 539  EAERIVGIK-----HLPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRS 591

Query: 1005 V--RYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVD 1061
            +  +Y+L  I+ H G     GHY ++   +           W  +DDE V+A      ++
Sbjct: 592  ISKKYELSGIIIHLGAGPQHGHYVAMCKTEKF--------GWLLYDDETVEAV-----LE 638

Query: 1062 KGITK-VSSKN----VYVLFYERVD 1081
            K + + V   N     Y+LFY+ ++
Sbjct: 639  KDVLRHVGDSNDLATAYILFYKTIE 663

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFI 677
           V G  N GNTCY N +LQ L+  +EL++  I
Sbjct: 126 VFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 92/245 (37%), Gaps = 65/245 (26%)

Query: 803  FQGQMENALQCQRCGYES-VNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEV 861
            F GQ+ + L C +C   S VN   F +  L +P+  +         KL D ++   +D +
Sbjct: 298  FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQAMS--------AKLSDMVSDNQTDTI 349

Query: 862  LTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISR-SKSPF 920
                  + C  C                          K S       G+  ++ ++   
Sbjct: 350  ----EGYSCLTC--------------------------KVSTIVNYEKGRGYAKCTQEEK 379

Query: 921  RKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSK--------KLVTIKTINFISLPKVLII 972
            R L  LE         D++  DE+  +    +K        K   +K    +  PK L++
Sbjct: 380  RILKTLEDALPDMAINDELS-DELTSYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVM 438

Query: 973  HLSRFYYDLT--KKNDAVVSYPLVLNIVLKNEEIVR-----------YKLYSIVNHTGNL 1019
            HLSR  +D    ++N   V++  +L      E+++R           YKL +IV H+G+ 
Sbjct: 439  HLSRSMFDGISYQRNSCGVAFDEILE---SREQVIRHNKCVGINPISYKLKAIVAHSGSH 495

Query: 1020 ISGHY 1024
              GHY
Sbjct: 496  SQGHY 500

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 43/109 (39%), Gaps = 6/109 (5%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           GL+N+GNTCY+N  LQ+L+    L+   ++   +      +D     +       F ++ 
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFPADDESHFLLVQELKRCFQQLK 164

Query: 709 MNGGCTVVPSGFLKICNFLRPDLRIPDD------QQDTQEFLLFILNRL 751
                +V P   L +     P     D       QQD +E    + + L
Sbjct: 165 DKPQESVTPILLLSVLRRCYPQFAERDSQSGFYKQQDAEELFTQLFHSL 213

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY + +  +   N      KWY F+D+   V++ EK       
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDEN------KWYKFNDDKVSVIEKEKIESLAGG 476

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 477  G----ESDSALILVYK 488

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 10/86 (11%)

Query: 949  KMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLT--KKNDAVVSY--PLVLN-IVLKNEE 1003
            K    K   +K    +  P VLI+HLSR  +D    +KN   VS+   LV+N  V++N +
Sbjct: 430  KTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNK 489

Query: 1004 IV-----RYKLYSIVNHTGNLISGHY 1024
             V      YKL S++ H G+  +GHY
Sbjct: 490  CVGIRKDSYKLRSMLRHQGSHSTGHY 515

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 19/111 (17%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELK---------------NLFISGKYREYQMKPNDNK 692
           TGL N+GNTCY+N +LQ  FA + L+               NL + G  R    +  +  
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRVGGRVTNTI 806

Query: 693 ESAISNTFA----NLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQD 739
           E   S  F     +LF++M  +    V P   L    F   ++ +  D +D
Sbjct: 807 EVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSED 857

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (46%), Gaps = 19/129 (14%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLK-NEEI-VRYKLYSI 1012
            + +    LPK L +HL RF Y   +  +      V+YPL L++    N  I  RY+L  I
Sbjct: 952  RIVGLKQLPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGI 1011

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVK--AEKTHGNVDKGITKVSS 1069
            V H G     GHY ++   D     G     W   DDE V+  +E+T     KG +K  +
Sbjct: 1012 VVHMGGGPQHGHYVAICKNDK---FG-----WLLMDDETVETISEETVLRC-KGDSKDLT 1062

Query: 1070 KNVYVLFYE 1078
               YVLFY+
Sbjct: 1063 T-AYVLFYK 1070

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 12/55 (21%)

Query: 631 SIPTIEKN-------SNPYVAYS-----VTGLRNLGNTCYINCMLQSLFATNELK 673
           +I TI+ N       +NP + +      V G  N GNTCY N +LQ L+    L+
Sbjct: 487 TITTIDHNHSALQPRTNPLIPFGDGSNKVFGYENFGNTCYCNSVLQCLYNMTNLR 541

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 47/117 (40%), Gaps = 18/117 (15%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFIS--GKYREYQMKPNDNKES------AISNTF 700
           G +N+GNTCY+N  LQ+L+    L+ L +S  G         +   ES       +   F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 701 ANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD------QQDTQEFLLFILNRL 751
            NL NK +     +V+P   L       P     D       QQD +E    + + L
Sbjct: 169 QNLKNKSFK----SVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSL 221

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            Y+L  ++ H G N  SGHY S +  D        E KWY F+D+ V
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDD------YDEDKWYKFNDDKV 470

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 62/144 (43%), Gaps = 21/144 (14%)

Query: 626 LTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           ++ K  IP + K         ++GL N+G+TCY++C++Q L        L  S     ++
Sbjct: 121 VSSKSCIPLMSKRD------GLSGLVNMGSTCYVSCIIQCLVRNPYF--LKYSLNQSHFK 172

Query: 686 MKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLK-----ICNFLRPDLRIPDD---- 736
           +    +  + IS    ++    Y   G + +     K     + + L    +I  +    
Sbjct: 173 ICKTHDPTTCISCALDSIVTDFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGY 229

Query: 737 -QQDTQEFLLFILNRLHDELSNQV 759
            QQD  EF  F+LNRLH E  + +
Sbjct: 230 SQQDAHEFWQFLLNRLHSEYKSNI 253

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 23/107 (21%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLT----KKNDAVVSYPLVLNI-----VLKNEEI----- 1004
            K +    L  VL+    RF + L+    K ND V+ +PL LN+     V + ++      
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLND-VIEFPLYLNMKDYCDVEQRDDSNSKPD 403

Query: 1005 VRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVV 1051
            + Y+L  I+ HTG +  GHYT++  K P       E +W  F+D +V
Sbjct: 404  LIYELIGIICHTGTVNEGHYTAIC-KIP-------EGQWIKFNDSMV 442

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    +P +L +HL RF Y   + ++      + YPL L++    +  V  RY+L  +
Sbjct: 550  RIVGLKQVPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGV 609

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY  +          N +  W  +DDE V++      +           
Sbjct: 610  VIHMGSGPQHGHYVCICK--------NEKFGWLLYDDETVESVSEETVLKFTGHSGDQTT 661

Query: 1072 VYVLFYERV 1080
             YVLFY+ +
Sbjct: 662  AYVLFYKEI 670

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 42/156 (26%)

Query: 956  VTIKTINFIS-LPKVLIIHLSRF-YYDLTKKNDAVVSY--------PLVLNIVLKNEEIV 1005
            V  K   FI  LP+VL+I L RF + + T K++++V+Y         +   I  ++E I+
Sbjct: 682  VEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELII 741

Query: 1006 ----------------RYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDD 1048
                            RY L  ++ H G +   GHYT+    D +H   +   KWY  DD
Sbjct: 742  PIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTA----DVYHRESD---KWYRIDD 794

Query: 1049 ----EVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
                E+ K +   G  + G     S+  Y+L Y+++
Sbjct: 795  VSIIELEKEDVLKGGEESG----DSRTAYILMYQKI 826

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 38.9 bits (89), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%)

Query: 612 KLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNE 671
           K+ +  +   RN  L   F    I   S   VA    G+ N+GNTCY+N +LQ  F    
Sbjct: 662 KMALQNIGFTRNSKLINHFLDTGIVDVSCLPVATWPAGINNVGNTCYLNSLLQFFFTIKP 721

Query: 672 LKNLFIS 678
           L++  ++
Sbjct: 722 LRDFILN 728

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFIS 678
           RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L++  ++
Sbjct: 710 RNSNLITNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAIS 697
           TG+ N+GNTCY+N +LQ  FA + L+   +  +Y++     + N +S IS
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV--QYQKTIADLSSNPDSIIS 769

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFIS 678
           GL N+GNTCY+N +LQ  FA   L+N   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNEL 672
           + GL N GNTC++NC+LQS+ ++ EL
Sbjct: 84  IGGLVNDGNTCFMNCVLQSMASSKEL 109

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 44/110 (40%), Gaps = 6/110 (5%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMY 708
           G+ N+GNTCY+N  LQ L+    L+   ++   ++   +  D     +       F K+ 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRKLR 120

Query: 709 MNGGCTVVPSGFLKICNFLRPDLRIPD------DQQDTQEFLLFILNRLH 752
              G  + P   L+I   + P     D       QQD +E    + + + 
Sbjct: 121 DKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQ 170

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 83/427 (19%), Positives = 154/427 (36%), Gaps = 115/427 (26%)

Query: 645  YSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFAN-- 702
            Y+  GL N GN C+I   LQ L             K    ++K N ++++ + N   +  
Sbjct: 50   YTTVGLINRGNDCFITSSLQGLAGMPRFVEYLKQIKSILQELKSNPSRKAKVDNLIVDDV 109

Query: 703  LFNKMYMNGGCTVVP---SGFLKICNFLR---------PDL-----------RIPDDQQD 739
            +    + N   ++ P   S    I + +          P +           ++   Q D
Sbjct: 110  VSCIRFRNSPDSLAPLHESLMALIFDLVSVRESKKSVSPQMVINTLEAIFKSKMSSRQND 169

Query: 740  TQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPV 799
              E  L +L  L  E SN V                       Y ++  +  + N     
Sbjct: 170  AHECTLLMLQTLQKERSNLVG----------------------YTQYMPEINIPNF---- 203

Query: 800  DGVFQGQMENALQCQRC-GYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTS 858
               F+G+    L C +C G    +Y   ++  L++P+ ++           E  + +  +
Sbjct: 204  --PFEGETSKFLVCLQCKGLSKPSYQQTFIRELSVPQQTS-----------EKLLTILAN 250

Query: 859  DEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKS 918
            DE    E+ + C  C  +A+                   +H++ + F   T +       
Sbjct: 251  DETEIIED-YSCSICQIRAI------------------LNHERYRNFKDCTPE------- 284

Query: 919  PFRKLGLLE--KHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTIN--------FISLPK 968
               +L ++E  K+   +  +++    E+E++ K  SK  + I  +          + LP 
Sbjct: 285  ---ELLMIEALKNYATKASINEDLPPELEQYIKRYSKDKLHISKVKGKIIKKDVAVQLPD 341

Query: 969  VLIIHLSRFYYDLTK--KNDAVVS---------YPLVLNIVLKNEEIVRYKLYSIVNHTG 1017
            +L++HLSR  ++     +N   V          Y L  N  +     V+Y L S+V HTG
Sbjct: 342  ILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSVVKHTG 401

Query: 1018 NLISGHY 1024
            +   GHY
Sbjct: 402  SHSRGHY 408

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 622 RNQTLTRKFSIP-TIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELK 673
           RN  L   F +  TI+ NS P   +  TG+ N+GNTCY+N +LQ  F+   L+
Sbjct: 709 RNSNLISNFLLTGTIDPNSLPPENWP-TGINNIGNTCYLNSLLQYYFSIAPLR 760

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 958  IKTINFISLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNI--------VLKNEEIVRY 1007
            IK    I  P  LI+HLSR  ++     ++   V Y   LN+          +  E ++Y
Sbjct: 328  IKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKY 387

Query: 1008 KLYSIVNHTGNLISGHY 1024
            +L S+V HTG+ + GHY
Sbjct: 388  ELKSVVKHTGSHVQGHY 404

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 85/231 (36%), Gaps = 53/231 (22%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELK---NLFISGKYREYQMKPNDNKESAISNTFANLF 704
           TGL N  N C++N  LQ+L     L    N F+   +   + +  + +   ++   ANL 
Sbjct: 75  TGLLNARNDCFLNSSLQALVPIESLTTYLNQFVEALHSVDEGQVFELER--LAPLHANLI 132

Query: 705 NKMYMNGGCTVVPSGFLK--ICNFLRPDLR--IPDDQQDTQEFLLFILNRLHDELSNQVN 760
             ++      V P       I   L   LR  +  DQ D  EF   +L  LH E      
Sbjct: 133 KLLHELQSLIVKPQTVSAKNIVKTLEDTLRRKMSSDQNDAHEFTQILLETLHSE------ 186

Query: 761 VIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCG-YE 819
                                 Y K   ++ +  G  P    F+G   N L C +C  Y 
Sbjct: 187 ----------------------YIKL--QSNIEIGSFP----FEGVSSNYLMCLQCNKYS 218

Query: 820 SVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDC 870
              +S F +L +A+P   +         KL D I + + DE++ G +   C
Sbjct: 219 QTIHSPFLMLEVAVPGNYSE--------KLTDLI-LHSQDEIIEGYSCLYC 260

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 86/211 (40%), Gaps = 50/211 (23%)

Query: 635 IEKNSNPYVA-YSVTGLRNLGNTCYINCMLQSLFATNELKN-LF--ISGKYREYQMKPND 690
           I KN  PY+      GL N G TCY N  +Q++     +++ LF  + GK+ + ++ P+ 
Sbjct: 277 IVKNWGPYLTNLRPKGLLNHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKHSD-KVSPD- 334

Query: 691 NKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPD--------DQQDTQE 742
               ++S  FA +  +M+     +      L+  N  +   R+ D         Q+D+ E
Sbjct: 335 ----SVSYAFAEITKRMWSPQDKSKKKRQSLQYINPKKLIARLDDINCMMSVWQQEDSHE 390

Query: 743 FLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGV 802
           + + +++RL ++   + + +             ++ D                      +
Sbjct: 391 YFMSLMSRLQEDSVPRGHKLTES----------ILYD----------------------I 418

Query: 803 FQGQMENALQCQRCGYESVNYSTFYVLSLAL 833
           F G +E  + C+ CG  S     FY LSL L
Sbjct: 419 FGGVLEQVVTCKSCGSISKTEQPFYDLSLHL 449

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 57/131 (43%), Gaps = 17/131 (12%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDAV-----VSYPLVLNIVLKNEEIV--RYKLYS 1011
            + +    LP  L +HL RF Y L +KN        + YPL+L++     + +  +Y+L S
Sbjct: 497  RIVGLKKLPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELIS 555

Query: 1012 I-VNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSK 1070
            I V+  G    GHY S+   D     G     W  FDDE V++      +          
Sbjct: 556  IVVHLGGGPHHGHYVSICKSD---KFG-----WLLFDDETVESINEETVLKFVGDPEDQT 607

Query: 1071 NVYVLFYERVD 1081
              YVLFY  +D
Sbjct: 608  TAYVLFYREID 618

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 36/159 (22%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRF-YYDLTKKNDAVVSY--------------- 991
            K  S   V  K   FI  LP+VL+I L RF + + T K++++++Y               
Sbjct: 644  KSSSGNDVEAKKQTFIDKLPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKIN 703

Query: 992  ---PLVLNI-------VLKNEEIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTE 1040
                L++ I        L++E+  +Y L  ++ H G +   GHYT+    D +H      
Sbjct: 704  YEHELMIPIESISSTNALRDED-RQYSLSGVIYHHGLSSDGGHYTA----DVYHK---ET 755

Query: 1041 QKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYER 1079
             KWY  DD  +   +    +  G   V S+  Y+L Y++
Sbjct: 756  DKWYRIDDINITEVQKDSVLKGGEDGVDSRTAYILMYQK 794

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 19/101 (18%)

Query: 943  EIEEWHKMKSKKLVTIKTIN--------FISLPKVLIIHLSRFYYD-LTKKND------- 986
            E+E++ K  SK  + +  I          + LP +LI+HLSR  ++ +T   +       
Sbjct: 308  EVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFG 367

Query: 987  ---AVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHY 1024
                +  Y L  +  +     V+Y L S+V HTG+  SGHY
Sbjct: 368  ERITLSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHY 408

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 15/129 (11%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    LP +L +HL RF Y   ++++      + YPL L++    +  +  +Y+L  +
Sbjct: 539  RIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGV 598

Query: 1013 VNHTGNLIS-GHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKN 1071
            V H G+    GHY  +          N +  W  +DDE V++ +    +           
Sbjct: 599  VIHMGSGPQHGHYVCICK--------NEKFGWLLYDDETVESIREETVLKFTGHPGDQTT 650

Query: 1072 VYVLFYERV 1080
             YVLFY+  
Sbjct: 651  AYVLFYKET 659

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFI 677
           TGL N+GNTCY+N +LQ  F  + L+   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 64/164 (39%), Gaps = 43/164 (26%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLK------- 1000
            K  S   V  K   FI  LP+VL+I L RF +      D +V+Y      V K       
Sbjct: 620  KSSSGNDVEAKKQTFIDKLPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHY 679

Query: 1001 NEEI-------------------VRYKLYSIVNHTGNLIS-GHYTSLVNKDPHHNLGNTE 1040
            N E+                    +YKL  +V H G   S GHYT+    D +H      
Sbjct: 680  NHELTIPKETISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTA----DVYH---QEM 732

Query: 1041 QKWYYFDD----EVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             KW+  DD    E+ K E   G  D       S+  Y+L Y+++
Sbjct: 733  DKWFRIDDVNIAELNKEEVLKGGED----GFDSRTAYILMYQKI 772

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 23/30 (76%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFIS 678
           G +N+GNTCY+N  LQ+L+  ++L++  ++
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLN 137

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFI 677
           G +N+GNTCY+N  LQ+L+    L+++ +
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMIL 138

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y+L  ++ H G N  SGHY S +  D        E KWY F+D+   VV  EK  G    
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDD------MDEDKWYNFNDDKVSVVPKEKIEGLAGG 478

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 479  G----ESDSALILIYK 490

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 72/181 (39%), Gaps = 43/181 (23%)

Query: 695 AISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDD--QQDTQEFLLFILNRLH 752
           A+ + F  +    +M G   V PS F+ +   LR +  + +    QD  EFL F++N L 
Sbjct: 391 ALKDVFECIAESNHMLG--VVSPSHFVSV---LRKENVLFNSMMHQDAHEFLNFLMNALS 445

Query: 753 DELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQ 812
           D L  Q+  +                  +K  + F  T+           FQG M N+++
Sbjct: 446 DSLQLQLQRL-----------------PDKSPENFIHTL-----------FQGTMNNSIK 477

Query: 813 CQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPK 872
           C  C   + N   F+  ++ + +           + ++D +  F   E+L G N + C  
Sbjct: 478 CLTCDNITSNEEPFFDFAIPVSEDE--------ELNVQDILRDFHQREMLNGANKFYCDS 529

Query: 873 C 873
           C
Sbjct: 530 C 530

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELK 673
           V GL N GNTCY N +LQ L+   EL+
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELK 673
           TGL N+GNTCY+N +LQ  F+ + L+
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELK 673
            GL+NLGNTCY+N  LQ+L+    L+
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLR 131

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 1007 YKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE---VVKAEKTHGNVDK 1062
            Y L  ++ H G N  SGHY S +  +   N      KWY F+D+   V++ EK       
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADEN------KWYRFNDDKVSVIEKEKIESLAGG 479

Query: 1063 GITKVSSKNVYVLFYE 1078
            G     S +  +L Y+
Sbjct: 480  G----ESDSALILIYK 491

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKN 674
           TGL N+GNTCY+N +LQ  F+ + L++
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRD 727

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 56/115 (48%), Gaps = 11/115 (9%)

Query: 648 TGLRNLGNTCYINCMLQSLFA----TNELKNLFISGKYREYQMKPNDNKESAISNTF--A 701
            GL N+GN+CY+N +LQ LF     T +L+ + +  ++    + P++N    +   +   
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDETWTGKLQ-MAVGEEFPTDVVFPSNNLRCQLIKLYRAM 378

Query: 702 NLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELS 756
            L  ++Y  G   + P  F K C     +      QQD  EFL ++++ L  +LS
Sbjct: 379 KLEPELYPQG---IKPQSFKK-CFSAGHEEFASQRQQDAMEFLTYMIDNLDKKLS 429

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFIS 678
            GL N+GNTCY+N +LQ  FA + L+   I+
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 612 KLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNE 671
           K  +  L   RN  L   F +  +   S   V    TG+ N+GNTCY+N +LQ  F+ + 
Sbjct: 716 KCALMKLGLERNSKLINNFLMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISP 775

Query: 672 LKNLFISGKYREYQ 685
           L+  ++ G  + Y+
Sbjct: 776 LRE-YVLGYSKTYE 788

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 46/196 (23%)

Query: 681 YREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKIC---NFLRPDLRIPDDQ 737
           Y    +KPN    +++ + F ++    ++ G   V P+ F++I    N L   +      
Sbjct: 391 YLPSSIKPN--LYTSLRDIFESITENRFLIG--VVSPTSFVEILKRENVLFSTMM----H 442

Query: 738 QDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLS 797
           QD  EFL F+LN L D L  Q++                           D +++    +
Sbjct: 443 QDAHEFLNFLLNELSDSLQRQIS---------------------------DDSIITPNDN 475

Query: 798 PVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFT 857
            +D +F+G M N  +C  C   +     F    + +          +    +++ ++ F 
Sbjct: 476 FIDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPIEV--------NGNCETDIQEMLSDFH 527

Query: 858 SDEVLTGENAWDCPKC 873
             E+L G N + C KC
Sbjct: 528 QKEMLNGSNKFYCDKC 543

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 59/136 (43%), Gaps = 27/136 (19%)

Query: 959  KTINFISLPKVLIIHLSRFYYDLTKKNDA----VVSYPLVLNIVLKNEEIV--RYKLYSI 1012
            + +    LP +L +HL RF Y  T+  +      + YPL L +    +  +  RY+L  I
Sbjct: 551  RIVGLKQLPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGI 610

Query: 1013 -VNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKA------EKTHGNVDKGIT 1065
             V+  G    GHY SL          N +  W  FDDE V++       K  G++    T
Sbjct: 611  VVHMGGGPHHGHYVSLCK--------NEKFGWLLFDDETVESVDESSVMKFCGDLHDLTT 662

Query: 1066 KVSSKNVYVLFYERVD 1081
                   YVLFY+ ++
Sbjct: 663  ------AYVLFYKEIN 672

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 5/39 (12%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQM 686
            GL N+GNTCY+N +LQ  F+   L++  +     +YQM
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL-----QYQM 795

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           TGL N+GNTCY+N +LQ  F  + L+   +     EYQ
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQSIV-----EYQ 735

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 12/119 (10%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMK---PNDNKES---AISNTFA 701
            GL NLGN+CY+N +LQ  F    + N  +     E+ +    P++N +     ++N   
Sbjct: 326 VGLINLGNSCYLNSILQC-FYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMK 384

Query: 702 NLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVN 760
            + + +Y NG   + P+ F K       +    + QQD  EFL ++++ L +++ N  N
Sbjct: 385 -IESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTAN 438

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 42/100 (42%), Gaps = 21/100 (21%)

Query: 648 TGLRNLGNTCYINCMLQSLF---------------ATNELKNLFISGKYREYQM------ 686
           TGL N+GNTCY+N +LQ  F               A++ L N+  SG   + ++      
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRIGGRAVN 755

Query: 687 KPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNF 726
           KP   +         +LFN M  +    V PS  L   +F
Sbjct: 756 KPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSF 795

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKN 674
            GL N+GNTCY+N +LQ  F  + L+N
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 60/159 (37%), Gaps = 34/159 (21%)

Query: 949  KMKSKKLVTIKTINFI-SLPKVLIIHLSRF-----------------YYDLTKKNDAVVS 990
            K  S   V  K   FI  LP++L+I L RF                 Y    +K    +S
Sbjct: 663  KSSSGNDVEAKKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKIS 722

Query: 991  YPLVLNI--------VLKNEEIVRYKLYSIVNHTG-NLISGHYTSLVNKDPHHNLGNTEQ 1041
            Y   L I         L+N     Y+L  ++ H G +   GHYT+    D  H    T  
Sbjct: 723  YGHTLEIPDETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTA----DVFHKQTKT-- 776

Query: 1042 KWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080
             WY  DD  +   +    +  G   + S+  Y+L Y+ V
Sbjct: 777  -WYRIDDVNITKLEDDDVLKGGEDNMDSRTAYILMYQNV 814

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           + GL N GNTC++N +LQSL ++ EL     +   R Y+
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYE 138

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 649 GLRNLGNTCYINCMLQSLFATNELKNLFIS--GKYREYQMKPNDNK 692
           GL N+GNTCY+N +LQ  F+   L+   ++  G    Y++    NK
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYEIDETSNK 756

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 615 IHALHS---PRNQTLTRKF-SIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATN 670
           +HAL      RN +L   F     I+ N  P   +   G+ N+GNTCY+N +LQ  F+  
Sbjct: 677 VHALVEIGLQRNSSLISNFLQTGKIDPNCLPIKDWPA-GINNIGNTCYLNSLLQYYFSIA 735

Query: 671 ELKN 674
            L+N
Sbjct: 736 PLRN 739

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY-QMKPND-NKESA 695
           + GL N GNTC++N +LQSL ++ EL     +   + Y +M+ N+ NKE +
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEEMEQNEHNKEES 150

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFIS 678
           TG+ N+GNTCY+N +LQ  F  + L+   ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 81/230 (35%), Gaps = 55/230 (23%)

Query: 648 TGLRNLGNTCYINCMLQSLF--ATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFN 705
            GL NLGN+CY+N  LQ LF           +        + P +N +S ++     L  
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKE 390

Query: 706 K--MYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIX 763
           +  +Y  G   + P  F K       +      QQD  EF  + ++ L            
Sbjct: 391 EPTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDEL------------ 434

Query: 764 XXXXXXXXXXXKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNY 823
                                   DK +  N     + + +  ME+ LQCQ C    V Y
Sbjct: 435 ------------------------DKKLFKNSDYNPNDLMKFMMEDRLQCQEC--HGVKY 468

Query: 824 STFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKC 873
           ST     + LP   +     +    LE+ IN + S EV+     + CP C
Sbjct: 469 STETSNVIQLPLQES-----NDAQDLEERINAYFSGEVI----EFKCPNC 509

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
            YPL072W
          Length = 495

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 37/78 (47%), Gaps = 16/78 (20%)

Query: 963  FISLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNI--------------VLKNEEIVR 1006
             +  PKVL+IHLSR  Y+     +N   V +  +L +               + +   +R
Sbjct: 326  LLQCPKVLLIHLSRSMYNGMAYTRNPCNVEFENILELEEEQMLQSSPGEKTFINSNSKIR 385

Query: 1007 YKLYSIVNHTGNLISGHY 1024
            Y+L S+V HTG+   GHY
Sbjct: 386  YELKSLVKHTGSHYQGHY 403

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQ 685
           + GL N GNTC++N +LQSL ++ EL +   +   + Y+
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYE 138

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 648 TGLRNLGNTCYINCMLQSLFATNELK 673
           TGL N+GNTCY+N +LQ  F+   L+
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
            (REAL)
          Length = 523

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 97/437 (22%), Positives = 153/437 (35%), Gaps = 118/437 (27%)

Query: 645  YSVTGLRNLGNTCYINCMLQSLFATNELKNLF--ISGKYREYQMKPNDNKESAISNTFAN 702
            Y+  GL N GN C+I   LQSL            I+   RE   KP+   + + +    N
Sbjct: 65   YTTVGLINNGNDCFITSSLQSLAGIPRFVEYLKEINSILREL-YKPDFKFDLSRNEEGEN 123

Query: 703  LFNKMYMNGG-C-------TVVPSGFLKICNFL----------RPDL-----------RI 733
            L     M+   C       T++    L + + L           P L           +I
Sbjct: 124  LTTGEIMDASRCGSQLSLSTILHESLLSLVSDLVSIRENKKTISPKLVVKTLETIFKSKI 183

Query: 734  PDDQQDTQEFLLFILNRLHDELSNQVNVIXXXXXXXXXXXXKMMVDKEKYKKWFDKTVVA 793
               Q D  EF L +L  L +E S  VN              K M D              
Sbjct: 184  SSQQNDAHEFTLVLLQTLQEEHSKLVN------------YTKNMPD-------------- 217

Query: 794  NGLSPVDGVFQGQMENALQCQRCGYESV-NYSTFYVLSLALPKPSAPAFYKSGRVKLEDC 852
              L+     FQGQ    L C +C   S  +Y   ++  L +P+ S+           E  
Sbjct: 218  --LNIPKFPFQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQRSS-----------EKL 264

Query: 853  INMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKA 912
            + +  +DE    E  + C  C  +A+                   +H+K + F       
Sbjct: 265  MKILANDETEIIE-GYSCLICQVRAI------------------LNHEKYRTFK------ 299

Query: 913  ISRSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSK--------KLVTIKTINFI 964
             + S+   R L  L K+      +++    ++E++ K  +K        K   IK    +
Sbjct: 300  -NCSQDELRILDAL-KNYANDASINEDLPIKVEQYIKHYAKDKLRTSNVKSTVIKKDIAV 357

Query: 965  SLPKVLIIHLSRFYYD--LTKKNDAVVSYPLVLNIVLKNE---------EIVRYKLYSIV 1013
             LP+VL+IHLSR  ++     +N   V +   + +                + Y L S+V
Sbjct: 358  QLPEVLVIHLSRSTFNGMTYTRNPCNVEFEETIKLAEYTSIEKGPSAEYRQIEYHLKSVV 417

Query: 1014 NHTGNLISGHYTSLVNK 1030
             HTG+   GHY    +K
Sbjct: 418  KHTGSHSRGHYVCYRSK 434

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 18/132 (13%)

Query: 103 LNMTNVIAMVKEEVAQIQEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAY 162
           ++  N   MV +   QI +Q DN  +   V  + P  N L       NQ    I R    
Sbjct: 549 ISQPNATPMVLQPALQINDQSDNPLN---VKHTAPSINQLTS-----NQSAMSIDRIQQQ 600

Query: 163 SISSPSGMSTLSLHDELPEHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNI 222
            ++  +  ST S+   LP+ RS + T+ PS+       +  D  L K+Q      PI+N+
Sbjct: 601 PLAKLNNPSTESI---LPQKRSNEPTKMPSI-------LTNDEPLNKRQKENTMAPISNL 650

Query: 223 NQPRKSLDVTLN 234
             P  + + T N
Sbjct: 651 TNPTANSNATAN 662

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 954  KLVTIKTINFISLPKVLIIHLSRFYYDLTK--KNDAVVSYP----LVLNIVLKNEEI--- 1004
            K   +K    +  P++LIIHLSR  ++     +N   V++     L   I+ KN+ +   
Sbjct: 440  KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 1005 -VRYKLYSIVNHTGNLISGHY 1024
             V+Y+L + V H G   +GHY
Sbjct: 500  NVKYRLRATVRHQGTHSAGHY 520

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 967  PKVLIIHLSRFYYDLTK--KNDAVVSYPLVLNI---VLKNEEIV-----RYKLYSIVNHT 1016
            P++LI+HLSR  ++ T   +N   V++   L+     ++N   V     +YKL S+V H 
Sbjct: 445  PEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKYKLKSMVKHQ 504

Query: 1017 GNLISGHY 1024
            G    GHY
Sbjct: 505  GTHSQGHY 512

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNEL 672
           V GL N GNTC+IN ++QSL ++ EL
Sbjct: 87  VGGLVNDGNTCFINSVIQSLASSREL 112

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
            (UBP3) - Ubiquitin-specific protease [contig 231] PARTIAL
          Length = 444

 Score = 35.0 bits (79), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 55/142 (38%), Gaps = 34/142 (23%)

Query: 966  LPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVR------------------- 1006
            LP+V +I L RF +        VV+Y      V K  + +R                   
Sbjct: 310  LPEVFLIQLKRFSFINNTDKSKVVNYNAYSGRVEKIRKKIRFGSELTIPSSAISSVHANF 369

Query: 1007 -------YKLYSIVNHTGNLISG-HYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHG 1058
                   YKL  +V H G   SG HYT  V ++        ++KW+  DD  V+  +   
Sbjct: 370  YKESGSTYKLIGVVYHHGVSSSGGHYTCDVYQE-------AQKKWFRIDDINVQEIEMEE 422

Query: 1059 NVDKGITKVSSKNVYVLFYERV 1080
             +  G     S+  Y+L Y+++
Sbjct: 423  VLQPGEEGSDSRTAYILIYQKL 444

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNELKNLF 676
           + GL N GNTC++N +LQSL ++ EL +  
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 647 VTGLRNLGNTCYINCMLQSLFATNEL 672
           V GL N GNTC++N +LQSL +++E+
Sbjct: 34  VGGLVNEGNTCFMNSVLQSLASSHEI 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 120,261,874
Number of extensions: 5751915
Number of successful extensions: 21111
Number of sequences better than 10.0: 338
Number of HSP's gapped: 21345
Number of HSP's successfully gapped: 563
Length of query: 1081
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 961
Effective length of database: 39,721,479
Effective search space: 38172341319
Effective search space used: 38172341319
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)