Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06633g5.708ON54454429450.0
KNAG0C066405.708ON54754726270.0
Suva_11.3345.708ON54854626090.0
YKR097W (PCK1)5.708ON54954625900.0
Smik_11.3615.708ON54953725880.0
Skud_11.3375.708ON54954625830.0
NCAS0A031605.708ON55253325690.0
NDAI0E050805.708ON55153525580.0
KLLA0A00484g5.708ON54354425250.0
SAKL0E15048g5.708ON54254325070.0
KAFR0H001605.708ON54953624830.0
TDEL0B021205.708ON54854224820.0
Ecym_40135.708ON54253524500.0
ZYRO0B16456g5.708ON54853324460.0
AFR292W5.708ON54153224060.0
TPHA0E001705.708ON57853323510.0
KLTH0E00902g5.708ON54453423400.0
TBLA0E017005.708ON57654223220.0
Kwal_55.196635.708ON54453423110.0
Kpol_1043.755.708ON55852223090.0
Suva_7.275singletonON961061615e-13
TDEL0C063501.67ON693115820.24
SAKL0B05126g8.762ON706119761.2
KNAG0E015105.29ON190136703.0
TPHA0O006001.380ON137268714.5
ADR312W3.168ON66036698.4
KAFR0C052205.500ON149939698.5
TPHA0J025406.239ON866104699.0
NCAS0F00410singletonON1531101699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06633g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...  1139   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1016   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1009   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1002   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1001   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   999   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   994   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   989   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   977   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   970   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   961   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   960   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   948   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   946   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   931   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   910   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   905   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   899   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   894   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   894   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    67   5e-13
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    36   0.24 
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    34   1.2  
KNAG0E01510 Chr5 complement(300496..301068) [573 bp, 190 aa] {ON...    32   3.0  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    32   4.5  
ADR312W Chr4 (1253622..1255604) [1983 bp, 660 aa] {ON} Syntenic ...    31   8.4  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    31   8.5  
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    31   9.0  
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                31   9.6  

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/544 (100%), Positives = 544/544 (100%)

Query: 1   MPSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYS 60
           MPSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYS
Sbjct: 1   MPSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYS 60

Query: 61  GEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAF 120
           GEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAF
Sbjct: 61  GEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAF 120

Query: 121 AGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQD 180
           AGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQD
Sbjct: 121 AGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQD 180

Query: 181 MTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGD 240
           MTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGD
Sbjct: 181 MTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGD 240

Query: 241 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFD 300
           VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFD
Sbjct: 241 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFD 300

Query: 301 AIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLT 360
           AIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLT
Sbjct: 301 AIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLT 360

Query: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRY 420
           CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRY 420

Query: 421 ATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLP 480
           ATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLP
Sbjct: 421 ATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLP 480

Query: 481 IFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAA 540
           IFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAA
Sbjct: 481 IFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAA 540

Query: 541 GPQL 544
           GPQL
Sbjct: 541 GPQL 544

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/547 (87%), Positives = 511/547 (93%), Gaps = 3/547 (0%)

Query: 1   MPSKSSVSGN---SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALI 57
           MPSKS+ +     SVE++IR EL LSKEV  IRRNAPAAVLY+DAL E+KTVI+S+GALI
Sbjct: 1   MPSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALI 60

Query: 58  AYSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVV 117
           AYSGEKTGRSPKDKRIVEEETS+DNVWWGPVNKPCSERTW INRERAADYLRTR+ LY+V
Sbjct: 61  AYSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIV 120

Query: 118 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANAR 177
           DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRP++EELANFGEPDFTVWNAGQFPAN  
Sbjct: 121 DAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMH 180

Query: 178 TQDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIK 237
           TQDM+SK+TIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGIK
Sbjct: 181 TQDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIK 240

Query: 238 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPE 297
           NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPE
Sbjct: 241 NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPE 300

Query: 298 IFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNII 357
           IFDAIRFGSVLENV YD +SHEVDYDDS+ITENTRCAYPI++IPSAKIPCLA +HPKNII
Sbjct: 301 IFDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNII 360

Query: 358 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHP 417
           LLTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP
Sbjct: 361 LLTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHP 420

Query: 418 MRYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFE 477
           +RYA MLA KM EH ANA+LINTGWTGSSYVSGGKRC LKYTRAILDAIHDGSLA+A +E
Sbjct: 421 IRYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYE 480

Query: 478 SLPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDV 537
           SLPIFNL+VP AV GVP ELLNPA+NW++GEAKY  AVS LA LFVENFK YQDKAT DV
Sbjct: 481 SLPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDV 540

Query: 538 LAAGPQL 544
           LAAGP L
Sbjct: 541 LAAGPIL 547

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/546 (86%), Positives = 509/546 (93%), Gaps = 3/546 (0%)

Query: 2   PSK-SSVSGNS--VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58
           PSK ++V+G +  VE++IR EL LS EVT IRRNAPAAVLY+D LKEKKTVISS+GALIA
Sbjct: 3   PSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62

Query: 59  YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118
           YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 119 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 179 QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238
           QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSS NQGIKN
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKN 242

Query: 239 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 299 FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358
           FDAIRFG+VLENV YD  SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 303 FDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 419 RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478
           RYATMLA KM +H ANA+LINTGWTGSSYVSGG RCALKYTRAILD+IHDGSLAKA +ES
Sbjct: 423 RYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYES 482

Query: 479 LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538
           LPIFNLQVP  V GVP+ELLNPA+NWS+GEAKY+ AV+ LA LFVENFK YQD+AT DVL
Sbjct: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVL 542

Query: 539 AAGPQL 544
           AAGPQ 
Sbjct: 543 AAGPQF 548

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/546 (85%), Positives = 505/546 (92%), Gaps = 3/546 (0%)

Query: 2   PSKSSV---SGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58
           PSK +    S + VE++IR EL LS EVT IRRNAPAAVLY+D LKE KTVISS+GALIA
Sbjct: 3   PSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGALIA 62

Query: 59  YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118
           YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 63  YSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 119 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 179 QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238
           QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+N
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242

Query: 239 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 299 FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358
           FDAI+FGSVLENVIYD +SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 303 FDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 419 RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478
           RYATMLA KM +H ANA+LINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLA   +E+
Sbjct: 423 RYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYET 482

Query: 479 LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538
           LPIFNLQVP  V GVP+ELLNPA+NWS+GE+KY+ AV+ LA LFV+NFK YQD+AT DVL
Sbjct: 483 LPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPDVL 542

Query: 539 AAGPQL 544
           AAGPQ 
Sbjct: 543 AAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/537 (86%), Positives = 501/537 (93%)

Query: 8   SGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRS 67
           S + VE++IR EL LS EVT IRRNAPAAVLY+D LKEKKTVISS+GALIAYSG KTGRS
Sbjct: 12  STSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRS 71

Query: 68  PKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKY 127
           PKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VDAFAGWDPKY
Sbjct: 72  PKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKY 131

Query: 128 RIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTI 187
           RIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  TQDM+SK+TI
Sbjct: 132 RIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTI 191

Query: 188 EINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGL 247
           EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+NGDVTLFFGL
Sbjct: 192 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQNGDVTLFFGL 251

Query: 248 SGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSV 307
           SGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIFDAI+FG+V
Sbjct: 252 SGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEIFDAIKFGAV 311

Query: 308 LENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVL 367
           LENV YD +SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIILLTCDASGVL
Sbjct: 312 LENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVL 371

Query: 368 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEK 427
           PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+RYATMLA K
Sbjct: 372 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAAK 431

Query: 428 MHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVP 487
           M +H ANA+LINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLA   +ESLPIFNLQVP
Sbjct: 432 MSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYESLPIFNLQVP 491

Query: 488 KAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
             V+GVP+ELLNPA+NWS+GE KY+ AV+ LA LFVENFK YQD+AT DVLAAGPQ 
Sbjct: 492 TKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPDVLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/546 (85%), Positives = 506/546 (92%), Gaps = 3/546 (0%)

Query: 2   PSK---SSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIA 58
           PSK   ++ S + VE++IR EL LS EVT IRRNAPAAVLY+D LKEKKTVISS+GALIA
Sbjct: 3   PSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIA 62

Query: 59  YSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVD 118
           YSG KTGRSPKDKRIVEE TS+D +WWGPVNKPCSERTW+INRERAADYLRTR+ +Y+VD
Sbjct: 63  YSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVD 122

Query: 119 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANART 178
           AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELA+FGEPDFTVWNAGQFPAN  T
Sbjct: 123 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHT 182

Query: 179 QDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKN 238
           QDM+SK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+N
Sbjct: 183 QDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQN 242

Query: 239 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEI 298
           GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEI
Sbjct: 243 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEPEI 302

Query: 299 FDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIIL 358
           FDAI+FG+VLENV YD +SH VDYDDSSITENTRCAYPID+IPSAKIPCLA +HPKNIIL
Sbjct: 303 FDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIIL 362

Query: 359 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPM 418
           LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+
Sbjct: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 422

Query: 419 RYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478
           RYATMLA KM  H +NA+LINTGW+GSSYVSGGKRC LKYTRAILD+IHDGSLA   +ES
Sbjct: 423 RYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETYES 482

Query: 479 LPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVL 538
           LPIFNLQVP  V+GVP+ELLNPA+NWS+GEAKY+ +V+ LA LFVENFK YQD+AT DVL
Sbjct: 483 LPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPDVL 542

Query: 539 AAGPQL 544
           AAGPQ 
Sbjct: 543 AAGPQF 548

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/533 (85%), Positives = 501/533 (93%)

Query: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71
           VE+ IR ELGLS++VT IRRNAPAAVLY+DAL E+KTVI+S+GALIAYSG KTGRSP+DK
Sbjct: 20  VEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGSKTGRSPRDK 79

Query: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131
           RIVEEETS+DNVWWGPVNKPCSE+TW INRERAADYLRTR+ LY+VDAFAGWDPKYRIKV
Sbjct: 80  RIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAGWDPKYRIKV 139

Query: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191
           RVVCARAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQFPAN  TQDM+SKTTIEINF
Sbjct: 140 RVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMSSKTTIEINF 199

Query: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251
           KAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSS NQGI+NGDVTLFFGLSGTG
Sbjct: 200 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVTLFFGLSGTG 259

Query: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311
           KTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF+AI++GS+LENV
Sbjct: 260 KTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAIKYGSILENV 319

Query: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371
           IYD  +  VDYDD+SITENTRCAYPI++IPSAKIPCLA +HPKNIILLTCDASGVLPPVS
Sbjct: 320 IYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVS 379

Query: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431
           KLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPFL+LHP+RYATMLAEK+  H
Sbjct: 380 KLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYATMLAEKISHH 439

Query: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491
           SA+AWLINTGWTGSSYV+GGKRC LKYTRAILD+IHDGSLAK  +E+LPIFNL VP AV 
Sbjct: 440 SADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIFNLSVPTAVN 499

Query: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           GVP E+LNPA+NWSEGEAKY +AVSKL  LFVENFKTYQD+AT DVLAAGPQ+
Sbjct: 500 GVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGPQI 552

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/535 (85%), Positives = 501/535 (93%)

Query: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPK 69
           N VE++IR EL LSK+VT IRRNAPAA+LY+DAL E+ T+ISS GAL+AYSGEKTGRSP+
Sbjct: 17  NQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPR 76

Query: 70  DKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRI 129
           DKRIVEEETS+D++WWGPVNKPCSERTW+INRERAADYLRTR+ LY+VDAFAGWDP+YRI
Sbjct: 77  DKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRI 136

Query: 130 KVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEI 189
           KVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN  TQDM+SKTTIEI
Sbjct: 137 KVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEI 196

Query: 190 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSG 249
           NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSS NQGI+NGDVTLFFGLSG
Sbjct: 197 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSG 256

Query: 250 TGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLE 309
           TGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPEIF+AI++GS+LE
Sbjct: 257 TGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILE 316

Query: 310 NVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPP 369
           NVIYD ++  V YDDS++TENTRCAYPI+FIPSAKIPCLA  HP NIILLTCDASGVLPP
Sbjct: 317 NVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPP 376

Query: 370 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMH 429
           VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+RYATMLA+K+ 
Sbjct: 377 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKIS 436

Query: 430 EHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKA 489
           +HSANAWLINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLAK EFE+LP+FNLQVP  
Sbjct: 437 KHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTN 496

Query: 490 VEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           V  VP ELLNPA+NW++GEAKY +AVS LA LFVENFK YQDKAT +VLAA P++
Sbjct: 497 VNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/544 (84%), Positives = 500/544 (91%), Gaps = 4/544 (0%)

Query: 2   PSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSG 61
           P+K+    NS EE IR+ELGLS EV  IRRNAPAA+LY+DALKE+ T IS+AGALIAYSG
Sbjct: 3   PTKTQ---NSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSG 59

Query: 62  EKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFA 121
           +KTGRSP+DKRIVEEETS+DNVWWGPVNKPCSERTW INRERAADYLRTR+ +Y+VDA+A
Sbjct: 60  DKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYA 119

Query: 122 GWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDM 181
           GWDP+YRIKVRVVCARAYHALFMTNMLIRP++EEL NFGEPDFTVWNAGQFPAN  T  M
Sbjct: 120 GWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGM 179

Query: 182 TSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDV 241
           TSKTT+EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI++ DV
Sbjct: 180 TSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDV 239

Query: 242 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDA 301
           TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS EKEPEIF+A
Sbjct: 240 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNA 299

Query: 302 IRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTC 361
           I+FGSVLEN+IYD  + EVDY+DS+ITENTRCAYPI++IPSAKIPCLA  HPKNI+LLTC
Sbjct: 300 IKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTC 359

Query: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYA 421
           DASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLSLHPM+YA
Sbjct: 360 DASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYA 419

Query: 422 TMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPI 481
           TMLAEKM EH+ANAWLINTGWTGSSYV+GGKRC LKYTRAILDAIHDGSLAK E+E LPI
Sbjct: 420 TMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPI 479

Query: 482 FNLQVPKAV-EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAA 540
           FNLQ+PKAV + VP+ LLNP++NW+EGEAKY S V  LA LFVENFKTYQDKAT  VLAA
Sbjct: 480 FNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAA 539

Query: 541 GPQL 544
           GPQL
Sbjct: 540 GPQL 543

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/543 (83%), Positives = 495/543 (91%), Gaps = 3/543 (0%)

Query: 2   PSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSG 61
           PSK+  S    E+RIR+EL LS EV  IRRNAPAA+LY+DALKE+KT ISS+GALIAYSG
Sbjct: 3   PSKTYASA---EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSG 59

Query: 62  EKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFA 121
           EKTGRSP+DKRIV+E TS DNVWWGPVNK CSERTW INRERAADYLRTR+ LY+VDA+A
Sbjct: 60  EKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYA 119

Query: 122 GWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDM 181
           GWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN  T  M
Sbjct: 120 GWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGM 179

Query: 182 TSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDV 241
           TSKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI + DV
Sbjct: 180 TSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDV 239

Query: 242 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDA 301
           TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI++A
Sbjct: 240 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNA 299

Query: 302 IRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTC 361
           I+FGSVLENVIY+ ++ EVDY+DSSITENTRCAYPID+IPSAKIPCLA  HP NI+LLTC
Sbjct: 300 IKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTC 359

Query: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYA 421
           DASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YA
Sbjct: 360 DASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYA 419

Query: 422 TMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPI 481
           TMLAEKM +H+ANAWLINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLAK ++E+LP 
Sbjct: 420 TMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPT 479

Query: 482 FNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAG 541
           FNL++P  V  VPSELLNPA+NW EGEAKY SAV  LA LFVENFKTYQD+ATS VL+AG
Sbjct: 480 FNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAG 539

Query: 542 PQL 544
           PQL
Sbjct: 540 PQL 542

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/536 (83%), Positives = 493/536 (91%), Gaps = 1/536 (0%)

Query: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALK-EKKTVISSAGALIAYSGEKTGRSP 68
           N+VE++IR EL LS  VT IRRNAP +VLY+DALK EK T+ISS GALIAYSGEKTGR P
Sbjct: 14  NAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGEKTGRCP 73

Query: 69  KDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYR 128
           KDKRIVEE  S++++WWGPVNKPCSERTW INRERAADYLRTRE +Y+VDAFAGWDPKYR
Sbjct: 74  KDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAGWDPKYR 133

Query: 129 IKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIE 188
           IKVRVVCARAYHALFMTNMLIRPT++EL NFG+PDFTVWNAGQFPAN  T+DM+SKTTIE
Sbjct: 134 IKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMSSKTTIE 193

Query: 189 INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLS 248
           INFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSS N+GI+  DVTLFFGLS
Sbjct: 194 INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVTLFFGLS 253

Query: 249 GTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVL 308
           GTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF++I+FGS+L
Sbjct: 254 GTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSIKFGSIL 313

Query: 309 ENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLP 368
           ENV+YD +S EVDYDDSSITENTRCAYPI+FIPSAKIPC+A +HPKNIILLTCDASGVLP
Sbjct: 314 ENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCDASGVLP 373

Query: 369 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKM 428
           PVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPFL+LHPM+YATMLAEKM
Sbjct: 374 PVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYATMLAEKM 433

Query: 429 HEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPK 488
            +H ANAWLINTGWTGSSY++GGKRC L YTRAILDAIHDGSL K  FE+LPIFNL+VPK
Sbjct: 434 EKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIFNLKVPK 493

Query: 489 AVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
            V  VP++LLNP++NW EGE KY  AV KL+ LF+ENFKTY+DKAT +VLAAGP+L
Sbjct: 494 NVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGPRL 549

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/542 (81%), Positives = 494/542 (91%)

Query: 3   SKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGE 62
           ++S    + VE++IR EL LS EV  IRRNAPAA+LY+DAL EKKT I+S+GALIAYSG+
Sbjct: 7   NRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGALIAYSGD 66

Query: 63  KTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAG 122
           KTGRSPKDKRI+EEETS+DN+WWGPVNKP  E+TW+INRERAADYLRTR  LY+VDAFAG
Sbjct: 67  KTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYIVDAFAG 126

Query: 123 WDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMT 182
           WDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA+FGEPDFTVWNAGQFPAN  TQ M+
Sbjct: 127 WDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANYHTQGMS 186

Query: 183 SKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVT 242
           SKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+  DVT
Sbjct: 187 SKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIQKNDVT 246

Query: 243 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAI 302
           LFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEI++AI
Sbjct: 247 LFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEPEIYNAI 306

Query: 303 RFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCD 362
           +FGS+LENV+YD ++ +VDY+DSSITENTRCAYPI+ IPSAKIPCLA +HP+N++LLTCD
Sbjct: 307 KFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNLVLLTCD 366

Query: 363 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYAT 422
           ASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP+RYAT
Sbjct: 367 ASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIRYAT 426

Query: 423 MLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIF 482
           MLA+KM EH ANAWLINTGWTGSSYV+GGKRC LKYTRAILDAIHDGSLAK  +E+LP F
Sbjct: 427 MLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESYETLPTF 486

Query: 483 NLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGP 542
           NL +P  V GVP ELLNP++NW EGEAKY +AV+ LA LFVENFK YQD+AT +VLAAGP
Sbjct: 487 NLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPEVLAAGP 546

Query: 543 QL 544
           Q+
Sbjct: 547 QV 548

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/535 (82%), Positives = 484/535 (90%)

Query: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPK 69
            S EE+IRSELGLS  V +IRRNAPAA+LY+DAL E+ T ISS GALIAYSGEKTGRSPK
Sbjct: 8   QSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPK 67

Query: 70  DKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRI 129
           DKRIV+E TS + VWWGPVN+  SERTW INRERA DYLRTRE LY+VDAFAGWDP+YRI
Sbjct: 68  DKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRI 127

Query: 130 KVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEI 189
           K+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN  T+ M+SKTT+EI
Sbjct: 128 KIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEI 187

Query: 190 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSG 249
           NFKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQGI  GDVTLFFGLSG
Sbjct: 188 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSG 247

Query: 250 TGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLE 309
           TGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AIR+GSVLE
Sbjct: 248 TGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLE 307

Query: 310 NVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPP 369
           NV+Y+  S  VDYDDSSITENTRCAYPI++IPSAKIPCL+ +HP NI+LLTCDASGVLPP
Sbjct: 308 NVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPP 367

Query: 370 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMH 429
           VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YATMLAEKM 
Sbjct: 368 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMS 427

Query: 430 EHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKA 489
           +H+ANAWLINTGWTG+SYVSGGKRC LKYTRAILDAIH GSLA A++E+LP+F L +P+A
Sbjct: 428 QHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRA 487

Query: 490 VEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           VEGVPSELLNP+RNW EGE KY  AV+ LA LFV+NFK YQD+AT +VL AGPQL
Sbjct: 488 VEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/533 (81%), Positives = 480/533 (90%)

Query: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71
           VEE+IR EL L  EV  IR NAPAA LY+D LKEKKT + S+GAL AYSG KTGRSPKDK
Sbjct: 16  VEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRSPKDK 75

Query: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131
           RI+EEETS++ VWWGPVNKP SE+TW+INRERAADYLRTR+ LY++DA+AGWDP+YRIKV
Sbjct: 76  RIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYRIKV 135

Query: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191
           RV+CARAYHALFMTNMLIRP+ EELANFGEPDFTVWNAGQFPAN  T+ MTSKTT+EINF
Sbjct: 136 RVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVEINF 195

Query: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251
           KAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+ GDVTLFFGLSGTG
Sbjct: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLSGTG 255

Query: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311
           KTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ EKEPEI++AI+FGSVLENV
Sbjct: 256 KTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVLENV 315

Query: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371
           ++D+ + EVDY D+SITENTRCAYPID+IPSAKIPCLA  HP NI+LLTCDASGVLPPVS
Sbjct: 316 VFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLPPVS 375

Query: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431
           KLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPMRYATMLA+KMH+H
Sbjct: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQH 435

Query: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491
           +ANAWL+NTGWTGSSY +GGKRC LKYTRAILD+IHDGSL+KA++E+LPIFNL  P  V 
Sbjct: 436 NANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPAKVN 495

Query: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           GVP  LLNPA++W EG  KY SAV  LA  F ENFK YQD+AT DVLAAGPQ 
Sbjct: 496 GVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGPQF 548

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/532 (81%), Positives = 482/532 (90%), Gaps = 1/532 (0%)

Query: 13  EERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDKR 72
           EE+IR+ELGLS  V  IRRNAPAAVLY+DAL E+KT ISS GALIAYSGEKTGRSPKDKR
Sbjct: 11  EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKR 70

Query: 73  IVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKVR 132
           IV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTRE LY+VDA+AGWDP+YRIK+R
Sbjct: 71  IVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIR 130

Query: 133 VVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINFK 192
           +VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN  T+ M+SKTT+EINF+
Sbjct: 131 IVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFR 190

Query: 193 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGK 252
           AMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQG  N DVTLFFGLSGTGK
Sbjct: 191 AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGK 249

Query: 253 TTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVI 312
           TTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AI++GSVLENV+
Sbjct: 250 TTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVV 309

Query: 313 YDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSK 372
           YD  +  VDY+DSSITENTRCAYPI++IPSA+IPCL+  HP NI+LLTCDASGVLPPVS+
Sbjct: 310 YDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSR 369

Query: 373 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHS 432
           LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YATMLAEKM +H+
Sbjct: 370 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 429

Query: 433 ANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEG 492
           A+AWLINTGWTGSSY +GGKRC LKYTRAILD+IHDG+LA+AE+E+LP+F L +PKAVEG
Sbjct: 430 ASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEG 489

Query: 493 VPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           VP+ELLNPA+NW EGE KY SAVS LA  F ENFK YQD+AT +V+ AGPQ+
Sbjct: 490 VPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/533 (78%), Positives = 468/533 (87%), Gaps = 1/533 (0%)

Query: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71
           +EE I   L  + ++  I+RN P A LY+D LKE KT +SS GALIAYSG KTGRSPKDK
Sbjct: 47  LEEFISDNLS-NHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDK 105

Query: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131
           RIVEEE S+DN+WWGPVNK CSERTWAINRERA DYL TR+TLYV+DAF GWDP+YRIK+
Sbjct: 106 RIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKI 165

Query: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191
           RVVCARAYHALFM NMLIRPT+EEL NFG+PDFTVWNAGQF AN+ T DM+SKT++EINF
Sbjct: 166 RVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINF 225

Query: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251
           K MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQ   NGDVTLFFGLSGTG
Sbjct: 226 KEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTG 285

Query: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311
           KTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI LS+EKEP+IF+AI+FGSVLEN 
Sbjct: 286 KTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENC 345

Query: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371
           IYD E+HEVDYD+S+ITENTRCAYPID+I +AKIPCLA  HP N+ILLTCDASGVLPPVS
Sbjct: 346 IYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVS 405

Query: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431
           KLTPEQVMYHFISGYTSKMAGTE GVTEP+PTFSSCFGQPFL+LHPM+YA+MLAEKM +H
Sbjct: 406 KLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKH 465

Query: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491
            ANAWL+NTGWTGSSYVSGG RC LKYTRAILDAIHDGSL   E+E+LPIFNLQ+PK   
Sbjct: 466 KANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNAN 525

Query: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
           GVPSELLNPA +W++    Y +AV +L  LF ENFKTY+DKAT++V+ AGP L
Sbjct: 526 GVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/534 (78%), Positives = 470/534 (88%)

Query: 11  SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKD 70
           S ++ IR EL L +EV  IRRNAPAA+LY+DALKE KT I+S+GALIA+SG KTGRSPKD
Sbjct: 11  SAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPKD 70

Query: 71  KRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIK 130
           KRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTR+ LY+VDA+AGWDP+YRIK
Sbjct: 71  KRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRIK 130

Query: 131 VRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEIN 190
           +RVVCARAYHALFMTNMLIRPT+EEL NFGEPDFTVWNAGQFPAN  T  MTSKTT+EIN
Sbjct: 131 IRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEIN 190

Query: 191 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGT 250
           F+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI++ DVTLFFGLSGT
Sbjct: 191 FQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSGT 250

Query: 251 GKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLEN 310
           GKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AI+FGSVLEN
Sbjct: 251 GKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLEN 310

Query: 311 VIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPV 370
           V YD  +  VDY+D  ITENTRCAYPI++IPSAKIPCLA +HPKNI+LLTCDASGVLPPV
Sbjct: 311 VAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPPV 370

Query: 371 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHE 430
           SKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL+LHP++YATMLAEKM +
Sbjct: 371 SKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMSQ 430

Query: 431 HSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAV 490
           H ANAWLINTGWTG+S+V GG RC LKYTRAILDA+HDGSLA+ +FE+LP F L VP+ V
Sbjct: 431 HRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRHV 490

Query: 491 EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
             VP  +LNPA+NW EGE KY+  V  LA LF ENFK YQD+A++DV++AGP L
Sbjct: 491 NNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/542 (77%), Positives = 475/542 (87%), Gaps = 8/542 (1%)

Query: 11  SVEERIRSELGL--SKEVTLI--RRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGR 66
           S+E+++ S+L    SK+ +LI  + N  AA+LY+DALKE KTVISS+GALIAYSG KTGR
Sbjct: 35  SMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGR 94

Query: 67  SPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPK 126
           SPKDKRIV E+ S+DNVWWGPVNKPCSE+TW INRER  DYL TR  LYV+DA+ GWDP+
Sbjct: 95  SPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPR 154

Query: 127 YRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTT 186
           YR+KVRVVCARAYHALFMTNMLIRPTEEEL NF EPDFTVWNAG F AN+ T DMTSKT+
Sbjct: 155 YRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTS 214

Query: 187 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFG 246
           +EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSS N+GI+  DVT+FFG
Sbjct: 215 VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFG 274

Query: 247 LSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGS 306
           LSGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGGCYAKCI L+REKEPEIFDAIRFGS
Sbjct: 275 LSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGS 334

Query: 307 VLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGV 366
           VLENV Y+  +H+VDY+D +ITENTRCAYPID+I SAKIPCLA +HPKN+ILLTCDASGV
Sbjct: 335 VLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGV 394

Query: 367 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAE 426
           LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHP+ YATMLA+
Sbjct: 395 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAK 454

Query: 427 KMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQV 486
           KM ++ +NAWLINTGWTGSSY +GG RC LKYTRAILDAIHDG+LA   +E+LP+FNLQ+
Sbjct: 455 KMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQI 514

Query: 487 PKAVEGVPSELLNPARNWSEGEAK----YQSAVSKLAGLFVENFKTYQDKATSDVLAAGP 542
           P  V GVP+E+LNP  +W+    K    Y  AV+KLA LFVENFK YQDKAT DVLAAGP
Sbjct: 515 PTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574

Query: 543 QL 544
           Q+
Sbjct: 575 QV 576

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/534 (77%), Positives = 469/534 (87%)

Query: 11  SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKD 70
           SV++RIR EL L +EV  IRRNAPAA+LY+DALKE KT IS++GALIA+SG KTGRSPKD
Sbjct: 11  SVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFSGSKTGRSPKD 70

Query: 71  KRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIK 130
           KRIV+E TS  N+WWGPVNK CSE+TW +NRERAAD+LRTR+ LY+VDA+AGWDP+YRIK
Sbjct: 71  KRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAYAGWDPRYRIK 130

Query: 131 VRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEIN 190
           +RVVCARAYHALFMTNMLI+PT +EL  FGEPDFTVWNAGQFPAN  T  MTSKTTIEIN
Sbjct: 131 IRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDGMTSKTTIEIN 190

Query: 191 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGT 250
           F+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSS NQGI++ DVTLFFGLSGT
Sbjct: 191 FQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDNDVTLFFGLSGT 250

Query: 251 GKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLEN 310
           GKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AIRFGSVLEN
Sbjct: 251 GKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIRFGSVLEN 310

Query: 311 VIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPV 370
           V YDS + EVD+++  ITENTRCAYPI++IPSAKIPCLA  HPKNI+LLTCDASGVLPPV
Sbjct: 311 VAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLTCDASGVLPPV 370

Query: 371 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHE 430
           SKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL+LHP++YATMLA+KM  
Sbjct: 371 SKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLADKMSH 430

Query: 431 HSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAV 490
           H A+AWLINTGWTG S+V GG RC LKYTRAILDAIHDG+LAK E+E+LP FNL +P  V
Sbjct: 431 HKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLPTFNLHIPLHV 490

Query: 491 EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
             VPS +LNPAR+W  GEAKY++ V  LA LFVENFK Y+  A+++++ AGP L
Sbjct: 491 NNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCAGPLL 544

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/522 (78%), Positives = 459/522 (87%), Gaps = 1/522 (0%)

Query: 23  SKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDKRIVEEETSRDN 82
           +K++T I+RN P A LY+D LKE  T +SS GAL+AYSG KTGRSPKDKRIVEE +S+DN
Sbjct: 38  NKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDN 96

Query: 83  VWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKVRVVCARAYHAL 142
           +WWGPVNKPCSE TW+INRERA DYL TR+ LYV+DA+AGWD  YRIK+RVVCAR YHAL
Sbjct: 97  IWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHAL 156

Query: 143 FMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINFKAMEMVILGTE 202
           FM NMLIRPT EEL NFGEPDFT+WNAG F AN+ T+DMTSKT+IEINFK+MEMVILGTE
Sbjct: 157 FMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTE 216

Query: 203 YAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTLSADPHRL 262
           YAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQG+ NGDVTLFFGLSGTGKTTLSADPHR 
Sbjct: 217 YAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRE 276

Query: 263 LIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDY 322
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF+AI+FGSVLEN +YD  +H VDY
Sbjct: 277 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDY 336

Query: 323 DDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHF 382
           DDS ITENTRCAYPIDFI SAKIPCL   HP N+ILLTCDASGVLPPVSKLTPEQVMYHF
Sbjct: 337 DDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHF 396

Query: 383 ISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGW 442
           ISGYTSKMAGTEQGVTEPEPTFS+CFGQPFL+LHPM+YA MLA+KM+ H A+AWLINTGW
Sbjct: 397 ISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGW 456

Query: 443 TGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPAR 502
           TG+SY +GGKRC LKYTRAILDAIH+GSLA  E+E+LP+FNL +PK VE VPSELLNP++
Sbjct: 457 TGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSK 516

Query: 503 NWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544
            WS+ +  Y  AV KL  LFV+NF  YQD+AT DV+AAGP L
Sbjct: 517 TWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 56/106 (52%), Gaps = 17/106 (16%)

Query: 373 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHS 432
           LT E+VMYHF SG+ S   G                 +PFL+LHP+ Y T++A KM  HS
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAHS 58

Query: 433 ANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFES 478
             A+LINTG+            ALK TR   D+IHD SLAK  F +
Sbjct: 59  --AYLINTGY------------ALK-TRVNFDSIHDDSLAKELFRA 89

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 28/115 (24%)

Query: 226 LTLHSSCNQGIKNG-DVTL-------FFGLSGTGKTTLSA--------DPHRLLIGDDEH 269
            T  +  NQ I +G D+T+         G SG+GK+T+++        +  R++IGD  H
Sbjct: 445 FTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD--H 502

Query: 270 CWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDYDD 324
             +    FN+    Y + + +  ++EP++F+    G++L+N++Y       D DD
Sbjct: 503 NINS---FNVRK--YRRLLGIV-QQEPQLFN----GTILDNILYTVPPERADNDD 547

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 60  SGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWA-INRERAADYL---------R 109
           +  K GR  +DK I++++    N+ W   N+P  ++T++ ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 110 TRETLYVVDAFAGWDPKYRIKVRV---VCARAYHA--LFMTNMLIRPTEEELANFGEPD 163
               L  +      + KY   + +   V  R  H    F   +L + + EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>KNAG0E01510 Chr5 complement(300496..301068) [573 bp, 190 aa] {ON}
           Anc_5.29 YGR273C
          Length = 190

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 15/136 (11%)

Query: 4   KSSVSGNSVEERIRSELGLSKE--VTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSG 61
           KS+VSG+S E++  S++ +SKE    L  R A  A    DA+ E +    +A        
Sbjct: 7   KSNVSGDSAEKKRNSKIEVSKEDAARLKVRTASVADPILDAVHEAQPFEQAADTFHDNMN 66

Query: 62  EKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFA 121
            ++  S +D  ++ +      V+  P+  P          ER  D +R  E  Y V    
Sbjct: 67  RQSYFSQEDGHVLRD------VFGQPITNPDISNPTRARDERPLDTIRAFE--YAVSGDP 118

Query: 122 GW-----DPKYRIKVR 132
            W      P+Y  +VR
Sbjct: 119 VWAQQLETPQYGFRVR 134

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 453 RCALKYTR----AILDAIHD-----GSLAKAEFESLPIFNLQVPKAVEGVPSELLNPARN 503
           +C + +T+    AI   +++      S+ K+E E +PI  +  PK ++ +P E  NP  +
Sbjct: 359 KCPIDHTKYQELAITSKVNNQPITSASIQKSEEEKIPIIQMTSPKIIKNIPLESTNPLPS 418

Query: 504 WSEGEAKY 511
           +    +K+
Sbjct: 419 FHSLASKF 426

>ADR312W Chr4 (1253622..1255604) [1983 bp, 660 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL060C (AMI3)
          Length = 660

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 23/36 (63%)

Query: 490 VEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVEN 525
           +EGVP  ++ PA++W +  +  +  +S   GL++E+
Sbjct: 608 IEGVPKTIIEPAQDWDDSHSAAEFRLSSHRGLYLES 643

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 217 YLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTL 255
           Y +P+ H    L  + +  +K G +T   G SG GKTTL
Sbjct: 858 YDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 10/104 (9%)

Query: 209 KGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDE 268
           K    VM + +P+++N+  L++    G+K+     FF           A   R+ I  DE
Sbjct: 420 KNFKEVMSWSIPLNYNIENLYTGSLLGVKSDGFVYFFDWES------GALIRRIDIDADE 473

Query: 269 HCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVI 312
             WSD G    E        + SR+  P+ +  +   SV E  +
Sbjct: 474 VVWSDNG----ELVMLMSSNSESRDDGPKAYSLLYNRSVFEEAV 513

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 10/101 (9%)

Query: 217 YLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTT-LSADPHRLLIGDD------EH 269
           Y +P+   +  + ++ +  +K G +T   G SG GKTT L     R+ +G          
Sbjct: 874 YEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNG 933

Query: 270 CWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLEN 310
           C  DE      G C  + ++L   K   + +++RF + L  
Sbjct: 934 CLRDESFPRSIGYCQQQDLHL---KTSTVRESLRFSAYLRQ 971

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,300,586
Number of extensions: 2512052
Number of successful extensions: 6569
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6675
Number of HSP's successfully gapped: 31
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)