Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06655g5.709ON42442422300.0
NCAS0G002005.709ON4383329891e-131
NDAI0F002405.709ON4643229641e-127
TDEL0B021105.709ON3894049451e-125
ZYRO0B16478g5.709ON3914009451e-125
KLTH0E00880g5.709ON3713569411e-124
AFR293C5.709ON3653239301e-123
SAKL0E15070g5.709ON3853149251e-122
Kwal_55.196615.709ON3713409211e-121
Kpol_2001.775.709ON4133779221e-121
Skud_9.155.709ON4023539101e-119
Ecym_40125.709ON3953239051e-119
YIL153W (RRD1)5.709ON3933489051e-119
TBLA0E016905.709ON4884459041e-117
Suva_9.355.709ON3933448941e-117
Smik_9.165.709ON3933488911e-116
TPHA0D046505.709ON4214198891e-116
KAFR0D021905.709ON4263678621e-112
KLLA0A00462g5.709ON3533228201e-106
KNAG0L021705.709ON3963288011e-103
Ecym_23998.674ON3513024084e-45
ZYRO0F07326g8.674ON3523373943e-43
SAKL0H06622g8.674ON3553023911e-42
CAGL0M02255g8.674ON3582983857e-42
KLTH0D11176g8.674ON3532233849e-42
ACR139C8.674ON3592203822e-41
TDEL0A062008.674ON3552403795e-41
NDAI0E024108.674ON3592983796e-41
KAFR0H024408.674ON3533133762e-40
NCAS0C016908.674ON3592983752e-40
KNAG0J016908.674ON3633003743e-40
TPHA0D012408.674ON3593023735e-40
Smik_6.3498.674ON3583363692e-39
YPL152W (RRD2)8.674ON3582313692e-39
Suva_16.1588.674ON3583343682e-39
KLLA0F11187g8.674ON3602503682e-39
Kpol_1013.48.674ON3582433647e-39
Skud_16.1308.674ON3582983612e-38
TBLA0C018608.674ON3563123585e-38
Kwal_26.87838.674ON3553073472e-36
YMR291W (TDA1)5.38ON58660732.0
NCAS0F037803.523ON90736732.1
NDAI0H004404.58ON21450703.1
ZYRO0F08800g8.514ON34895694.4
ZYRO0E08536g3.523ON94343696.6
Kpol_223.66.122ON61277687.8
CAGL0J07546g2.6ON78942688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06655g
         (424 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   863   0.0  
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      385   e-131
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      375   e-127
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   368   e-125
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   368   e-125
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   367   e-124
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   362   e-123
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   360   e-122
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   359   e-121
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   359   e-121
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   355   e-119
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   353   e-119
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   353   e-119
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   352   e-117
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   348   e-117
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   347   e-116
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   347   e-116
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   336   e-112
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   320   e-106
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   313   e-103
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   161   4e-45
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   156   3e-43
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   155   1e-42
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   152   7e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   152   9e-42
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   151   2e-41
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   150   5e-41
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   150   6e-41
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   149   2e-40
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   149   2e-40
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   148   3e-40
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   148   5e-40
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   146   2e-39
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   146   2e-39
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   146   2e-39
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   146   2e-39
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   144   7e-39
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   143   2e-38
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   142   5e-38
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   138   2e-36
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    33   2.0  
NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {O...    33   2.1  
NDAI0H00440 Chr8 (99300..99944) [645 bp, 214 aa] {ON} Anc_4.58 Y...    32   3.1  
ZYRO0F08800g Chr6 (704371..705417) [1047 bp, 348 aa] {ON} simila...    31   4.4  
ZYRO0E08536g Chr5 complement(682374..685205) [2832 bp, 943 aa] {...    31   6.6  
Kpol_223.6 s223 complement(9674..11512) [1839 bp, 612 aa] {ON} c...    31   7.8  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    31   8.3  

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/424 (97%), Positives = 415/424 (97%)

Query: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLD 60
           MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELS         LD
Sbjct: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLD 60

Query: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
           RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL
Sbjct: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQVLYIFDRYYSLVHRLILSYTLE 180
           ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQVLYIFDRYYSLVHRLILSYTLE
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQVLYIFDRYYSLVHRLILSYTLE 180

Query: 181 PAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFV 240
           PAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFV
Sbjct: 181 PAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFV 240

Query: 241 FTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPWV 300
           FTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPWV
Sbjct: 241 FTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPWV 300

Query: 301 DYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQDSG 360
           DYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQDSG
Sbjct: 301 DYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQDSG 360

Query: 361 VGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSMGIVQTRMPSSTTSQAHASRLMN 420
           VGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSMGIVQTRMPSSTTSQAHASRLMN
Sbjct: 361 VGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSMGIVQTRMPSSTTSQAHASRLMN 420

Query: 421 TPRQ 424
           TPRQ
Sbjct: 421 TPRQ 424

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  385 bits (989), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 235/332 (70%), Gaps = 15/332 (4%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDV---ADLELSXXXXXXXXX 58
           FS P KRI+DSQ    FQSS A+ RL   + KY  +V +        L            
Sbjct: 40  FSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTLVNSIVQL 99

Query: 59  LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFP-------SELQ 111
           L+ L  L+ ETPP+ GPRRYGN+ACRDWH K+E ++P LL +++  + P       S   
Sbjct: 100 LNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSGESSSMHP 159

Query: 112 CVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ---VLYIFDRYYS 168
           C+ EL YY++N+FGS+TRLDFGTGHELSF+A +AA+DMLG   DG Q   +L +F+ YY+
Sbjct: 160 CIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILLLFNTYYA 219

Query: 169 LVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYS 228
           LV +LIL+YTLEPAGSHGVWGLDDHFHLAYILGSSQW   +   M P D+ D  LV+QY+
Sbjct: 220 LVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDISLVKQYA 277

Query: 229 RTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQ 288
           ++N++C+ + F+F VKSG F EHSP+L+DI+ SV TW+KV++GL KMY DEVL KFPV+Q
Sbjct: 278 KSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVLKKFPVVQ 337

Query: 289 HFWFGTGFYPWVDYKNGKPLPNYENSPDIDET 320
           HFWFG GFYPW++   GKPLP YE+SP+ DET
Sbjct: 338 HFWFGDGFYPWINQHTGKPLPIYEHSPEDDET 369

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  375 bits (964), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 233/322 (72%), Gaps = 11/322 (3%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVA---DLELSXXXXXXXXX 58
           FS PVKRI+DSQ    FQSS A++RL   + +Y +LV + ++    D  +S         
Sbjct: 21  FSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSII 80

Query: 59  --LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVEL 116
             L+ L  +V +TPP+ GPRRYGN+ACRDWH KIE E+P LLE  I S  P     ++EL
Sbjct: 81  HLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPS--PDLQPSIIEL 138

Query: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHRLI 174
            YY+ANSFGS+TRLD+GTGHELSF+A +AALDMLG   D  G  +L +F+ YYSLV  LI
Sbjct: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSLVRELI 198

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFC 234
           L+YTLEPAGSHGVWGLDDHFHLAYILGSSQW N   L   P ++++  LV+ YS  N++C
Sbjct: 199 LTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLT--PKEITNSRLVKDYSTKNLYC 256

Query: 235 KTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294
           + + FV TVKSG F EHSP+L+DIS SV  W KV++GL KMY DEVLNKFPV+QHFWFGT
Sbjct: 257 QCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316

Query: 295 GFYPWVDYKNGKPLPNYENSPD 316
           GFYPW++++  + LP YE+SP+
Sbjct: 317 GFYPWINFQTLRELPVYEHSPE 338

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 192/404 (47%), Positives = 251/404 (62%), Gaps = 46/404 (11%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDV----ADLELSXXXXXXXX 57
           F  PVK I+DSQGA  FQ S AI RL+  + KY  ++  + +    + +E+         
Sbjct: 14  FESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEV---VNRVVS 70

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELR 117
            L RL +LV ETPP  GPRRYGN+ACRDWH+K++  +  LL+ ++   +    +C+ EL 
Sbjct: 71  LLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH---KCIPELS 127

Query: 118 YYLANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLI 174
           YYL NSFGS+TRLD+GTGHELSFLA + ALDMLG   + F G  VL +FD YY LV +LI
Sbjct: 128 YYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLI 187

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFC 234
           L+YTLEPAGSHGVWGLDDHFH+ YILGSSQW +   + M P D+ + VLV+ Y+ TN++C
Sbjct: 188 LTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYC 247

Query: 235 KTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294
           + ++F+F VKSG F EHS ML+DI+ +V+TW+KV+ GL KMY  EVL KFPV+QHFWFG 
Sbjct: 248 QAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGP 307

Query: 295 GFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQ 354
           GFYPW+  +NG+ LP YEN+    E+   +  +   M           +P N T      
Sbjct: 308 GFYPWISDRNGQKLPIYENA----ESEKKQPPSMTTM-----------APSNTTMYHLTT 352

Query: 355 LPQDSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTSM 398
            P            P  +L  V    TR       G M PPTS+
Sbjct: 353 RP-----------IPHGKLSQVHKLPTR-------GTMQPPTSL 378

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 249/400 (62%), Gaps = 37/400 (9%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD-LELSXXXXXXXXXLD 60
           F+ PVKRI+DSQ    FQ+S AI RL+  I KY  ++   ++                L+
Sbjct: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVGVLN 70

Query: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
            +  LV +TPP+ GPRRYGN+ACRDWH KI+ ++P L   ++   F     C+VEL +YL
Sbjct: 71  HMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFH---HCIVELVHYL 127

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA---SFDGDQVLYIFDRYYSLVHRLILSY 177
            NSFGSATRLD+GTGHELSFLA V A+DMLG     F G+  L I + YY++V +LIL+Y
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237
           TLEPAGSHGVWGLDDHFHLAY+ GS+QW N K+  + P D+ +  LV++Y+  N++C+T+
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247

Query: 238 NFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFY 297
            F++ VK G FREHS ML+D++ +V TWAK+  GL KMY  EVLNKFPV+QHFWFGTGFY
Sbjct: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307

Query: 298 PWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQ 357
           PWVD + GK L  Y+ + D D  N   T  +          + F+S  N      P  P 
Sbjct: 308 PWVDNQTGKQLLIYDPA-DADRRNTSSTGGK---------YAAFVSSINSPV---PHFPA 354

Query: 358 DSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTS 397
            S                 TT ++ + A P + RMGPPT+
Sbjct: 355 PS-----------------TTAASEARAPPARTRMGPPTA 377

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 177/356 (49%), Positives = 238/356 (66%), Gaps = 12/356 (3%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDR 61
           F+EP KRI+DS+G++ FQSS A+ RL+  + KY   +    + +   +         L  
Sbjct: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72

Query: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLA 121
           L +LV  TP +PGPRRYGN+ACR WH+K++  +  LL   +    P   + +VEL+YYL 
Sbjct: 73  LSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPE--PCH-KSIVELQYYLG 129

Query: 122 NSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLILSYT 178
           N+FGS  RLD+GTGHELSF A + ALDMLG   A F    VL++FD+YY+LV +L+L+YT
Sbjct: 130 NAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLVLTYT 189

Query: 179 LEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLN 238
           LEPAGSHGVWGLDDHFHL YI G+SQW + K   + P ++ D ++V++Y++TN +C+ ++
Sbjct: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAIS 249

Query: 239 FVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYP 298
           F+F VKSG F EHSPMLFDISRSV TW+KV++GL KMY  EVLNKFPV+QHFWFGTG +P
Sbjct: 250 FIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFP 309

Query: 299 WVDYKNGKPLPNYENSPDIDETNDLKTQAQA--NMDGTRVVESRFLSPGNETFVRR 352
           W    +G  LP YE S +        T A A  N++  R    R ++P N   + R
Sbjct: 310 WTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSAR----RQMNPPNLRGINR 361

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 171/323 (52%), Positives = 228/323 (70%), Gaps = 8/323 (2%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDR 61
           FS PVKRI+D+ G + FQ S  + RL+  + +Y  LV+ + +     +         L+R
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVCILER 69

Query: 62  LDQLVSETPPIPG-PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
           LD L+ ETPP  G  RR+G++ACRDWH++++ E+ GLLE L+     +  +   ELRYYL
Sbjct: 70  LDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPE---AARRSAAELRYYL 126

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA----SFDGDQVLYIFDRYYSLVHRLILS 176
            ++FGS  RLD+GTGHEL+FLA V ALDMLG      F G+ +LY++ RYY+LVHRLIL+
Sbjct: 127 GSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILT 186

Query: 177 YTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKT 236
           Y LEPAGSHGVWGLDDH HLAYILG+SQW   + + M+P+D+ DP  V +YS TN++C +
Sbjct: 187 YNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNS 246

Query: 237 LNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGF 296
           + F+  VK+G F +HSPML DI+++V TW+KV  GL KMY+ EVLNKFPV+QHFWFGTGF
Sbjct: 247 IAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGF 306

Query: 297 YPWVDYKNGKPLPNYENSPDIDE 319
           +PWVD  +G  LPNYE   +  E
Sbjct: 307 FPWVDMAHGMSLPNYEAPSETSE 329

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/314 (52%), Positives = 225/314 (71%), Gaps = 6/314 (1%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDR 61
           F+EPVK+I+D+QG   FQSS  + RL+  + KY  LV ++++     +         +D 
Sbjct: 17  FTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNRFTQIIDA 76

Query: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLA 121
           L + + ETPP+PGPRR+GN ACR WH K+   +  LL+  I   +     C+VE+RYYL 
Sbjct: 77  LSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHV---CIVEIRYYLG 133

Query: 122 NSFGSATRLDFGTGHELSFLATVAALDML---GASFDGDQVLYIFDRYYSLVHRLILSYT 178
           N+FGS  RLD+GTGHELSFLA V+A+DML   G++  G+ +L++F+ YY+LV +LI +YT
Sbjct: 134 NAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLIATYT 193

Query: 179 LEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLN 238
           LEPAGSHGVWGLDDHFHLAYILGSSQ        + P+D+ D   VE Y++TN++ + + 
Sbjct: 194 LEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIA 253

Query: 239 FVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYP 298
           F+  VKSG+F EHSPML+DI+++V TW+KV++GL KMY  EVLNKFPV+QHFWFGTGF+P
Sbjct: 254 FIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTGFFP 313

Query: 299 WVDYKNGKPLPNYE 312
           WV+ K+G  LP YE
Sbjct: 314 WVNVKSGAILPTYE 327

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/340 (50%), Positives = 229/340 (67%), Gaps = 10/340 (2%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDR 61
           F+EPVKRI+DS+G + FQSS A+ RL+  + KY  ++  + +     +         L  
Sbjct: 13  FTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVISLRKILHF 72

Query: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLI-SSHFPSELQCVVELRYYL 120
             +LV ETP +PGPRRYGN+ACRDWH+K+E +I   L++ +   ++PS    +VEL YYL
Sbjct: 73  FSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS----IVELAYYL 128

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLILSY 177
            N+FGS  RLD+GTGHELSF + + ALDMLG   + F    +LY+F+ YYSLV +LI  Y
Sbjct: 129 GNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLITKY 188

Query: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237
           +LEPAGSHGVWGLDDHFHL YI G+SQW + K     P ++   ++V++Y+ +N +C+ +
Sbjct: 189 SLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAI 248

Query: 238 NFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFY 297
           +F+F VKSG F EHSPML+DISRSV TW+KV++GL KMY  EVLNKFPV+QHFWFGT  +
Sbjct: 249 SFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTALF 308

Query: 298 PWVDYKNGKPLPNYENSPDIDETNDL--KTQAQANMDGTR 335
           PW     G  LP YE S + D    L   TQ Q +M   R
Sbjct: 309 PWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTKLR 348

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  359 bits (922), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 241/377 (63%), Gaps = 20/377 (5%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD---LELSXXXXXXXXX 58
           F  PVKRIYDSQG   FQSS AI RL+  I KY  LV + D+ D   +            
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74

Query: 59  LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLIS---SHFPSELQ-CVV 114
           +  L  LV ETPP PGPRR+GN++CR+WH+K++  +  LL  +++    +  S+ +  VV
Sbjct: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134

Query: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVH 171
           EL YYL NSFGS+TRLD+GTGHELSF+A +A +DMLG    +  G  +L IF+ YY L+ 
Sbjct: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLMK 194

Query: 172 RLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTN 231
           +LIL+YTLEPAGSHGVWGLDDHFH AYILGS+QW       ++P D+ +  LV +Y+ TN
Sbjct: 195 KLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANTN 254

Query: 232 IFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFW 291
           ++C  + F+  VKSG F EHSPML+DIS+SV  W+KV  GL KMY  EVLNKFPV+QHFW
Sbjct: 255 MYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQHFW 314

Query: 292 FGTGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMD---GTRVVESRFLSPGNET 348
           FGTG +PW+D    K LP YEN  D  +T  + T++ +       TR   S+F SP    
Sbjct: 315 FGTGLFPWIDNNTKKSLPLYEN--DAKKTTSIHTKSPSPSPLGISTRRDFSKFTSPA--- 369

Query: 349 FVRRPQL--PQDSGVGT 363
             R P    P   G+G 
Sbjct: 370 LNRNPICRNPNHLGIGA 386

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  355 bits (910), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 183/353 (51%), Positives = 238/353 (67%), Gaps = 19/353 (5%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXX---- 57
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +            
Sbjct: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116
            LD+L QL+ ETPP+PGPRRYGN+ACR+WH K++  +   L++++    P+E   VV EL
Sbjct: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEML----PAEYHVVVPEL 137

Query: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHRLI 174
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALD+LG      G+ V  +F++YY+++ RLI
Sbjct: 138 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMRRLI 197

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKKLAMEPNDLSDPVLVEQYSRTNIF 233
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW     +  ++P ++ D  LV  Y  TN +
Sbjct: 198 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFY 257

Query: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 258 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 317

Query: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGN 346
           TGF+PWV+ +NG  LP +E     DET +   QA A   G     +RF  PG+
Sbjct: 318 TGFFPWVNIQNGTDLPVFEEKE--DETIE---QANAASPGPNHTSTRF--PGS 363

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/323 (52%), Positives = 224/323 (69%), Gaps = 12/323 (3%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELS-XXXXXXXXXLD 60
           FS PVKRI+DS G + FQ S  + RL+  + +Y  LV +++V  +  +          LD
Sbjct: 10  FSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSSFVSIFLD 69

Query: 61  RLDQLVSETPPIPG-PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQ-CVVELRY 118
           R  +L+ ETPP    PRR+GNMACRDWH K++ E+  L    +     +  + C++ELRY
Sbjct: 70  RFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRY 129

Query: 119 YLANSFGSATRLDFGTGHELSFLATVAALDMLGA--------SFDGDQVLYIFDRYYSLV 170
           YL N+FGS  RLD+GTGHELSFLA V A+DMLG            G  +LY++++YYS+V
Sbjct: 130 YLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIV 189

Query: 171 HRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSR 229
           H+LIL+YTLEPAGSHGVWGLDDH HLAYI+G+SQW ++ + A ++ +D+ D   + QY  
Sbjct: 190 HKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQYED 249

Query: 230 TNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQH 289
           TN++C ++ FV  VKSG F +HSPML+DISR+V TW+K   GL KMY+ EVLNKFPV+QH
Sbjct: 250 TNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVVQH 309

Query: 290 FWFGTGFYPWVDYKNGKPLPNYE 312
           FWFGTGF+PWVD K G  LPNYE
Sbjct: 310 FWFGTGFFPWVDMKKGMSLPNYE 332

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 232/348 (66%), Gaps = 17/348 (4%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXX---- 57
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +            
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116
            LD+L  L+ ETPP+PGPRRYGN+ACR+WH K++  +P  L++++    PSE   VV EL
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML----PSEYHEVVPEL 128

Query: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHRLI 174
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALDMLG      G  V  +F++YY+++ RLI
Sbjct: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMRRLI 188

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSRTNIF 233
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW      A ++P ++ D  LV +Y  TN +
Sbjct: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFY 248

Query: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 249 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 308

Query: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRF 341
           TGF+PWV+ +NG  LP +E         +   QA A   G     +RF
Sbjct: 309 TGFFPWVNIQNGTDLPVFEEK-----EEESIEQANAGSPGREQTSTRF 351

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  352 bits (904), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 258/445 (57%), Gaps = 30/445 (6%)

Query: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXX---XXX 57
           +FS P K+I+DSQG  YF  S A  R++  I KYT L++  ++   + +           
Sbjct: 14  VFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSK 73

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDL--ISSHFPSELQCVVE 115
            ++ L +LV ETPP+PGPRRYGN++CR WH++++  I  L E    IS+   ++ Q  +E
Sbjct: 74  IINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133

Query: 116 LRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHRL 173
           L YY   S GS TRLD+GTGHELSFLA + ALDML    D  G  +L+IF+ YY L+ +L
Sbjct: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLIRKL 193

Query: 174 ILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRK-------------KLAMEPNDLSD 220
           IL+YTLEPAGSHGVWGLDDHFHL YI GSSQWC                K  ++P D+ +
Sbjct: 194 ILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDILN 253

Query: 221 PVLVEQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEV 280
             L+E++  +N +C+++ F+ TVK+G F EHSP+LFDI+++V  W KVR GL KMY  EV
Sbjct: 254 KNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMVEV 313

Query: 281 LNKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDETN-DLKTQAQANMDGTRVVES 339
           LNKFPV+QHFWFGTGFYPW++      LP YE +PD + T   +      +  G++    
Sbjct: 314 LNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTYTINKPTDLSKSGSKKTLE 373

Query: 340 RFLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRST--------RSTAGPGQGR 391
             L+   E       +      G+ R+  P     N++TR          RS+    +G 
Sbjct: 374 NMLNTDKEKIDPNSCVTTTINHGSNRAKQPTLSSSNISTRKQARIPNDMLRSSQMSSEGP 433

Query: 392 MGP-PTSMGIVQTRMPSSTTSQAHA 415
             P   S  ++    P S+TS  H+
Sbjct: 434 TAPLERSTNMITGMNPPSSTSIRHS 458

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  348 bits (894), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 178/344 (51%), Positives = 231/344 (67%), Gaps = 16/344 (4%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXX----XX 57
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D   +            
Sbjct: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116
            LDR  QL+ +TPP+PGPRRYGN+ACR+WH K++  +   L +++    P++   VV EL
Sbjct: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVL----PAQYHAVVPEL 128

Query: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLG--ASFDGDQVLYIFDRYYSLVHRLI 174
           +YYL NSFGS+TRLD+GTGHELSF+ATVAALD+LG      G  V  +F +YY+++ RLI
Sbjct: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMRRLI 188

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSRTNIF 233
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW      A ++P D+ D  LV +Y  TN +
Sbjct: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFY 248

Query: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 249 CQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFG 308

Query: 294 TGFYPWVDYKNGKPLPNYENSPD--IDETNDLKTQAQANMDGTR 335
           TGF+PW++ +NG  LP +E   +  ID+ N   T A  +   TR
Sbjct: 309 TGFFPWINVQNGTDLPVFEEKEEESIDQAN--ATSATPDRTSTR 350

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  347 bits (891), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 177/348 (50%), Positives = 229/348 (65%), Gaps = 17/348 (4%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXX----XX 57
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D +              
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116
            LD+L  L+ ETPP+PGPRRYGN+ACR+WH K++  +P  L +++    P E   VV EL
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREML----PPEYHVVVPEL 128

Query: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLG--ASFDGDQVLYIFDRYYSLVHRLI 174
           +YYL NSFGS+TRLD+GTGHELSF+ATV ALD+LG      G  V  +F++YY+++ RLI
Sbjct: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMRRLI 188

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKKLAMEPNDLSDPVLVEQYSRTNIF 233
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW     +  ++P ++ D  LV +Y  TN +
Sbjct: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFY 248

Query: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 249 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 308

Query: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRF 341
           TGF+PWV+ +NG  LP +E         +   QA A   G     +RF
Sbjct: 309 TGFFPWVNIQNGTNLPVFEEK-----EEETIEQANAGPPGPEHTSTRF 351

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  347 bits (889), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 186/419 (44%), Positives = 245/419 (58%), Gaps = 47/419 (11%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDR 61
           FS P+KRIYDSQ  + FQSS AI RL+  + KY ++V + ++ DL               
Sbjct: 14  FSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITIVNEMSSL 73

Query: 62  LDQL---VSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLI--SSH------FPSEL 110
           L +L   +   PP  GPRRYGN+ACR+WH  I+ ++P LLE ++  S+H      F    
Sbjct: 74  LTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEKGEFEKLK 133

Query: 111 QCVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYY 167
            C++EL YYL NS GSATRLD+GTGHELSFLA +AA+DMLG    +F G  +L++F  YY
Sbjct: 134 GCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYY 193

Query: 168 SLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQY 227
            LV +LI++YTLEPAGSHGVWGLDDHFHL+YILGSSQ          P+D+ +  +V +Y
Sbjct: 194 ELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIINKKIVTEY 253

Query: 228 SRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVI 287
              N +C T++F++ VKSG F EHSP+L+DIS +V +W KV  GL KMY  EVLNKFPV+
Sbjct: 254 MHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEVLNKFPVV 313

Query: 288 QHFWFGTGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNE 347
           QHFWFG GFYPW + K  K L  Y N  +  E N   +   +++    + + R ++    
Sbjct: 314 QHFWFGEGFYPWKNVKTHKLLDVYMNDTN-QENNVFNSSDSSSIPNNAMNKDRSVNQNPS 372

Query: 348 TFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGR------MGPPTSMGI 400
              R PQ                           R TA P   R      MGPP+S G+
Sbjct: 373 QLNRIPQ--------------------------NRYTAIPVNNRDLRRPPMGPPSSHGV 405

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  336 bits (862), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 232/367 (63%), Gaps = 20/367 (5%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVE------SRDVADLELSXXXXXX 55
           FS P KRI+DSQ   YFQ S A  RL+    KY +LV       SR++            
Sbjct: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT----MTITRYI 72

Query: 56  XXXLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV- 114
              LD+  Q + ETPP+  PRR+GN++CR WH+KI   +PG L+ +I +    E + +  
Sbjct: 73  LDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132

Query: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHR 172
           EL YYL NSFGS TRLD+GTGHELSFLA ++ +DM+    D   D  L I+  YY+L  +
Sbjct: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRK 192

Query: 173 LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNI 232
           LIL+YTLEPAGSHGVWGLDDHFHLAYI GSSQ  +     + P D+    +V ++   N+
Sbjct: 193 LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDIS-HLAPKDILKKDVVAEHKENNL 251

Query: 233 FCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
           +C+ +NF+FTVK G F EHSP+L+DIS++V++W+KV KGL KMY DEVLNKFPV+QHFWF
Sbjct: 252 YCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWF 311

Query: 293 GTGFYPWVDYKNGKPLPNYENS------PDIDETNDLKTQAQANMDGTRVVESRFLSPGN 346
           G GF+PW D  +GK LP +E+S      P I       T+  A+ +  R  +S  ++P  
Sbjct: 312 GDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIMNPNY 371

Query: 347 ETFVRRP 353
           +  + RP
Sbjct: 372 KMSMHRP 378

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  320 bits (820), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 215/322 (66%), Gaps = 9/322 (2%)

Query: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD-LELSXXXXXXXXXLD 60
           FS P KRI+DSQG   FQ+S A+ R++  + KY  L + + + D ++ S         L 
Sbjct: 10  FSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVVELLK 69

Query: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
           RL  L+ ETPP     RYGN++ RDW  K + ++   L +L+   + +    ++EL YY+
Sbjct: 70  RLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNS---IIELSYYI 126

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA-SFDGDQVLYIFDRYYSLVHRLILSYTL 179
           +N+FGS  R+D+GTGHELSFLA +  LDML   +  G  +LY F+ YY ++ +LIL+Y L
Sbjct: 127 SNAFGSKERIDYGTGHELSFLAVIICLDMLKIETIKGPALLYCFNSYYDVIQKLILTYKL 186

Query: 180 EPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNF 239
           EPAGSHGVWGLDDHFH +YILG++Q  +    ++ P D+S+  L+EQ S +N+FCK++ F
Sbjct: 187 EPAGSHGVWGLDDHFHFSYILGATQLLDVNT-SLIPKDISNTRLMEQNSSSNLFCKSIRF 245

Query: 240 VFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPW 299
           +  VKSG F  HSP+L++ISRSV TW K+++GL KMYK EVLNKFPV+QHFWFGT F+PW
Sbjct: 246 INVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAFFPW 305

Query: 300 VDYKNGKPLPNY---ENSPDID 318
             Y N   LP Y   EN+ D D
Sbjct: 306 TSYGNNHSLPIYQPAENNDDAD 327

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  313 bits (801), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 210/328 (64%), Gaps = 21/328 (6%)

Query: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLD 60
           +F +P KRI+DSQ    FQ S A+ R+   I KY  ++  R      +S         LD
Sbjct: 22  VFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM--RGDTSGGISASVARMLQILD 79

Query: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCV------V 114
           RLD LV ETPP+ GPRRYGN+ACRDWH+K++  +PGL          S++ C+      +
Sbjct: 80  RLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLT---------SQVDCLAGGGACI 130

Query: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHR 172
           E  YYL NSFGS  RLD+GTGHELSFLA VAALDM+         ++  ++DRYY LV R
Sbjct: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVRR 190

Query: 173 LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPND-LSDPVLVEQYSRTN 231
           LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+ N   + ++P D LS  +     +  N
Sbjct: 191 LIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFAN-NPVGVQPRDVLSGVIPGRDDAPAN 249

Query: 232 IFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFW 291
              + + FV +VK G F E+SPML DI   V +W K+++GL++MY  EVLNKFPV+QHFW
Sbjct: 250 FLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFW 309

Query: 292 FGTGFYPWVDYKNGKPLPNYENSPDIDE 319
           FGT F+PW   ++G PLP YE S D ++
Sbjct: 310 FGTAFFPWTSVRDGTPLPVYEQSADTEQ 337

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  161 bits (408), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 108/302 (35%), Positives = 167/302 (55%), Gaps = 19/302 (6%)

Query: 7   KRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRLDQ 64
           KR+        + +SE    +   + +  + V  ++ A  E  +S         LD + +
Sbjct: 5   KRLLTEDDLQKWLNSETYESVVSFVTQLGEAVNGKENAAYEQPISSQIENLCALLDTVAK 64

Query: 65  LVSETPPI--PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSEL--QCVVELRYYL 120
           +V + P +   G  R+G +  RD+++++ RE     ++LISS   SEL  + V EL  Y 
Sbjct: 65  IVDKHPVVQDKGTSRFGKVEFRDFYDEV-RETT---KELISS-LSSELTDEQVEELAVYF 119

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQV---LYIFDRYYSLVHRLILSY 177
             S+G   R+D+G+GHEL+F+  +  L       D D+V   L +F +Y  ++  L   Y
Sbjct: 120 TESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMRLLETKY 179

Query: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237
            LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +P +VE + +  ++ + +
Sbjct: 180 WLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHL--KPKSIHNPEIVEVFEKRYMYFECV 237

Query: 238 NFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGF 296
            F+  VK+ A  R HSPML DIS  VRTW+KV +G+ KMYK EVL K P++QHF+F T F
Sbjct: 238 AFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIMQHFFFST-F 295

Query: 297 YP 298
            P
Sbjct: 296 LP 297

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  156 bits (394), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 110/337 (32%), Positives = 170/337 (50%), Gaps = 29/337 (8%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRL 62
           P KR+  ++    +  S  +  L   +    D V  R+    +  +S         L ++
Sbjct: 3   PEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDMEPTMQLLKKV 62

Query: 63  DQLVSETPPI--PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPS-ELQCVVELRYY 119
           + L+ + P I      R+G +  RD+++ ++       E+L+++ +PS     V EL  Y
Sbjct: 63  NDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHA----EELVATTYPSLNKDQVEELAVY 118

Query: 120 LANSFGSATRLDFGTGHELSFLATVAALDMLGASFD-----GDQVLYIFDRYYSLVHRLI 174
           L  S+G+  R+D+G+GHEL+F+  +  L +    FD      D VL +F  Y  ++  L 
Sbjct: 119 LYESWGNKRRIDYGSGHELNFVCFIYGLYVYKV-FDLERDAADLVLKVFVEYLRIMRILE 177

Query: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFC 234
             Y LEPAGSHGVWGLDD+  L ++ G+ Q      L   P  + +  +VE +    I+ 
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPHL--RPKSIHNEEVVEMFMDKYIYF 235

Query: 235 KTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293
             + F+ +VKS A  R HSPML DIS  V+TWAKV +G+ KMYK EVL+K P++QHF+FG
Sbjct: 236 GCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

Query: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQAN 330
                     N  P P   + P  D   DL  +   +
Sbjct: 295 ----------NILPCPEGISPPKGDHGRDLCEEGHVH 321

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  155 bits (391), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 161/302 (53%), Gaps = 23/302 (7%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADL--ELSXXXXXXXXXLDRL 62
           P KR+        +  S     L G I K  + V+ R+       +S         LD++
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 63  DQLVSETPPI--PGPRRYGNMACRDWHEKIEREIPGL---LEDLISSHFPSELQCVVELR 117
           +++VS  P I      R+G +  RD+++ +      +   L D +S+  P     V EL 
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLST--PQ----VDELA 116

Query: 118 YYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ-----VLYIFDRYYSLVHR 172
            Y   S+G+ TR+D+G+GHEL+F+  +  L+     FD ++     VL +F +Y  ++  
Sbjct: 117 AYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNF-FDLEKDATNVVLRVFIKYLDVMRT 175

Query: 173 LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNI 232
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +   VE + +  +
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHL--KPKSIHNKEFVEMFEKRYL 233

Query: 233 FCKTLNFVFTVKSG-AFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFW 291
           +   + F+ +VK+  + R HSPML DIS  V+TW+KV +G+ KMYK EVL K P++QHF+
Sbjct: 234 YFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFY 292

Query: 292 FG 293
           FG
Sbjct: 293 FG 294

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  152 bits (385), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 157/298 (52%), Gaps = 17/298 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVE--SRDVADLELSXXXXXXXXXLDRL 62
           P KRI   +    ++ SE    +   I      VE    D     +S         L  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 63  DQLVSETPPI--PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVE-LRYY 119
           D+L+   P I      R+G +  RD+++ +  +     +DL+SSHFP+     +E L  Y
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKA----DDLLSSHFPALTSEQIEQLSIY 118

Query: 120 LANSFGSATRLDFGTGHELSFLATVAAL---DMLGASFDG-DQVLYIFDRYYSLVHRLIL 175
           L  S+G+  R+D+G+GHEL+F+  +  L    +     D  + VL +F  Y  ++  +  
Sbjct: 119 LQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIET 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE ++   ++  
Sbjct: 179 LYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHL--KPKSIHNEELVEMFADKYLYFG 236

Query: 236 TLNFVFTVK-SGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
            + F+ +VK S + R HSPML DIS  V+ W+KV +G+ KMYK EVL K P++QHF+F
Sbjct: 237 CIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYF 293

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  152 bits (384), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 135/223 (60%), Gaps = 11/223 (4%)

Query: 77  RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLANSFGSATRLDFGTGH 136
           R+G +  R +++ ++ +  GL++    +   ++ +   EL  Y A S+G  +R+D+G+GH
Sbjct: 79  RFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCE---ELSVYFAESWGDRSRIDYGSGH 135

Query: 137 ELSFLATVAALDMLGASFD----GDQVLYIFDRYYSLVHRLILSYTLEPAGSHGVWGLDD 192
           EL+FL  +  L   G   +     + VL +F +Y  ++  L   Y LEPAGSHGVWGLDD
Sbjct: 136 ELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTLETKYWLEPAGSHGVWGLDD 195

Query: 193 HFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFVFTVKSGA-FREH 251
           +  L ++ G+ Q    K L  +P  + +  +VE + +  ++   ++F+  VK+ A  R H
Sbjct: 196 YHFLPFLFGAFQLSTHKHL--KPKSIHNSEVVEMFGKRYLYFGCIDFINKVKTTASLRWH 253

Query: 252 SPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294
           SPML DIS  V+TWAKV +G+ KMYK EVLNK P++QHF+FG+
Sbjct: 254 SPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFGS 295

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  151 bits (382), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 129/220 (58%), Gaps = 10/220 (4%)

Query: 77  RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLANSFGSATRLDFGTGH 136
           R+G +  RD+H++++     L+  +  S    + Q   EL  YL N++G   R+D+G+GH
Sbjct: 87  RFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQ---ELAVYLGNAWGDCKRIDYGSGH 143

Query: 137 ELSFLATVAALDMLGASFDGD---QVLYIFDRYYSLVHRLILSYTLEPAGSHGVWGLDDH 193
           EL+F+  +  L   G   + D    VL +F +Y  ++  L   Y LEPAGSHGVWGLDD+
Sbjct: 144 ELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDY 203

Query: 194 FHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFVFTVKSGA-FREHS 252
             L ++ G+ Q    K L  +P  + +P +VE +    ++   + F+  VK+ A  R HS
Sbjct: 204 HFLPFLFGAFQLATHKHL--KPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHS 261

Query: 253 PMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
           PML DIS  VR+W KV +G+ KMYK EVL K P++QHF+F
Sbjct: 262 PMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF 300

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  150 bits (379), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 137/240 (57%), Gaps = 12/240 (5%)

Query: 59  LDRLDQLVSETP-PIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELR 117
           ++ +DQ +   P    GP R+G    RD ++ I      L+++   S    +   V +L 
Sbjct: 60  IECVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQ---VAQLS 116

Query: 118 YYLANSFGSATRLDFGTGHELSFLATVAALDMLG----ASFDGDQVLYIFDRYYSLVHRL 173
            Y   S+G  +R+D+G+GHEL+FL  +  L   G    A  + + VL +F +Y   +  +
Sbjct: 117 VYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVI 176

Query: 174 ILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIF 233
              Y LEPAGSHGVWGLDD+  L ++ G+SQ    + L  +P  + +P +VE +S   ++
Sbjct: 177 ETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRHL--KPKSIHNPEVVEMFSEKYLY 234

Query: 234 CKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
              ++F+ +VK+ A  R HSPML DIS  V+ WAKV +G+ KMY  EVL K P++QHF+F
Sbjct: 235 FGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF 293

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  150 bits (379), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 161/298 (54%), Gaps = 17/298 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRL 62
           P KR+        +++S   + L   I    + V+  + + +   +S         L  +
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 63  DQLVSETPPIPGPR--RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVE-LRYY 119
           D+++ + P +      R+G    R +++    EI  + E LI  +FPS     +E L  Y
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYD----EINEVSEKLIHENFPSLTHEQLEQLTIY 118

Query: 120 LANSFGSATRLDFGTGHELSFLATVAAL---DMLGASFDG-DQVLYIFDRYYSLVHRLIL 175
           L  S+G+  R+D+G+GHEL+F+  +  L   D+L    D  + VL IF +Y  ++  L  
Sbjct: 119 LDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLET 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE +++  ++  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHL--KPLSIHNEELVEMFAKKYLYFG 236

Query: 236 TLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
            + F+ +VK+ A  R HSPML DIS  V+ W+KV +G+ KMY  EVL+K P++QHF+F
Sbjct: 237 CIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYF 293

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  149 bits (376), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/313 (31%), Positives = 162/313 (51%), Gaps = 20/313 (6%)

Query: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXX 58
           M S P KR+        + SS+  + L   I    + V+ RD    +  +S         
Sbjct: 1   MSSCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAEVSSTLAL 60

Query: 59  LDRLDQLVSETPPI-PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELR 117
           LD +  +V E P +     R+G    R +++ ++     LL     +   ++++   +L 
Sbjct: 61  LDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIE---QLS 117

Query: 118 YYLANSFGSATRLDFGTGHELSFLATVAAL---DMLGASFDG-DQVLYIFDRYYSLVHRL 173
            Y   S+G+  R+D+G+GHEL+F+  +  L   D+     D  + V+ +F +Y  ++ RL
Sbjct: 118 IYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRL 177

Query: 174 ILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIF 233
              Y LEPAGSHGVWGLDD+  L ++ G+ Q  N K L  +P  + +  +V+ +    ++
Sbjct: 178 ETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKHL--KPKSIHNDEIVDMFKDKYLY 235

Query: 234 CKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
              + F+ +VK+ A  R HSPML DIS  V+ W+KV +G+ KMY  EVL+K PV+QHF+F
Sbjct: 236 FGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYF 294

Query: 293 G------TGFYPW 299
                  TG  P+
Sbjct: 295 SEFLACPTGISPY 307

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  149 bits (375), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 164/298 (55%), Gaps = 17/298 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADL--ELSXXXXXXXXXLDRL 62
           P KRI        +++S   + L   I    + VE  + + +   +S         LD +
Sbjct: 3   PEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSLLDEV 62

Query: 63  DQLVSETPPIPGPR--RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
           ++LV + P I   +  R+G +  RD+++++  +   L++   S+    +L+   +L  YL
Sbjct: 63  NKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLE---QLSIYL 119

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ-----VLYIFDRYYSLVHRLIL 175
             S+G+  R+D+G+GHEL+F+  +  L   G  FD ++     VL +F +Y +++  L  
Sbjct: 120 DESWGNKRRIDYGSGHELNFICFLFGLYSYGL-FDLEKDAINLVLVVFLKYLNIMRVLET 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE +    ++  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKHL--KPMSIHNEELVELFKDKFLYFG 236

Query: 236 TLNFVFTVK-SGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
            ++F+ +VK + + R HSPML DIS  V+ W+KV +G+ KMY  EVL K P++QHF+F
Sbjct: 237 CISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  148 bits (374), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 159/300 (53%), Gaps = 19/300 (6%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVA--DLELSXXXXXXXXXLDRL 62
           P KR+   +    ++SSE    L   I +  D V  R+    DL +S         L ++
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQQV 65

Query: 63  DQLVSETPPIPG---PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-ELRY 118
             ++   P         R+G +  RD+++++  E   L    I+  FP   Q  V +L+ 
Sbjct: 66  RGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASL----ITGAFPQLTQNQVRQLQT 121

Query: 119 YLANSFGSATRLDFGTGHELSFLATVAALDM-----LGASFDGDQVLYIFDRYYSLVHRL 173
           YL  S+G   R+D+G+GHEL+F+  +  L       LG +   + VL  F  Y  ++  L
Sbjct: 122 YLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFIEYLKIMRVL 181

Query: 174 ILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIF 233
              Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  +VE ++   ++
Sbjct: 182 ETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHL--KPLSIHNEEVVELFADKYLY 239

Query: 234 CKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
              ++F+ +VK+ A  R HSPML DIS  V+ W+KV +G+ KMY+ EVL+K P++QHF+F
Sbjct: 240 FGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYF 298

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  148 bits (373), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/302 (31%), Positives = 163/302 (53%), Gaps = 17/302 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD--LELSXXXXXXXXXLDRL 62
           P KR+  +     +  S+    L   + +    VE ++  D  L +S         L ++
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMKLLHKV 62

Query: 63  DQLVSETPPIPGPR--RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
             ++ + P +      R+G +  RD+++ +  +   LL++   S   S+++   +L  Y+
Sbjct: 63  QSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIE---QLYVYV 119

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ-----VLYIFDRYYSLVHRLIL 175
             S+G+  R+D+G+GHEL+F+  +  L      FD ++     VL +F +Y  L+  L L
Sbjct: 120 DESWGNKQRIDYGSGHELNFMCFIYGLTSFKI-FDLERDATNLVLKVFIQYLKLMRVLEL 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P+ + +  L+E ++   ++  
Sbjct: 179 QYWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHL--KPSSIHNDDLIEMFADKYLYFG 236

Query: 236 TLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294
            + F+ +VK+    R HSPML DIS  V+ W+KV +G++KMY+ EV+ K P++QHF+F  
Sbjct: 237 CIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFND 295

Query: 295 GF 296
            F
Sbjct: 296 MF 297

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  146 bits (369), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/336 (30%), Positives = 173/336 (51%), Gaps = 19/336 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRL 62
           P KR+  S     ++ S+        I+   + V+  + +  E  +S         L  +
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 63  DQLVSETPPI--PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVE-LRYY 119
             ++ + P +      R+G +  RD+++++ +     L     S FPS     +E L  Y
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLR----SEFPSLTDEQLEQLSIY 118

Query: 120 LANSFGSATRLDFGTGHELSFLATVAALDMLGA-SFDGDQ---VLYIFDRYYSLVHRLIL 175
           L  S+G+  R+D+G+GHEL+F+  +  L   G  +   D    +L +F  Y  ++  L  
Sbjct: 119 LDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILET 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q  + K L  +P  + +  LVE ++   ++  
Sbjct: 179 RYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTSHKHL--KPISIHNNELVEMFANRYLYFG 236

Query: 236 TLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294
            ++F+  VKS A  R HSPML DIS  V+TW+KV +G+ KMY+ EVL+K P++QHF+F +
Sbjct: 237 CIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-S 294

Query: 295 GFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQAN 330
            F P  +     P  +  +  D+D+  + +    +N
Sbjct: 295 DFLPCPE-GVSPPRGHIHDGTDVDDECNFEGHVHSN 329

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  146 bits (369), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 136/231 (58%), Gaps = 14/231 (6%)

Query: 77  RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVE-LRYYLANSFGSATRLDFGTG 135
           R+G +  RD+++++ R    +L     S FPS     +E L  YL  S+G+  R+D+G+G
Sbjct: 79  RFGKVEFRDFYDEVSRNSRKILR----SEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSG 134

Query: 136 HELSFLATVAALDMLG----ASFDGDQVLYIFDRYYSLVHRLILSYTLEPAGSHGVWGLD 191
           HEL+F+  +  L   G    ++   + VL +F  Y  ++  L   Y LEPAGSHGVWGLD
Sbjct: 135 HELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLD 194

Query: 192 DHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLNFVFTVKSGA-FRE 250
           D+  L ++ G+ Q    K L  +P  + +  LVE ++   ++   + F+  VKS A  R 
Sbjct: 195 DYHFLPFLFGAFQLTTHKHL--KPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRW 252

Query: 251 HSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYPWVD 301
           HSPML DIS  V+TW+KV +G+ KMYK EVL+K P++QHF+F + F P  D
Sbjct: 253 HSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-SEFLPCPD 301

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  146 bits (368), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 174/334 (52%), Gaps = 17/334 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRL 62
           P KR+  ++    ++ S+        ++     VE  + +  +  +S         L R+
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQITRMLSLLSRV 62

Query: 63  DQLVSETPPIPG--PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120
             ++ + P +      R+G +  RD+++++ +    LL+   S     +L+   +L  YL
Sbjct: 63  RDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLE---QLSIYL 119

Query: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA-SFDGDQ---VLYIFDRYYSLVHRLILS 176
             S+G+  R+D+G+GHEL+F+  +  L   G  +   D    +L +F  Y  ++  L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETK 179

Query: 177 YTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKT 236
           Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE +S   ++   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHL--KPISIHNSELVEMFSDRYLYFGC 237

Query: 237 LNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTG 295
           + F+  VKS A  R HSPML DIS  V+TW+KV +G+ KMY+ EVL+K P++QHF+F + 
Sbjct: 238 IAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SE 295

Query: 296 FYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQA 329
           F P  +    +P  +  +  D D+  +++  A +
Sbjct: 296 FLPCPE-GVSQPRGHIHDGTDADDECNIEGHAHS 328

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  146 bits (368), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 137/250 (54%), Gaps = 19/250 (7%)

Query: 59  LDRLDQLVSETPPIPGPR---------RYGNMACRDWHEKIEREIPGLLEDLISSHFPSE 109
           + R+  L+S+   I G           R+G +  RD+++ I      L+  +       +
Sbjct: 51  VQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPD 110

Query: 110 LQCVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD-----GDQVLYIFD 164
              + ++  Y  NS+G  +R+D+G+GHEL+F+  +  L      FD      + VL +F 
Sbjct: 111 TGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTE-SKVFDLENDSSNIVLMLFI 169

Query: 165 RYYSLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLV 224
           +Y  ++  L L Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +P +V
Sbjct: 170 KYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHL--KPKSIHNPEVV 227

Query: 225 EQYSRTNIFCKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNK 283
           E +    ++   + F+  VK+ A  R HSPML DIS  V+ W+KV +G+ KMYK EVL K
Sbjct: 228 EMFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQK 286

Query: 284 FPVIQHFWFG 293
            P++QHF+FG
Sbjct: 287 LPIMQHFYFG 296

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  144 bits (364), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 143/243 (58%), Gaps = 15/243 (6%)

Query: 59  LDRLDQLVSETPPIPGPR--RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVEL 116
           L  ++ ++ + P +   +  R+G +  RD+++    E+    + LIS+ +PS  +  ++ 
Sbjct: 59  LKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYD----ELTSQSKTLISNAYPSLTEDQLDQ 114

Query: 117 RY-YLANSFGSATRLDFGTGHELSFLATVAAL---DMLGASFD-GDQVLYIFDRYYSLVH 171
            Y YL  S+G+  R+D+G+GHEL+FL  +  L    +   S D  + VL IF  Y  ++ 
Sbjct: 115 LYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRVMR 174

Query: 172 RLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTN 231
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE +    
Sbjct: 175 ILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHL--KPLSIHNEELVEMFQDKY 232

Query: 232 IFCKTLNFVFTVK-SGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHF 290
           ++   + F+ +VK S + R HSPML DIS  V+ W+KV +G+ KMY+ EVL+K P++QHF
Sbjct: 233 LYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHF 291

Query: 291 WFG 293
           +FG
Sbjct: 292 YFG 294

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  143 bits (361), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 156/298 (52%), Gaps = 17/298 (5%)

Query: 5   PVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLE--LSXXXXXXXXXLDRL 62
           P KR+  +     ++ S+        I++  + V+  +    +  +S         L ++
Sbjct: 3   PEKRLLTAGDMKLWEESQTRADFTKFIIELAESVKGHENYQFKEPISEQIISMMNLLSQI 62

Query: 63  DQLVSETPPI--PGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVE-LRYY 119
             ++ + P +      R+G +  RD+++++ +    LL     S FP      +E L  Y
Sbjct: 63  KDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLR----SEFPHLTDEQLEQLSIY 118

Query: 120 LANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ----VLYIFDRYYSLVHRLIL 175
           L  S+G+  R+D+G+GHEL+F+  +  L   G     D     +L +F  Y  ++  L  
Sbjct: 119 LDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILET 178

Query: 176 SYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCK 235
            Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  LVE ++   ++  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHL--KPISIHNNELVEMFAHRYLYFG 236

Query: 236 TLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWF 292
            + F+  VKS A  R HSPML DIS  V+TW+KV +G+ KMYK EVL+K P++QHF+F
Sbjct: 237 CIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF 293

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  142 bits (358), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 166/312 (53%), Gaps = 32/312 (10%)

Query: 5   PVKRIYDSQGAYYFQSSEA-------IRRLEGAIVKYTDLVESRDVADLELSXXXXXXXX 57
           P KR+  SQ    + +S+        I  L  +IV Y +   S  ++D  ++        
Sbjct: 2   PEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSD-SINNAFSLLQD 60

Query: 58  XLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHF----PSELQCV 113
             D +++   E+       R+G +  + +++ I +      E LI SHF    P+++Q  
Sbjct: 61  IRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQN----SEKLIKSHFNGLDPNQIQ-- 114

Query: 114 VELRYYLANSFGSATRLDFGTGHELSFLATVAAL------DMLGASFDGDQVLYIFDRYY 167
            EL  YL  S+G+  R+D+G+GHEL+F+  +  L      ++L  S   + VL IF  Y 
Sbjct: 115 -ELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDS--TNLVLKIFMEYI 171

Query: 168 SLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQY 227
           +++  +   Y LEPAGSHGVWGLDD+  L ++ G+ Q    K L  +P  + +  +VE +
Sbjct: 172 NIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKHL--KPISIHNEEMVEMF 229

Query: 228 SRTNIFCKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPV 286
               ++   ++F+ ++K+ A  R HSPML DIS  V+ W+KV +G+ KMY  EVL K P+
Sbjct: 230 KDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPI 288

Query: 287 IQHFWFGTGFYP 298
           +QHF+F + F P
Sbjct: 289 MQHFYF-SDFLP 299

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  138 bits (347), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 157/307 (51%), Gaps = 29/307 (9%)

Query: 4   EPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSXXXXXXXXXLDRLD 63
           +P KR+  SQ    +       +L   I   ++L ES  V  LE +         +D+  
Sbjct: 2   KPQKRLLTSQDIETWVDCATFDQL---IEFISELAES--VKGLENNQYQEPIGASIDKCC 56

Query: 64  QLVSETPPIPGPR---------RYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQ-CV 113
            L+ E   I             R+G +  R +++ +  +     +DLIS  F    Q   
Sbjct: 57  SLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKA----QDLISKEFDQLSQDQA 112

Query: 114 VELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQ-----VLYIFDRYYS 168
            EL  Y   S+G   R+D+G+GHEL+F+  +  L   G  F+  +     VL +F  Y  
Sbjct: 113 EELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGL-FERSRDYRNLVLKVFIHYLE 171

Query: 169 LVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYS 228
           L+  L  +Y LEPAGSHGVWGLDD+  L ++ G+SQ    K L  +P  + +  LV+ ++
Sbjct: 172 LMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKHL--KPKSIHNNELVDMFA 229

Query: 229 RTNIFCKTLNFVFTVKSGA-FREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVI 287
              ++   ++F+  VK+ A  R HSPML DIS   ++W+KV +G+ KMY+ EVL K P++
Sbjct: 230 SRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIM 288

Query: 288 QHFWFGT 294
           QHF FG+
Sbjct: 289 QHFLFGS 295

>YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Protein
           kinase of unknown cellular role; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; null mutant is sensitive to expression of
           the top1-T722A allele; not an essential gene
          Length = 586

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 328 QANMDGTRVVESRF-LSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTRSTAG 386
            AN +GT +  S+  L   N TFV  P+ P++S +    S+TPESR  N  T  T S  G
Sbjct: 463 HANKNGTSLSSSKSGLVKKNSTFVLDPKPPKNSLMNGCFSTTPESR-SNFNTPKTLSRQG 521

>NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {ON}
           Anc_3.523 YER033C
          Length = 907

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 66  VSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDL 101
           +S TPP+P P R  ++   D +  ++ E+PGL  +L
Sbjct: 663 LSYTPPLPPPARSQSLKYHDLNSNLDAEVPGLTSNL 698

>NDAI0H00440 Chr8 (99300..99944) [645 bp, 214 aa] {ON} Anc_4.58
           YGL047W
          Length = 214

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 106 FPSELQCVVELRYYLANSFGSATRL--DFGTGHELSFLATVAALDMLGAS 153
           FP  ++CV+  ++ +       TRL   FGTG+E +FL  ++ L++   +
Sbjct: 17  FPDLVECVINEKFIVEIIKNGYTRLVVQFGTGYESTFLTLLSGLNIANCT 66

>ZYRO0F08800g Chr6 (704371..705417) [1047 bp, 348 aa] {ON} similar
           to uniprot|P33300 Saccharomyces cerevisiae YPL057C SUR1
           Probable catalytic subunit of a mannosylinositol
           phosphorylceramide
          Length = 348

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 38/95 (40%), Gaps = 17/95 (17%)

Query: 68  ETPPIPGPRRYGNMACRDWH--------------EKIEREIPGLLEDLISSHFPSELQCV 113
           +T  IPG  + G   C D H              + IE E P  LE   +  +P E    
Sbjct: 66  KTDEIPGHWKEGRQRCLDLHPDYEYILWTDEMADKFIEDEYPWFLETFRNYRYPIERADA 125

Query: 114 VELRYYLANSFGSA-TRLDFGTGHELSFLATVAAL 147
           +  RY++ + FG     LD G   +L  L TV A 
Sbjct: 126 I--RYFILSHFGGVYIDLDDGCERKLDPLLTVPAF 158

>ZYRO0E08536g Chr5 complement(682374..685205) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P40021 Saccharomyces
           cerevisiae YER033C ZRG8 Cytoplasmic protein of unknown
           function transcription is induced under conditions of
           zinc deficiency
          Length = 943

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 59  LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDL 101
            D    L + TP +P P R  ++   D    ++ EIPGL+ +L
Sbjct: 728 FDSQPHLSNTTPSLPPPARSQSLKYHDLSSNLDSEIPGLMSNL 770

>Kpol_223.6 s223 complement(9674..11512) [1839 bp, 612 aa] {ON}
           complement(9674..11512) [1839 nt, 613 aa]
          Length = 612

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 6/77 (7%)

Query: 350 VRRPQLPQDSGVGTMRSSTP--ESRLMNVTTRSTRSTAGPGQGRMGPPTSMGIVQTRMP- 406
           +++P  P     GT  ++TP  E+R+     R    +    Q  +G  T M +  T M  
Sbjct: 8   IKQPSRPSSMSRGTQEAATPQTETRMQQTAARRPTRSCFTAQSVLGLETCMHLTCTNMSL 67

Query: 407 ---SSTTSQAHASRLMN 420
               +   QAHAS   N
Sbjct: 68  AAIDAALEQAHASGCHN 84

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 312 ENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRP 353
           EN  DID  N L+ +A  N D   ++ S FL+P N+   R P
Sbjct: 76  ENEDDIDSGNSLRKRAIENED--HILSSEFLTPSNKLQKRMP 115

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,789,136
Number of extensions: 1965464
Number of successful extensions: 4967
Number of sequences better than 10.0: 58
Number of HSP's gapped: 4986
Number of HSP's successfully gapped: 58
Length of query: 424
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 312
Effective length of database: 40,638,807
Effective search space: 12679307784
Effective search space used: 12679307784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)