Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06611g5.706ON1282128266520.0
ZYRO0B16412g5.706ON1372101925800.0
TDEL0B021405.706ON1147124525380.0
Kpol_1043.735.706ON1260128624570.0
SAKL0E15004g5.706ON1196116824410.0
KAFR0H001805.706ON1241103424220.0
KLTH0E00968g5.706ON1148101923380.0
Suva_11.3335.706ON1187104023290.0
Smik_9.185.706ON1118125523090.0
Kwal_55.196785.706ON1178118123020.0
NCAS0A031705.706ON1319108223080.0
Suva_9.375.706ON1117126022880.0
AFR290W5.706ON1217102622720.0
Ecym_40155.706ON1257101122680.0
KLLA0A00528g5.706ON1229102222360.0
CAGL0G02541g5.706ON129571219920.0
Smik_11.3605.706ON118073719300.0
KNAG0C066305.706ON128172619180.0
Skud_11.3365.706ON118874418930.0
Skud_9.175.706ON111896018550.0
YKR096W5.706ON119573718600.0
YIL151C5.706ON111897118210.0
TPHA0E001905.706ON136174518250.0
NDAI0E050705.706ON155638211151e-128
TBLA0E017105.706ON152642210211e-115
TPHA0D046405.706ON9625923196e-29
SAKL0F12210g7.383ON205120734.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06611g
         (1282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...  2566   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   998   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...   982   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   951   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   944   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   937   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   905   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   901   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   894   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   891   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   893   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   885   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   879   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   878   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   865   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   771   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   748   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   743   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   733   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   719   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   721   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   706   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   707   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   434   e-128
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   397   e-115
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   127   6e-29
SAKL0F12210g Chr6 complement(950838..951430,951636..951660) [618...    33   4.0  

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score = 2566 bits (6652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1239/1282 (96%), Positives = 1239/1282 (96%)

Query: 1    MGSSPIEHSIKGKHVYDRKSKLTDXXXXXXXXXXXXXXXPGFTQGLHQKRHNSSANNHTR 60
            MGSSPIEHSIKGKHVYDRKSKLTD               PGFTQGLHQKRHNSSANNHTR
Sbjct: 1    MGSSPIEHSIKGKHVYDRKSKLTDNNFNSNNFINNNNSIPGFTQGLHQKRHNSSANNHTR 60

Query: 61   DTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTPGSRPHSVTKKTSNIDNTDMVGRS 120
            DTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTPGSRPHSVTKKTSNIDNTDMVGRS
Sbjct: 61   DTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTPGSRPHSVTKKTSNIDNTDMVGRS 120

Query: 121  NAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIANSANRVDIPGSPFYLPTRTHS 180
            NAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIANSANRVDIPGSPFYLPTRTHS
Sbjct: 121  NAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIANSANRVDIPGSPFYLPTRTHS 180

Query: 181  NILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNSNLENGEINYNTEVSDFESLPTK 240
            NILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNSNLENGEINYNTEVSDFESLPTK
Sbjct: 181  NILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNSNLENGEINYNTEVSDFESLPTK 240

Query: 241  DANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSA 300
            DANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSA
Sbjct: 241  DANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSA 300

Query: 301  ITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLW 360
            ITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLW
Sbjct: 301  ITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLW 360

Query: 361  VYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMA 420
            VYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMA
Sbjct: 361  VYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMA 420

Query: 421  TALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAF 480
            TALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAF
Sbjct: 421  TALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAF 480

Query: 481  VPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVY 540
            VPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVY
Sbjct: 481  VPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVY 540

Query: 541  FSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLY 600
            FSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLY
Sbjct: 541  FSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLY 600

Query: 601  ELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPP 660
            ELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPP
Sbjct: 601  ELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPP 660

Query: 661  NVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTN 720
            NVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTN
Sbjct: 661  NVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTN 720

Query: 721  SQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSE 780
            SQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSE
Sbjct: 721  SQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSE 780

Query: 781  NEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKF 840
            NEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKF
Sbjct: 781  NEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKF 840

Query: 841  WKRACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLL 900
            WKRACRILFLFKGYAEKFDQGLRLT            FTKKQEKRNIDFLFKFDPTYDLL
Sbjct: 841  WKRACRILFLFKGYAEKFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLL 900

Query: 901  PIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCY 960
            PIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCY
Sbjct: 901  PIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCY 960

Query: 961  YYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKY 1020
            YYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKY
Sbjct: 961  YYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKY 1020

Query: 1021 LECDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRV 1080
            LECDESQESSDHLA                NSRKVDKYYTNQRDLDTIFKTIKINGEMRV
Sbjct: 1021 LECDESQESSDHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRV 1080

Query: 1081 AYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRA 1140
            AYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRA
Sbjct: 1081 AYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRA 1140

Query: 1141 VIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFD 1200
            VIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFD
Sbjct: 1141 VIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFD 1200

Query: 1201 ELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRT 1260
            ELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRT
Sbjct: 1201 ELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRT 1260

Query: 1261 CSTRFIFSICSQLGMKYGICTN 1282
            CSTRFIFSICSQLGMKYGICTN
Sbjct: 1261 CSTRFIFSICSQLGMKYGICTN 1282

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1019 (48%), Positives = 676/1019 (66%), Gaps = 65/1019 (6%)

Query: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
            RS+QAL+ KLQDIYK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L+NNYV F+
Sbjct: 412  RSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFL 471

Query: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            TTALLPSQ++ D+LIG+EI+++Y+IERRLWVYGTITFLD+ K+FSNFMDPE+CCQFI HV
Sbjct: 472  TTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHV 531

Query: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
            FISI+NM   IP K+ IPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  G
Sbjct: 532  FISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 591

Query: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNV 510
            KLYYHM+TVQQN+L AF+NLGKSVFC+D F+P+QQY+QLVIDNIYQRA++ R   +  N 
Sbjct: 592  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNT 651

Query: 511  QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570
            Q+++YLKH+E+M+LP+F+E+ +LQ++  +YF  KFG D    N FDTR MF QN + +++
Sbjct: 652  QLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRY 711

Query: 571  YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI-----KDNEISRQRKKSKTGVDNM 625
            +FRH+P FA++HILQ+VG+G+  N FALL+ELP+F+     K  +   +          M
Sbjct: 712  FFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTM 771

Query: 626  SIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQ 685
            +ID L  + S       G +F ++E +   +++P N++IW +SL Y N T + C M+VLQ
Sbjct: 772  AIDDLEDEQSDRMSTPEG-FFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQ 830

Query: 686  KFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVL 745
            KFL+GP V ALPH +PW YF+IS+A+KI+ L   +S+ FW  F+ RIFPWNTI++FLNVL
Sbjct: 831  KFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVL 890

Query: 746  IAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSET 805
            IA++ DNS   SLV+ LC  YS + L+++L  F+ NE LPEVW CWG+LWFDTI NK ++
Sbjct: 891  IAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQS 950

Query: 806  SYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLT 865
                L++ GIK+  FLDAP DGI FD  D++G  FWKRACRI+FLFKG AE F  G+ L+
Sbjct: 951  HVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLS 1010

Query: 866  XXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQV-YSLFTEKLPAFE 924
                         +     ++  F  +     +L+P++        +        L  FE
Sbjct: 1011 -PVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFE 1069

Query: 925  SISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQL 984
              S  NI +D +P LSVI+GESIFDY GY++L P Y+ YDKNG     ++Y++W A N  
Sbjct: 1070 EASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNT 1129

Query: 985  GN-GLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXX 1043
             N G+ P   +GS   +D   D+    ++E  +F + +E       +D L          
Sbjct: 1130 NNTGVIP--AHGSD--VDSQRDAVQ-SVQEMHIFNQIMEPGYCGGFADDLFLR------- 1177

Query: 1044 XXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYK 1103
                                  D +++T   +        +TYF+ D TTWLRHF HIYK
Sbjct: 1178 ----------------------DALYQTAHSS--------TTYFVLDTTTWLRHFGHIYK 1207

Query: 1104 IAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIA 1163
            +A SG+L F ICLTTF ELRFLR+ +DENV+EAATRA+I +R LY   K++PLRF G +A
Sbjct: 1208 LASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVA 1267

Query: 1164 SHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSAD 1223
            +HIEEHLEFEE+ITWRSHV+EFVIEAV K+Q              + F   N    +  +
Sbjct: 1268 THIEEHLEFEEKITWRSHVDEFVIEAVYKAQ--------------SKFQEMNQLQLEQEE 1313

Query: 1224 TKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
             + +  ++   +     VLVTDD NM  KA+++ +RT ST+F+FS+C+ +G++  ICTN
Sbjct: 1314 QQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1245 (43%), Positives = 748/1245 (60%), Gaps = 153/1245 (12%)

Query: 48   QKRHNSSANNHTRDTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTP-GSRPHSVTK 106
            QKRH+S+  N    T VKRR  V + ++ I  FLD+ +  ++P   C+ P  SR  S T+
Sbjct: 46   QKRHSSNPYNSAESTGVKRR--VANHDDGITQFLDNGAIPNTP---CKEPVSSRRPSATR 100

Query: 107  KTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIANSANRVD 166
            +T        V R+      S  + +++ S + +   P N N   + L   + NS+  V 
Sbjct: 101  RT--------VNRT----PRSTTSYVADASASPYCYSPNNSNLRIDHL-SRMVNSSG-VS 146

Query: 167  IPG---SPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNSNLENG 223
            IP     P +L    H  I+   Q D     +NS EV  +S     N  +E  + N EN 
Sbjct: 147  IPNVCRDPSFLSKEAH--IVSDGQ-DTGTISINSGEVNDQSQDNSAN--DEGRDDNNEN- 200

Query: 224  EINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQDI 283
                       +S+  K++N+      E            ++P+   +S+QAL+ KLQDI
Sbjct: 201  -----------DSIRNKNSNNDNDNNRENNKDNNGNVPSVVVPS--KKSSQALVQKLQDI 247

Query: 284  YKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDL 343
            YK I+ QE+ELQ  CS +T+SQTT+LK++W +YK+N +L+NNYV FITTALLP QS  DL
Sbjct: 248  YKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALLPPQSDQDL 307

Query: 344  LIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPK 403
             IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+C QFI HVFISI+NM   IP 
Sbjct: 308  AIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISISNMLADIPS 367

Query: 404  KFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNS 463
            +++IPW+ RLGDLSRMA ALYP G  DWKLSAE+WY EAMKY YG GKLYYHM+TVQQN+
Sbjct: 368  RYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYHMSTVQQNT 427

Query: 464  LAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLKHNEIMV 523
            L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQRA++ R   +  N Q+++YLKH+E+M+
Sbjct: 428  LEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEYLKHSEVML 487

Query: 524  LPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHI 583
            LP+F+E+ +LQ++  +YF +KFG D   NN FDTR MF QN + +K++FRH+P FA++HI
Sbjct: 488  LPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAPAFAESHI 547

Query: 584  LQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDN-----MSIDTLSFQVSGNE 638
            LQ+VG+G+  N FALL+ELP+ +KD    ++++K+K+ V       M+ID   +  S   
Sbjct: 548  LQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSAMAIDEEEYIDSSFS 607

Query: 639  I-HDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALP 697
            +   V ++F++++++   +  PP++++W  SL+Y N T + C M+VL+KFL+GP V ALP
Sbjct: 608  LGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALP 667

Query: 698  HLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCS 757
            HLLPW YF+I+V  K++ + D  S+ FW   + RIFPWNTI+NFLNVLIA+  DN     
Sbjct: 668  HLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSL 727

Query: 758  LVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKD 817
             ++ LCE  S + LD+++ +F+ NE+LPEVW CWG LWFD I +K +      ++AGIKD
Sbjct: 728  PIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKD 787

Query: 818  VNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXX 877
              FLD P DGI FD +D++G KFWKRACR++FLFK  AE F   L ++            
Sbjct: 788  HMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQVHCRRTDP 847

Query: 878  FTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVP 937
                 +     F FK   T            ++   S+    +  FE  S+ N  +   P
Sbjct: 848  MNHVLKS----FCFKLRDT------------FYNSNSVLQNTIEVFEEGSDANKDMQMTP 891

Query: 938  QLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSS 997
            QLSV++ ESIF YVGYK+LL     YD+ G     ++Y++W                   
Sbjct: 892  QLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW------------------- 932

Query: 998  FIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDK 1057
                G + SKN             E  +S+ +    A                    ++ 
Sbjct: 933  ----GNETSKN-------------EIPQSEPTQQQTANEADLF--------------IEG 961

Query: 1058 YYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLT 1117
              T+  + +  F   K+NG+       T+F+ DAT+WLRHFAH+YK+A + +L F ICLT
Sbjct: 962  INTSLTEFNIDFPECKMNGK------DTFFVLDATSWLRHFAHVYKLASNQVLQFAICLT 1015

Query: 1118 TFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQIT 1177
            TFQELRFLR+S+DENV+EAATRAVI +R LY   +++PLRF G +A+HIEEHLEFEEQIT
Sbjct: 1016 TFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQIT 1075

Query: 1178 WRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSK 1237
            WRSHV+EFV EA+ K+Q              A    EN D                    
Sbjct: 1076 WRSHVDEFVFEAIKKAQ--------------ARLSQENRDFHH----------------- 1104

Query: 1238 VLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
               VLVTDD NM  KA++  I T STRF+F+ C+ +G +  ICTN
Sbjct: 1105 --VVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1286 (44%), Positives = 752/1286 (58%), Gaps = 153/1286 (11%)

Query: 43   TQGLHQKRHNSSANNHTRDTIVKRRLPVQSDENPIGNFLDSFS------KNSSPLQQCRT 96
            T+ L QKRH SS+   T + I K+R+   S  +  GNFLDS S       N + LQ   T
Sbjct: 60   TKNLGQKRHGSSSYYITPNYI-KKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQN--T 116

Query: 97   PGSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAG-PVNKNHTGN-SL 154
            P + P     K +NI NT    +   I         S  SP   N+  P N +   N +L
Sbjct: 117  PLASPKPSIAK-NNIINTSTTPQPTYI------TQDSMTSPFVLNSNLPSNLDIVSNENL 169

Query: 155  LDNIANSANRVDIPGS-------PFYLPTRTHSNILETTQADAP------LH-------- 193
             D+I    +   I  +       P  L  R  S + + +   +P      LH        
Sbjct: 170  EDSIRKDQDFSQINQAIKDKMMRP--LSVRNDSFVYQVSNFPSPENTEPHLHTFEKNTSI 227

Query: 194  ----------PVNSSEVEQESIGPELNLIEEQYNSNLENGEINYNTEVSDFESLPTK-DA 242
                      P N  ++  E+   E N      N+N  NGE   N  V DF  +      
Sbjct: 228  QNYSSNDNIVPDNDMDIGNENANNESNDSNNNNNNNDFNGESGNNGTVEDFNDMSHNVGG 287

Query: 243  NSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAIT 302
            N     + +           S+ P    +S+QAL+ KLQDIYK IL QEVELQ  CS +T
Sbjct: 288  NGDEDKDNKDNGDNNDVPSVSVPPR---KSSQALVQKLQDIYKIILKQEVELQERCSQLT 344

Query: 303  SSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVY 362
            +SQTT++K +W +YK+N +L+NNYV FITTAL PSQS++DLLIG+EI+D+YKIERRLWVY
Sbjct: 345  NSQTTEIKNLWVIYKLNADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVY 404

Query: 363  GTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATA 422
            GTITFLDVLK+FSNFMDPE+CCQFI HVFISI++M D IP+K++IPW  +LGDLSRMA A
Sbjct: 405  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVA 464

Query: 423  LYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVP 482
            L+P G  DWKLSAE WY  AM+Y+YG GKLYYHM+TVQQN+L AF+NLGKSVFC++ FVP
Sbjct: 465  LFPSGFIDWKLSAERWYMAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVP 524

Query: 483  TQQYLQLVIDNIYQRAYISRGEESSS-NVQIL-DYLKHNEIMVLPNFMENFELQRMAYVY 540
            +QQYLQLVIDNIYQRA+  R   S+S N Q+L DYLKH+E+M+LPNFME+ +LQ++  +Y
Sbjct: 525  SQQYLQLVIDNIYQRAFADRNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLY 584

Query: 541  FSEKFGQDFVGNN--FFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFAL 598
            F EKFG D+  NN   F  R MF+QN + +KFYFRH+  FA+A ILQ+VGYGN  N FAL
Sbjct: 585  FMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFAL 644

Query: 599  LYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSF-QVSG---------NEIHDVGEYFNS 648
            L+ LPK++K+    ++++K K  +      + +F  VSG         N      ++FN+
Sbjct: 645  LFSLPKYLKERRDKKEKRKPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNN 704

Query: 649  LENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLIS 708
            ++ +     +P ++ +W  SL+Y N T   C M+VLQKFL GP + ALPH+LPWVYFLIS
Sbjct: 705  IDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLIS 764

Query: 709  VAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQ 768
            +A +IE  +DT    FW  FI+RIFPWN+++ FLNVL+A++ DN    S +N+LC+ Y  
Sbjct: 765  IALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGS 824

Query: 769  LSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKT-AGIKDVNFLDAPYDG 827
            L+L+E+L NF+ NE+LPEVW C GSLWFD I  K  +      T  GIKD  FLD P DG
Sbjct: 825  LNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDG 884

Query: 828  IVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNI 887
            I FDE D+ G KFWKR+ R++FLF+G  E+F+    L                      +
Sbjct: 885  IEFDENDEIGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHL--V 942

Query: 888  DFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESI 947
             + FK     D +  D+               +  FE I  NN   +A+P LS+I GE+I
Sbjct: 943  GYSFKLMAKSDDIMFDDM-------------LVSNFEEIDSNNSDFNAIPLLSMIYGENI 989

Query: 948  FDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSK 1007
            F+YVGYK++   YY +DKNG++   + Y+ W      G    P   N SS      D   
Sbjct: 990  FEYVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAASSD--- 1046

Query: 1008 NFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDLDT 1067
               + EK LF K   C + +  S                        VD+++ N+   D 
Sbjct: 1047 --PMNEKELFNK---CFDPEYDS------------------------VDEFW-NKEIYDD 1076

Query: 1068 IFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRR 1127
            I +  K   E+   Y  TYFI DAT+WLRHFAH+YKIA + +L F ICLTTFQELRFLR+
Sbjct: 1077 IGR--KFGMEL---YEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRK 1131

Query: 1128 SRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVI 1187
            S+DENV+EAATRA+I +R L+   K++PLRF G +A+HIEEHLEFEEQITWRSHV+EFVI
Sbjct: 1132 SKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVI 1191

Query: 1188 EAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDR 1247
            EAV K++      E+HN                                    VLVTDD 
Sbjct: 1192 EAVIKAETKRKEQEMHNMKG------------------------------FQIVLVTDDS 1221

Query: 1248 NMDSKAKERGIRTCSTRFIFSICSQL 1273
            NM +KA E+G +T STRF+F+I + L
Sbjct: 1222 NMKNKALEKGSKTFSTRFVFAISNYL 1247

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/1168 (44%), Positives = 734/1168 (62%), Gaps = 125/1168 (10%)

Query: 165  VDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIG----------------PE 208
             D P SPFYLPT + SN+    +A + +   ++S V+   I                   
Sbjct: 104  ADTPQSPFYLPTTSSSNL----EAASKVITNDNSSVQLPDICIDNKQQPERRQQQRLEKR 159

Query: 209  LNLIEEQYNSNLENGEI--NYNTEVSDFESLPTKDA--------------NSV---TSTE 249
            +N  +++   N  NGE   +   E+   ++ P + +              NSV   +S  
Sbjct: 160  VNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTHADTNQQSDQHNSVQQGSSGG 219

Query: 250  YEKGTRTAMTSHQSILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDL 309
             + G      S   I+      ++QAL+ KLQDIY+SI+ QE+ELQ  CS +T+SQTTD+
Sbjct: 220  SDDGENNRENSGIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDM 279

Query: 310  KKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLD 369
            K +W +YK+N EL+NNY+ FITTALLPSQ + DLLIGQEI+++Y++ERRLWVYGTITFLD
Sbjct: 280  KNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLD 339

Query: 370  VLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGAT 429
            VLK+FSNFMDPE+CCQFI HVF+SI+NM   +P ++SIPW  RLGDLSRMA ALYP G  
Sbjct: 340  VLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFI 399

Query: 430  DWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQL 489
            DWKLSAE+WY +A+ YTYG GKLYYHM+TVQQN+L AF+NLGKSVFC+D F+P+QQY+QL
Sbjct: 400  DWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQL 459

Query: 490  VIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDF 549
            VIDNIYQRA+  R   SS N  I++YLKH+E+M+LP+F+E+ ELQ++   +F ++FG   
Sbjct: 460  VIDNIYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWP 519

Query: 550  VGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDN 609
               +FFD + +F+Q+ E ++++F H+P FA++HILQ+VG+G+  N FA+L+ELPKF+K+ 
Sbjct: 520  NNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKER 579

Query: 610  EISRQRKKS------KTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVD 663
            +  ++R++S       T +D+          +G+    V  YF ++++    ++ P ++ 
Sbjct: 580  KERKERRRSKSSPPLPTNLDDG---------NGSSSISVDHYFENIDSHRVPYSFPQDIQ 630

Query: 664  IWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQY 723
            IW QSL Y N T + C M VL+KFL  P +TALPHLLPW +FL+SVA +I +L     + 
Sbjct: 631  IWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKK 690

Query: 724  FWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEE 783
            FW +F+RRIFPWN++++FLN L+AFL DNS + S V +LCE Y+++ L  ++ +F+ +EE
Sbjct: 691  FWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEE 750

Query: 784  LPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKR 843
            LPEVW CWG+LWFDTI NKSE   S +++ GI+D  FLDAP DGI FD++D++G KFWKR
Sbjct: 751  LPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKR 810

Query: 844  ACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPID 903
            ACR++F+FKG A++F  G+R++             + +++   +  L +F   ++ LP  
Sbjct: 811  ACRVIFMFKGMAKEFHYGIRVS---------DTPISTRRDVTTLHALKRFSFKFEELP-Q 860

Query: 904  EASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYY 963
            E  N+ F     F   +  FE IS  N   +AVP LS+IDGESIF++ GY+++ P YY +
Sbjct: 861  EWDNEVFLQSDNF---IKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCF 917

Query: 964  DKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDD-SKNFEIREKRLFAKY-- 1020
            +KNG++  G++Y+         +GL  R+       I G DD +    +    L A +  
Sbjct: 918  NKNGDLITGSLYT---------SGLLERVA------IQGGDDFNVKRHVENGVLLAAHNS 962

Query: 1021 -LECDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMR 1079
             ++C+E    +                    N      +  + RD       +  N +  
Sbjct: 963  PVDCNERTPET----------MVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSN 1012

Query: 1080 VAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATR 1139
            V    TYF+ DAT+WLRHFAH+YK+A + +L F ICLTTFQELRFLR+S+DE+V+EAATR
Sbjct: 1013 V----TYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATR 1068

Query: 1140 AVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF 1199
            AVI  R LY  +K++PLRF G IA+H+EEHLEFEEQITWRSHV+EFVIEAV KSQ     
Sbjct: 1069 AVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRK--- 1125

Query: 1200 DELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKV-----LSVLVTDDRNMDSKAK 1254
                       F   N+   D      +G     T+ K        VLVTDD NM +KA+
Sbjct: 1126 -----------FKGLNLQARD------QGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAE 1168

Query: 1255 ERGIRTCSTRFIFSICSQLGMKYGICTN 1282
               I   S+RF+F+ C+QLG    +C N
Sbjct: 1169 AHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1034 (47%), Positives = 677/1034 (65%), Gaps = 93/1034 (8%)

Query: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
            ++++ LI KLQ+IYK I+ QE+ELQ  CS +T+SQTT+LK +W +YK+N +L+NNY+ FI
Sbjct: 279  KTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFI 338

Query: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            TTALLPSQS  D+ IG+EI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+C QFI HV
Sbjct: 339  TTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 398

Query: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
            FIS++ M   +P K SIPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  G
Sbjct: 399  FISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 458

Query: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS-SN 509
            KLYYHM+TVQQN+L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQR ++ R +  +  N
Sbjct: 459  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRN 518

Query: 510  VQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVK 569
              ++DYLKH+E+M+LP+F+EN +LQ++   YF+++FG D+  NN F+T+ MF Q   S++
Sbjct: 519  SDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLR 578

Query: 570  FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDN--EISRQRKKSKTGVDNMSI 627
            FYFRH+P FA++HILQ+VG+GN  N FALL++LP F+K+   +  + + KS T +  MSI
Sbjct: 579  FYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMSI 638

Query: 628  DT-------LSFQVSGNEIHDVGEYFNSLENIDKEFTLP---PNVDIWIQSLQYTNTTGI 677
            DT       L+     NE + V EYF   +NID    LP   PN+ +W++SL++ N T +
Sbjct: 639  DTNDSRGPILNTSAYVNEGNIVTEYF---DNIDS-LRLPIDHPNILVWLKSLEHLNMTSL 694

Query: 678  FCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNT 737
             C ++VL+KFL+GP + ALPH+LPW YF+I+   K ++ ++T+S  FW + +RRI PWNT
Sbjct: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754

Query: 738  IINFLNVLIAFLKDNSDSCSLVNQLCETYSQL-SLDEILTNFSENEELPEVWNCWGSLWF 796
            + +FLNVL+A++ DN      + +LCETYS   +  E+L  F+ NE LPE+W CWG+LWF
Sbjct: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWF 814

Query: 797  DTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE 856
            D I NK   +       GI+D  FLD P DGI FDE D+ G  FW RA RI+FLFKG AE
Sbjct: 815  DVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAE 874

Query: 857  KFDQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLF 916
                GLR++              ++ +      L  F  ++ +   DE+S    Q +S  
Sbjct: 875  NLQTGLRVSRTAPVH-------CRRDDIDPNHILKSF--SFKMEGFDESSYSG-QPFSTI 924

Query: 917  TEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYS 976
             + LP FE+I E N+  DA P LSV+ GE+IF+YVGYKKL    + +D+NG +   +IY+
Sbjct: 925  NKLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYT 984

Query: 977  NW------EAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESS 1030
             W         N  GN     M+           + +NF++R    FA       ++++ 
Sbjct: 985  AWVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRN---FAS------NEDTE 1035

Query: 1031 DHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTI--KINGEMRVAYYSTYFI 1088
            D                   N  K++K      D  +I+ T   +IN  +      TYF+
Sbjct: 1036 DDF-----------NFELYMNPEKLNK----NMDQASIWTTANDEINRNI------TYFV 1074

Query: 1089 FDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLY 1148
            FDAT+WLRHFAHIYK++ + +LNF +CLTTFQELRFLR+S+DENV+ AA RA+I +R LY
Sbjct: 1075 FDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLY 1134

Query: 1149 KLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAK 1208
               K++PLRF G +A+ IEEHLEFEEQITWRSHV+EFVIEAV K+Q   +          
Sbjct: 1135 SEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKFI---------- 1184

Query: 1209 ADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFS 1268
                     +A+ + T ++G ++         VLVTDD NM  KA+E+GI+T +T FIFS
Sbjct: 1185 ---------SANESVTLRKGFNHV--------VLVTDDINMKRKAQEQGIKTFTTHFIFS 1227

Query: 1269 ICSQLGMKYGICTN 1282
            +C +LG++  +CTN
Sbjct: 1228 VCRKLGIQDNVCTN 1241

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1019 (47%), Positives = 671/1019 (65%), Gaps = 80/1019 (7%)

Query: 268  TWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYV 327
            T ++++QAL+ KLQDIY++I+ QEVELQ  CS +T SQTTDLK +W +YK+N EL+NNYV
Sbjct: 206  TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265

Query: 328  IFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFI 387
             FITTALLPSQ + DLLIGQEI+++Y+IERRLWV+GTITFLDVLK+FSNFMDPE+CCQFI
Sbjct: 266  AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325

Query: 388  IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTY 447
             HVFISI+NM   +P+KF+ PW  RLGDLSRMA ALYP G  DWKLSAE+WY +A+ + +
Sbjct: 326  THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385

Query: 448  GVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS 507
            G GKLYYHM+TVQQN+L AF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R   + 
Sbjct: 386  GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQ 445

Query: 508  SNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLES 567
             N  +++YLKH+E+M+L +F+E+ ELQ++   +F  KFG      ++F  +++F+Q+ E 
Sbjct: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505

Query: 568  VKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSI 627
             K++FRH+P FA++HILQ+VG+GN  N FALL+ELPKF+K+ +  ++R+KSK+     S+
Sbjct: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSM 565

Query: 628  DTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKF 687
            +  S     + I    EY  S+++    +  P ++ IW QSL + NTT I C  +VLQKF
Sbjct: 566  EAPS---PTSPI----EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKF 618

Query: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747
            L GP V+A  HLLPW YFL+S+A +I+ L     + FW    R++FPWN+I+NFLN++IA
Sbjct: 619  LHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIA 678

Query: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807
            F  DN+   S ++ LCE +  + +  ++ +FS+NE+LPEVW CWG+LWFD I +KS+   
Sbjct: 679  FALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVD 738

Query: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTXX 867
             G     ++D  F D P DGI FDE+D+ G++FWKRACR++F+FKG A++F+ GL L   
Sbjct: 739  EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASV 798

Query: 868  XXXXXXXXXXFTKKQEKRNIDFLFKF-DPTYDLLPIDEASNKYFQVYSLFTEKLPAFESI 926
                          Q     +F FKF DP     P+D  S      Y+L + ++PAFE+I
Sbjct: 799  PLQSRRSLAAGHPLQ-----NFCFKFEDP-----PVDSES------YALISTQMPAFENI 842

Query: 927  SENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGN 986
            SE N+  +A P  S+++G+S+F+  GY++L   +  ++K G +   ++Y++         
Sbjct: 843  SERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS------- 895

Query: 987  GLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXX 1046
                 +E G    I G DD             +Y   DE  + +D+              
Sbjct: 896  -----LEKGP---IHGGDDFNT---------ERYSRSDELNK-ADNPQIKELDKMERMWL 937

Query: 1047 XXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAY 1106
                N   +++ Y    D+   F  +  N +  V    +YF+ DAT+WLRHFAH+YK+A 
Sbjct: 938  DTCMNPEFIEQTY----DMKFPFGDLSCNCDSGV----SYFVPDATSWLRHFAHVYKLAT 989

Query: 1107 SGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHI 1166
            +G+L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  K+++PLRF G +A+H+
Sbjct: 990  NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHL 1049

Query: 1167 EEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQ 1226
            EEHLEFEEQITWRSHV+EFVIEAV K+Q                F+A N      A  K+
Sbjct: 1050 EEHLEFEEQITWRSHVDEFVIEAVYKAQNK--------------FEALN------AQAKE 1089

Query: 1227 RGNSNASTNSKV---LSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
             G+    T  +       LV+DD NM  KA  + IRT S+RF+F++C+Q+G+ +  CTN
Sbjct: 1090 GGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1040 (46%), Positives = 649/1040 (62%), Gaps = 133/1040 (12%)

Query: 266  PTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNN 325
            P    +S+ ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +Y+IN ELVNN
Sbjct: 258  PANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNN 317

Query: 326  YVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQ 385
            YV FITTALLPSQ Q DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQ
Sbjct: 318  YVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 377

Query: 386  FIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKY 445
            FI HVF+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY
Sbjct: 378  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 437

Query: 446  TYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEE 505
             Y  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   
Sbjct: 438  VYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 497

Query: 506  SSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565
            +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN 
Sbjct: 498  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNP 557

Query: 566  ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV--- 622
            +  K++FRH+P FAQ+HILQ+VG+G   N FA+L+ELPK +K+ +  ++RKKS       
Sbjct: 558  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSI 617

Query: 623  -------------DNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEF--TLPPNVDIWIQ 667
                         DN  I  +S   S +E   + E+FN ++ + +    ++  N + W++
Sbjct: 618  TESSTSNSRNENDDNDEI--MSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTN-EAWLE 674

Query: 668  SLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKL 727
            SL++ N T + CGM+VL+KFL GP   ALPH LPW+YF+IS+  K   L D  S+ FW +
Sbjct: 675  SLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIV 734

Query: 728  FIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEV 787
             ++RIFPW+T++ F+N+LIA + DN  +  ++  LC+ YS L+L E+L  F E EELPE+
Sbjct: 735  IVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEI 794

Query: 788  WNCWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRA 844
            W CWG+LWFDTI  K+  S S     +  GIKD   LD+P DGI+FD  D+NG KFWKRA
Sbjct: 795  WGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRA 854

Query: 845  CRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNI--DFLFKFDPTYDLLPI 902
            CR +FLF+  +  F  G+ +                  +  NI  +  +K +P   L   
Sbjct: 855  CRTIFLFRELSRSFQIGVIINNESSINRSSL-------QSNNILGNLSYKLEPLSTL--- 904

Query: 903  DEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYY 962
                       +     +  FE+ SENNI L AVP+LSVI G SIF+Y GYKKL P Y  
Sbjct: 905  ----GSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTC 960

Query: 963  YDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLE 1022
            +DKNG     ++Y++W   N   N   P     S+               EK    ++LE
Sbjct: 961  FDKNGEFLSASLYTSWYVPNGSNN---PETNINSNC--------------EKENEGQFLE 1003

Query: 1023 CDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAY 1082
            C +S +                        R++        DL+T               
Sbjct: 1004 CLKSDD------------------------REI--------DLNT--------------- 1016

Query: 1083 YSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVI 1142
              TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR +I
Sbjct: 1017 --TYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGII 1074

Query: 1143 VIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDEL 1202
             IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE     +L
Sbjct: 1075 TIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQE-----KL 1129

Query: 1203 HNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCS 1262
             N                     Q   S+   N     +L++DD  M  KA+E+ I+T S
Sbjct: 1130 EN-------------------ANQLPVSSCRFN---YVILISDDDTMKKKAEEKKIKTLS 1167

Query: 1263 TRFIFSICSQLGMKYGICTN 1282
            TRF+FS+C++LG +  +CT+
Sbjct: 1168 TRFVFSLCTKLGEQRHLCTD 1187

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1255 (40%), Positives = 727/1255 (57%), Gaps = 182/1255 (14%)

Query: 40   PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97
            P  T  LHQKRH+SS++N T ++   KRR+P   +  P+G  F+D  +      Q   TP
Sbjct: 34   PTTTAFLHQKRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFIDGVTNGQISAQN--TP 89

Query: 98   GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157
                             D V R  +I        +   +P    A               
Sbjct: 90   SK--------------VDDVSRRPSIS-----RKVMESTPQAKTA--------------- 115

Query: 158  IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217
               S + +D+P SP+Y+     +  +E          V S E   E+  P++ + E    
Sbjct: 116  ---SISTMDVPKSPYYVNRTAVARNME----------VVSKESYDENANPQMRIDESLVA 162

Query: 218  SNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALI 277
            SN     I  N++     +LP      V ++      R         LP+   +  Q  I
Sbjct: 163  SN----GIYNNSQPQSQVTLPDIRKAPVVASSPPPVVRQ--------LPSA--QPNQTFI 208

Query: 278  SKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPS 337
             KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI TALL +
Sbjct: 209  KKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTT 268

Query: 338  QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANM 397
            Q   DL++GQEI+D+Y +E+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ FIS++NM
Sbjct: 269  QPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSNM 328

Query: 398  SDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMA 457
             + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH+A
Sbjct: 329  LEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIA 388

Query: 458  TVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSSNV 510
            TVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I RG       E +  N 
Sbjct: 389  TVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAHKNS 448

Query: 511  QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570
            Q++DYLKH E+M+LP+F+EN +LQ +  +YF  KFG+DF GN+ FDT+ MF QN ES+++
Sbjct: 449  QLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPESLRY 508

Query: 571  YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTL 630
            YFRH+P FA++ +LQ++G+GN  N FALL++LPK++K  +  R++K+S       + +T 
Sbjct: 509  YFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSS------ATETP 562

Query: 631  SFQVSGNEIHDVGEYFNSLENIDKEF-TLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQ 689
             ++   ++      YF +++ +   F  +P N++IW++SL + N T I C + VL KFL 
Sbjct: 563  QYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLH 622

Query: 690  GPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFL 749
             PFV ALPH L W+YFL+++  ++ET+       FW  F+RR  PWN++++  NVL+ ++
Sbjct: 623  APFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYM 682

Query: 750  KDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSG 809
             DN      + +  E++    LD+++ +F+ENE LPE+W CWGSLWFD IK K +     
Sbjct: 683  LDNLH--PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIK-KCDV---- 735

Query: 810  LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTXXX 868
            ++  G++D  F D+P DGIVFDE+D+ G +FW R+ R + L KG A+KF D GL++    
Sbjct: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKVN--- 792

Query: 869  XXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISE 928
                     F ++ +     FL KF  T+ L   DE +N          E +   E I  
Sbjct: 793  ----FQAPVFCRRNDIPQDYFLRKF--TFKLDAYDEGNNNDNNELDELYETIEINEKIDN 846

Query: 929  NNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGL 988
             N+ L A P LSV+ GESIF+Y GY +L P Y+ +DKNG  N   IYS W   + +GNG+
Sbjct: 847  VNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW---SNVGNGV 903

Query: 989  KPRMENGSSFIIDGLDDSKNFE-IREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXXX 1047
               + N   + +   D S ++E I   R+ A Y  CDE+                     
Sbjct: 904  PIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDEN--------------------- 942

Query: 1048 XXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYS 1107
                            D  TI+  +     +R                 HFAHI+K+A +
Sbjct: 943  ----------------DNCTIYFVVDATSWLR-----------------HFAHIFKLAKN 969

Query: 1108 GLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIE 1167
             +L+F ICLTTFQELR+LR S+D+NV+EAATR+VI IR LY  +K+IP+RF G IA+H+E
Sbjct: 970  SILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVE 1029

Query: 1168 EHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQR 1227
            E+LEFEEQITW++HV+EFVI+A+AK  +N              F  E M   +    KQ 
Sbjct: 1030 ENLEFEEQITWKTHVDEFVIDAIAKLNQN--------------FQTERMIAENKNKNKQ- 1074

Query: 1228 GNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
                        +VLVTDD NM+ KAK++ I+TC+T+++FS+ S+LG+  G+CTN
Sbjct: 1075 -----------FAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1181 (42%), Positives = 718/1181 (60%), Gaps = 139/1181 (11%)

Query: 157  NIANSANRVDIPGSPFYLPTRTHSNI------------------LETTQADAPLHPVNSS 198
             + +S    D   SP YLPT + SN+                  +E  + D   H V  +
Sbjct: 82   GMPHSVMSADNAYSPSYLPTTSSSNLEAAVTENENGSVNFPDICIERQRTDP--HSVRYT 139

Query: 199  EVEQESIGPELNLIEEQYNSNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTA- 257
              EQ ++ P+ +   E  +++  +   N     S    LPT D +    +  E  +R++ 
Sbjct: 140  RTEQGNVRPQSH---ESLSNHQHHTLPNSIQGGSSSAGLPTGDQDFREGSTPENSSRSSR 196

Query: 258  ------------------------------MTSHQSILPTTWNRSTQALISKLQDIYKSI 287
                                            + Q++ P++ + ++QAL+ KLQDIY++I
Sbjct: 197  HGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSS-SPTSQALVQKLQDIYRNI 255

Query: 288  LVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQ 347
            + QEVELQ  C+ +T+SQTTDLK +W +YKIN+EL+NNYV FITTALLPSQ + DLLIGQ
Sbjct: 256  VKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALLPSQPEQDLLIGQ 315

Query: 348  EIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSI 407
            EI+++Y+IERRLWV+GTITFLDVLK+FSNFMDPE+CCQFI HVFISI+ M   +P+KFS 
Sbjct: 316  EIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISTMLGDMPQKFST 375

Query: 408  PWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAF 467
            PWF RLGDLSRMA ALYP G  DWKLSAE+WY +A+ + +G GKLYYHM+TVQQN+L AF
Sbjct: 376  PWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYHMSTVQQNTLEAF 435

Query: 468  INLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNF 527
            +NLGKSVFCRD F+P+ QY+QLVIDNIYQRA+  R   +  N  +++YLKH+E+M+L +F
Sbjct: 436  VNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEYLKHSEVMLLSSF 495

Query: 528  MENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVV 587
            +E+ ELQ++   +F  KFG      +FF+ R MF+Q+ E VK++FRH+P FA++HILQ V
Sbjct: 496  LESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHAPAFAESHILQTV 555

Query: 588  GYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFN 647
            G+G+  N FALL+ELPKF+K+ +  ++R+KSK+     SI+T S  +S +E         
Sbjct: 556  GFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSIETTS-HLSPSEY-------- 606

Query: 648  SLENIDK---EFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVY 704
             LEN+D     +  P ++ IW +SL + N T   C  +V QKFL+GP V A+ H+LPW Y
Sbjct: 607  -LENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSY 665

Query: 705  FLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCE 764
            FL+S+A KI++L     + FW   +R+IFPWN+I++FLN+L+AF+ DN+   S ++ LCE
Sbjct: 666  FLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCE 725

Query: 765  TYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAP 824
                +    ++ +FSE+E+LPE+W CWG+LWFD I +KS      +  +G KD  F D P
Sbjct: 726  QLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHPFWDLP 785

Query: 825  YDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEK 884
             DGI FDE+D+ G KFWKRACR++F+FKG A++F  GL L+             T     
Sbjct: 786  GDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLS---AFAPQSRRPMTAGHPL 842

Query: 885  RNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDG 944
            +N  F F+  P               Q+ S    ++P FE I+  N+  +  P  S+++G
Sbjct: 843  QNFSFNFEEIPAQS------------QIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEG 890

Query: 945  ESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLD 1004
            ESIFD+ GY+++   Y  ++K+G++   ++Y++             ++E G    I G D
Sbjct: 891  ESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS------------GKLERGP---IQGGD 935

Query: 1005 DSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRD 1064
            D             +Y   ++S +  ++                  N   +++ Y    +
Sbjct: 936  DFNT---------ERYGRSEDSNK-PENAQITELERLERDWLDNCMNPEFIEQAY----E 981

Query: 1065 LDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRF 1124
            +   F  +  N +  V    +YF+ DAT+WLRHFAH++K+A + +L F ICLTTFQELRF
Sbjct: 982  MKFPFGDLSCNCDSGV----SYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRF 1037

Query: 1125 LRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNE 1184
            LR+S+DE+V+EAATRAVI +R LY  KK++PLRF G +A+H+EEHLEFEEQITWRSHV+E
Sbjct: 1038 LRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDE 1097

Query: 1185 FVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKV---LSV 1241
            FVIEAV K+Q+               F+A N      A  K+ G+   +T  +       
Sbjct: 1098 FVIEAVYKAQKK--------------FEAIN------AQAKEAGHDFIATTDEEPFHFVA 1137

Query: 1242 LVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
            LV+DD NM  KA  + I+T STRF+F++C+Q+G+ +  CTN
Sbjct: 1138 LVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1082 (45%), Positives = 665/1082 (61%), Gaps = 127/1082 (11%)

Query: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
            ++ +AL+ KLQDIYK I+ QE+ELQ  CS +T+SQTTDLK +W +YK+N++L+NNYV FI
Sbjct: 295  KTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFI 354

Query: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            TTALL SQSQ DL IG+EII++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI HV
Sbjct: 355  TTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 414

Query: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
            FIS++ M   IP K+SIPW  RLGDLSRMA ALYP G  DWKLSAE WY EAMK+TY  G
Sbjct: 415  FISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHG 474

Query: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNV 510
            KLYYHM+TVQQN+L AF+NLGKSVFC++ F P+QQY+QLVIDNIYQRA++ R   ++ N+
Sbjct: 475  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNL 534

Query: 511  QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFG--------------QDFVGNN--- 553
            Q+++YLKH+E+M+LP F+EN ELQ++  +YF EKFG               + + NN   
Sbjct: 535  QLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594

Query: 554  --FFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDN-- 609
               F +R MF+QN E +K++FRH+P FA++HILQ+VG+G+  N FALL+ELPK++K+   
Sbjct: 595  IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKD 654

Query: 610  -----------------EISRQRKKSKTGVDN--MSIDTLSFQVSGNEIHDVG--EYFNS 648
                               S     S   +DN  M  D ++   S N ++ V   E+F +
Sbjct: 655  KKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQN 714

Query: 649  LENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLIS 708
            +E +  ++ +P +++IW+ SL + N   + C M+VL+KFL GP + ALPHLLPW YF+IS
Sbjct: 715  IEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIIS 774

Query: 709  VAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDN--------------SD 754
            +  K E L   +S+ FW   ++ IFPWN IINFLNVL+ +  DN               D
Sbjct: 775  ILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKD 834

Query: 755  SCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAG 814
                +  LC  YS +   ++L +F+ENE+LPEVW CWG+LWFDTI NK+       +  G
Sbjct: 835  MNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLG 894

Query: 815  IKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQ-GLRLTXXXXX--- 870
            IKD  FLD P DGI +  ED+ G  FWKR  RI+FLFKG AE FD  GL+++        
Sbjct: 895  IKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYR 954

Query: 871  -----XXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFES 925
                        F+ K    N D++       D    DE       + +  TE +   E 
Sbjct: 955  NNNVPMDNILKMFSFKWAGSNADYV-------DANLGDELEIYTNTIINRITEFVDIKEP 1007

Query: 926  ISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEA-FNQL 984
            I E N+  +  P  S+I  E IFDY GYKKL P    +DKNG  + G+IY+ W   ++QL
Sbjct: 1008 IHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQL 1067

Query: 985  GNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXX 1044
               +  +  N ++   D + D          LF   L  DE                   
Sbjct: 1068 ---ILAQNNNNNTNATDEMTD----------LFTGTLSIDE------------------- 1095

Query: 1045 XXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKI 1104
                  + R++ +     RD  T+  +       R   Y TYF+FDAT+WLRHFAHIYK+
Sbjct: 1096 -----LSFRQLKR--PEFRDKSTLLSSTSTEPFNR---YKTYFVFDATSWLRHFAHIYKL 1145

Query: 1105 AYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIAS 1164
            A + +L F +CLTTFQELRFLR+S+D NV+EA+TRA+I +R LY    ++PLRF G +A+
Sbjct: 1146 ASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVAT 1205

Query: 1165 HIEEHLEFEEQITWRSHVNEFVIEAVAKSQE----NGMFDELHNESAKADFDAENMDTAD 1220
             IEEHLEFEEQITWRSHV+EFVIEAV K+QE    +   + +   S   + DA    T  
Sbjct: 1206 DIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEGTSNWGEIDATT--TTV 1263

Query: 1221 SADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGIC 1280
            SA+ +++ N           VL+TDD +M  KA+ +GI T  T+ +FS+CS +G+  G+C
Sbjct: 1264 SAEEEEKSNLFKYV------VLITDDDSMRMKAQLKGISTFGTQVVFSVCSMMGIDEGVC 1317

Query: 1281 TN 1282
            TN
Sbjct: 1318 TN 1319

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1260 (41%), Positives = 728/1260 (57%), Gaps = 193/1260 (15%)

Query: 40   PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97
            P     LHQKRH+SS++N T ++   KRR+P   +  P+G  F+D  + +   +Q     
Sbjct: 34   PTTAAFLHQKRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFIDGITTSQISMQ----- 86

Query: 98   GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157
                 ++  K  +I     + R                           K       L  
Sbjct: 87   -----NIPFKAEDISRRPSISR---------------------------KAMETTPQLHT 114

Query: 158  IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217
             +NSA  +DIP SP+Y+     +  +E          V S E   E+ GP+    +    
Sbjct: 115  SSNSA--MDIPKSPYYVNRTAITRNME----------VVSKESHDEN-GPQTRADDSLTT 161

Query: 218  SN--LENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQA 275
            S     N +      +SD  + P   ANS+ S   +             LP+   +  Q 
Sbjct: 162  STGIYANSQPQSQITLSDTRAAPIV-ANSLPSVTRQ-------------LPSA--QPNQT 205

Query: 276  LISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALL 335
             I KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +YK+N EL+ NY+ FI TALL
Sbjct: 206  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITALL 265

Query: 336  PSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIA 395
             +Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK FSNFMDPE+CCQFI + FI I+
Sbjct: 266  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICIS 325

Query: 396  NMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYH 455
            NM + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH
Sbjct: 326  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 385

Query: 456  MATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSS 508
            +AT+QQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R        E +  
Sbjct: 386  IATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAHR 445

Query: 509  NVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESV 568
            N Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ F T+ MF QN ES+
Sbjct: 446  NSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPESL 505

Query: 569  KFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSID 628
            ++YFRH+P FA++ ILQ++G+GN  N FALL++LPK +K  +  R++KKS         D
Sbjct: 506  RYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAAEIPHYRD 565

Query: 629  TLSFQVSGNEIHDVGEYFNSLENIDKEFTLPP-NVDIWIQSLQYTNTTGIFCGMMVLQKF 687
                Q S         YF +++ ++ +F  PP N+ IW+ SL Y N T I C + VL KF
Sbjct: 566  PFDDQGSSE------SYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKF 619

Query: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747
            L  P   ALPH L W++F+I+V  K+ET+       FW  F+RR  PWN+++ F NVL+ 
Sbjct: 620  LHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVC 679

Query: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807
            ++ DN      + +  E +  L LD+++  F+ENE LPEVW CWGSLWFD +K K +   
Sbjct: 680  YMLDNLH--PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK-KCDV-- 734

Query: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTX 866
              ++  G++D  F D+P DGIVFD++D+ G KFW R+ R +   KG A+KF D GL++  
Sbjct: 735  --MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDLGLKVN- 791

Query: 867  XXXXXXXXXXXFTKKQEKRNIDFL----FKFDPTYDLLPIDEASNKYFQVYSLFTEKLPA 922
                       F ++ +     FL    FK DP Y+    ++A N   ++  L+ + +  
Sbjct: 792  ------FQASVFCRRNDISPDYFLKNLTFKLDP-YE----EDAFNDNNELDELY-DTIEI 839

Query: 923  FESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFN 982
             E I   NI L A P+LSV+ GESIF+Y GY +L   Y+ +DKNG  N   IY+ W   +
Sbjct: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW---S 896

Query: 983  QLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXX 1042
             +GNG+   + + S +     D + N                   + S H A        
Sbjct: 897  NVGNGVTLDVSSESLY-----DSTTN-------------------DLSLHWAKIL----- 927

Query: 1043 XXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIY 1102
                         DK +T  ++ D        +G   V +     + DAT+WLRHFAHI+
Sbjct: 928  ------------FDKVFTIGKNTDD-------DGSCSVYF-----VIDATSWLRHFAHIF 963

Query: 1103 KIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKI 1162
            K+A + +L F ICLTTFQELR+LR S+D+NV+EAATR+VI IR LY  KK+IP+RF G I
Sbjct: 964  KLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNI 1023

Query: 1163 ASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSA 1222
            A+HIEE+LEFEEQITW++HV+EFVI+A+AK  +N              F  E   T D  
Sbjct: 1024 ATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQN--------------FQTER--TID-- 1065

Query: 1223 DTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
              K +G       SK  +VLVTDD NM+ KAK++ I+TC+T+++FS+ S+LG+  G+CTN
Sbjct: 1066 --KNKG------RSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1026 (45%), Positives = 661/1026 (64%), Gaps = 90/1026 (8%)

Query: 265  LPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVN 324
            +  T  +S+QAL+ KLQ+IY++I+ QE ELQ  CS +T+SQTTDLK +W +YK+N EL++
Sbjct: 274  VAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELID 333

Query: 325  NYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICC 384
            NY +FITTALLP+Q + DLLIG+EII+VY+IERRLWVYGTITFLDVLK+FSNFMDPE+CC
Sbjct: 334  NYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 393

Query: 385  QFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMK 444
            QFII+VFISI+NM   IP KFSI W  RLGDLSRMA ALYP G  DWKLSAE+WY EA+K
Sbjct: 394  QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALK 453

Query: 445  YTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGE 504
            YT+G GKLYYHM+TVQQN+LAAF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R  
Sbjct: 454  YTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS 513

Query: 505  ESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNN--FFDTRSMFV 562
                N  +++YLKH E+M+LP+F+E+ ELQ +   +F +KFG   V +N  FFD R +FV
Sbjct: 514  GHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFG---VTSNVDFFDPRLVFV 570

Query: 563  QNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSK--- 619
            Q+ E +K +FRH+ L+A++H+LQ+VG+G+  N FALL+ELPK +K+ +  R+++KSK   
Sbjct: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSST 630

Query: 620  -TGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIF 678
             T  D    D  +F           E+F ++++    +  P +++IW +SL Y N T + 
Sbjct: 631  STQYDTSIDDDCAFAAP-------SEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMK 683

Query: 679  CGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTI 738
            C M+VL+KFL GP +TALPHLLPW YFL +   ++ T+     + FW   +R++FP+NTI
Sbjct: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743

Query: 739  INFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDT 798
            I FLNVL+ ++ + + +    ++  E +  +SL +++  F ENEELPEVW CWG+LWFD 
Sbjct: 744  ITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDA 803

Query: 799  IKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF 858
            +  K  T+ + + + G+KD  F+D+P DGI FD  D++G KFWKR  R++ LF+  A + 
Sbjct: 804  LNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALEC 863

Query: 859  DQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTE 918
              GLR               +  +  R++  +FKF+      P  E  + Y + ++L  +
Sbjct: 864  PVGLR-------------EISGGRNWRSL--VFKFEE-----PPSEWCDMYLEPFTLVFD 903

Query: 919  KLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNW 978
                FE IS  N+   A P   +     I    GY+ LLP YY +++NG++  G++Y+  
Sbjct: 904  ---TFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT-- 958

Query: 979  EAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXX 1038
                 +G      +  G  F    L ++      E+R +   ++ +E     + L     
Sbjct: 959  -----IGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLR---- 1009

Query: 1039 XXXXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMR--VAYYSTYFIFDATTWLR 1096
                                +T+ ++ D  ++ +   G++      + TYF+ DATTWLR
Sbjct: 1010 --------------------HTHCKN-DVRWEQMLPRGDLHCFADTHVTYFVLDATTWLR 1048

Query: 1097 HFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPL 1156
            HF H+YK+A + +L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++PL
Sbjct: 1049 HFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPL 1108

Query: 1157 RFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENM 1216
            RF G +A H+EEHLE EEQ+TWRSHV+EFVIEA+ K+Q+   F+ L++++  A  D    
Sbjct: 1109 RFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDK--FNALNDDAKAASRDC--- 1163

Query: 1217 DTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMK 1276
                 AD  QR N  A         LVTDD NM +KA  + I+  STRF+FS+C++LG  
Sbjct: 1164 -IPTGAD--QRFNFIA---------LVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHA 1211

Query: 1277 YGICTN 1282
              +CTN
Sbjct: 1212 KNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1011 (46%), Positives = 656/1011 (64%), Gaps = 72/1011 (7%)

Query: 272  STQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFIT 331
            S+Q L+ KLQ+IYK+I+ QE ELQ  CS +T+SQTTDLK +W +YK+N EL++NY  FIT
Sbjct: 319  SSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFIT 378

Query: 332  TALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVF 391
            TALLP+Q + DLLIGQEII+VY+IERRLW+YGTITFLDVLK+FSNFMDPE+CCQFI++VF
Sbjct: 379  TALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVF 438

Query: 392  ISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGK 451
            ISI+N+   IP  FS+ W  RLGDLSRMA ALYP G  DWKLSAE+WY EA+KY +G GK
Sbjct: 439  ISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGK 498

Query: 452  LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQ 511
            LYYHM+TVQQN+LAAF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R         
Sbjct: 499  LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSH 558

Query: 512  ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFY 571
            I++YLKH E+M+LP+F+EN E Q +   +F +KFG      NFFD   +FVQ+ E +K +
Sbjct: 559  IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERLKHF 617

Query: 572  FRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLS 631
            FRH+ L+A++HILQ+VG+G+  N FALL+ELPK IK+ +  ++++KSK+   N S     
Sbjct: 618  FRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQS----D 673

Query: 632  FQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGP 691
              +    + D  ++F +L +    +    +++IW +SL Y N T + C M+VL+KFL   
Sbjct: 674  MSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSS 733

Query: 692  FVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKD 751
             +TALPHLLPW YFL++V  +++ +R+ +S+ FW +FIR+IFPW +I NFLNVL+ ++ D
Sbjct: 734  LLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYIND 793

Query: 752  NSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLK 811
               +   +++    Y  + L E+L  F ENE+LPEVWNCWG+LWFD I +K  ++   + 
Sbjct: 794  QKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIH 853

Query: 812  TAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTXXXXXX 871
            + G+KD  FLDAP DGI FD  D++G KFWKR  R++ LF+G A +F  G          
Sbjct: 854  STGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGF--------- 904

Query: 872  XXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNI 931
                  F    + +++  +FKF+      P  E   +Y      F+++   FESIS  N 
Sbjct: 905  ----TEFNGSDDWKSL--VFKFNE-----PPAEWKEQYL---GSFSKEYGEFESISFVNT 950

Query: 932  ILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPR 991
             L + P   ++ G  I    GYK+L+P Y  ++KNG++  G++Y++    ++ G+G+   
Sbjct: 951  DLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTS--GMSEGGSGVP-- 1006

Query: 992  MENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXXXXXXXXXXXN 1051
                        +DS++F   ++ L  + L   E ++ ++ L                 +
Sbjct: 1007 ------------NDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSS 1054

Query: 1052 SRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLN 1111
            +    +    + DL     T           + TYF+ DATTWLRHF H+YK+A S LL 
Sbjct: 1055 TNSRWEQCLPRGDLQYFTDT-----------HVTYFVLDATTWLRHFGHVYKLATSNLLK 1103

Query: 1112 FVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLE 1171
            F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++PLRF G +A H+EEHLE
Sbjct: 1104 FAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLE 1163

Query: 1172 FEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGNSN 1231
             EEQ+TWRSHV+EFVIEA+ K+Q    F++L N+ AKA    E++ T D       G  N
Sbjct: 1164 IEEQMTWRSHVDEFVIEAIDKAQSK--FNQL-NKDAKAS-GRESITTIDD------GKFN 1213

Query: 1232 ASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
                      LVTDD NM +KA+ + IR  ST+F+F+IC ++G+   +CT+
Sbjct: 1214 -------FIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1022 (45%), Positives = 650/1022 (63%), Gaps = 91/1022 (8%)

Query: 276  LISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALL 335
            L+ KLQ+IYKSI+ QE ELQ  CS +T+ QTTDLK +W  YKIN EL++NY++FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 336  PSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIA 395
            PSQS++ L IGQEI+DVY+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI +VFI+++
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 396  NMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYH 455
            NM + +P K+SIPW  RLGDLSRMA ALYP G  DWKLSAE+WY E++K+T+G GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 456  MATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQILDY 515
            M+TVQQN+L AF+NLGKSVFC D FVP+ QY+QLVIDNIYQRA+  R    +    I+DY
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 516  LKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFRHS 575
            LKH E+M+LP+F+E+ ELQ +   YF  KFG    G NFFD   +F+Q+ E +K +FRHS
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 576  PLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVS 635
             LF+Q+HILQ+ G+G+  N FA+L+EL K +K  +  ++RKKS       S+D + F  S
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEF--S 640

Query: 636  GNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTA 695
              +     ++F+++++    +  P ++ +W +SL Y N T + CGM+VL++FL GP VTA
Sbjct: 641  SQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTA 700

Query: 696  LPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDS 755
            LPH+LPW+ F+IS+  +++ + D   + FW +FIRRIFPW+++I F+N LI +       
Sbjct: 701  LPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTK 760

Query: 756  CSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGI 815
               ++    TY  ++ +E+LT+  ENE LPE W+CWGSLWF+TI  KS+   + L++ G+
Sbjct: 761  NFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGL 820

Query: 816  KDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE-----KFDQGLRLTXXXXX 870
             D  FLD+P +GI FD++D+ G K+W+R CR L LF    E      +  G +       
Sbjct: 821  SDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLN---- 876

Query: 871  XXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLP--AFESISE 928
                     +    +N+ F F  D T D L +        ++Y    E  P   FE IS 
Sbjct: 877  --------PEATSWKNLVFRFN-DDTNDQLSV--------ELYPEENESFPFEKFEIISN 919

Query: 929  NNI---ILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSN--WEAFN- 982
             N    + D     S+I G SI +  G+K + P Y+ ++KNG++   ++Y+    E  N 
Sbjct: 920  LNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANI 977

Query: 983  QLGNGLKPR--MENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXX 1040
            Q G+       ++NG   + D L+ S   +  E+     ++  D                
Sbjct: 978  QGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPD---------------- 1021

Query: 1041 XXXXXXXXXXNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAH 1100
                                 QR+L  + ++   N   +     T+F+ DATTWLRHFAH
Sbjct: 1022 -------------------FRQREL--LNRSFLGNLNCQADTNVTFFVLDATTWLRHFAH 1060

Query: 1101 IYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNG 1160
            IYK+A S +L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++ LRF G
Sbjct: 1061 IYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTG 1120

Query: 1161 KIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTAD 1220
             +A H+EEHLE EEQ+TW+SHV+EFVI+A+AK+Q+   F+ L+N++ +   D   +  ++
Sbjct: 1121 NVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK--FNVLNNDAIEKGKDC--IPLSE 1176

Query: 1221 SADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGIC 1280
               + QR N            LVTDD NM +KA++ GIRT STRF+F+IC +LG + G+C
Sbjct: 1177 DGQSTQRFN---------FVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVC 1227

Query: 1281 TN 1282
            TN
Sbjct: 1228 TN 1229

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/712 (52%), Positives = 496/712 (69%), Gaps = 12/712 (1%)

Query: 270  NRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIF 329
            N+ TQAL+ KLQDIYK+I+ QEVELQ  C+ +TSSQTTDL  IW +Y+INVELV NYV F
Sbjct: 364  NKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTF 423

Query: 330  ITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIH 389
            I+TALL SQSQ DL+IGQEI++ Y+I RRLWVYGTITFLDVLK+FS+FMDPE+C QFI H
Sbjct: 424  ISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITH 483

Query: 390  VFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGV 449
            VFISI+ M   IP K+SIPW  RLGDLSRMA ALYP G  DWKLS+EYWY +A+KYTYG 
Sbjct: 484  VFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGY 543

Query: 450  GKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSN 509
            GKLYYHM+T+QQN+L AF+NLGKSVFC+D F+P+ QY+QLVIDNIYQRA+I RG  ++ N
Sbjct: 544  GKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRN 603

Query: 510  VQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVK 569
             Q+++YLKH+E+M+LPNF+ N  LQ++   YF  KFG D    N F  R +F+QN E++K
Sbjct: 604  SQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLK 663

Query: 570  FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELP---KFIKDNEISRQRKKSKTGVDNMS 626
            ++FRH+P FA++HILQ VG+G+  N FALL++LP   K  KD +  ++ K S     N S
Sbjct: 664  YFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNES 723

Query: 627  IDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQK 686
            + +L   +S + +    +YF++LE++   +  PP  DIW++SL Y N T + CG++VL+K
Sbjct: 724  VMSLD-NISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRK 782

Query: 687  FLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLI 746
            FL GPFV ALPHL+ W YF+ISV  K ETL D  S+YFW  F+RR+ P N+I++FLNVLI
Sbjct: 783  FLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLI 842

Query: 747  AFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETS 806
            A+  DNS   +L++ + E    + L E+LT F+ NEELPEVW CWG+LWFD I +KS T 
Sbjct: 843  AYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTD 902

Query: 807  YSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTX 866
             +  +  G+ D  F D+P DGIVFD +D+NG KFWKRA RI+FLFK  AE FD G+ L+ 
Sbjct: 903  TNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSH 962

Query: 867  XXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESI 926
                            E  +I   F F     LL     +    ++ +     +   E  
Sbjct: 963  TAPVYCRRDDV-----ELNHILGSFSFKIEQHLL---NGNTVQVEIENCLGAIIEMTEMP 1014

Query: 927  SENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNW 978
            +E NI +DA P +S+ + E+IF+Y GYK++ P    +DKNG +   A Y++W
Sbjct: 1015 NEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW 1066

 Score =  196 bits (498), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 133/199 (66%), Gaps = 27/199 (13%)

Query: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143
            +T F+ DAT+WLRH AHIYK+A +  L F ICLTTFQELRFLR+S+DENVMEAA RA+I+
Sbjct: 1124 TTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIII 1183

Query: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203
            IR LY   KVIPLRF G IA+HIEEHLEFEEQITWRSHV+EFVIE+++K+Q+  +     
Sbjct: 1184 IRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFL----- 1238

Query: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263
                                  Q    N   N     VLV+DD NM  KA E+ IRT +T
Sbjct: 1239 ----------------------QPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTT 1276

Query: 1264 RFIFSICSQLGMKYGICTN 1282
            RF+F++CS++G    ICTN
Sbjct: 1277 RFVFALCSEMGKGRLICTN 1295

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
           (REAL)
          Length = 1180

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/737 (49%), Positives = 498/737 (67%), Gaps = 42/737 (5%)

Query: 266 PTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNN 325
           P    RS  ALI KLQ++Y+ I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN ELVNN
Sbjct: 246 PANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNN 305

Query: 326 YVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQ 385
           YV FITTALLPSQ   DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQ
Sbjct: 306 YVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 365

Query: 386 FIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKY 445
           FI HVFIS++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY
Sbjct: 366 FITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 425

Query: 446 TYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEE 505
           TY  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   
Sbjct: 426 TYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 485

Query: 506 SSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565
           +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN 
Sbjct: 486 NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNP 545

Query: 566 ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI--------------KDNEI 611
           +  K++FRH P FAQ+HILQ+VG+G   N FA+L+ELPK++               D+ +
Sbjct: 546 DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSV 605

Query: 612 SRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNV--DIWIQSL 669
           +     +    +    +T+S   S ++   + E+FN ++ + +   LP  +  + W+++L
Sbjct: 606 TESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETL 664

Query: 670 QYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFI 729
           ++ N T + CGM+VL+KFL GP   ALPH+LPW+YF+IS+  K   L D  S+ FW + I
Sbjct: 665 KFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVII 724

Query: 730 RRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWN 789
           +R+FPW+T++ F+NVLIA+L DN  S S++  LC  YS+L+L E+L +F+ENE+LPE+W 
Sbjct: 725 KRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWG 784

Query: 790 CWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACR 846
           CWG+LWFD I  K+  S S     +  GI+D   LD+P DGI+FD++D+NG KFWKRACR
Sbjct: 785 CWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACR 844

Query: 847 ILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNI--DFLFKFDPTYDL---LP 901
           I+FLF+  +  F  G+ +                  +  NI  D ++K +P  ++   +P
Sbjct: 845 IIFLFREVSRSFPLGVIVRHDPLVN-------CSSLQSNNILRDLVYKLEPLTNIRSSVP 897

Query: 902 IDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYY 961
           +       F +           E+ SE N  L AVP+LSVI+G++IF YVGYKKL P Y 
Sbjct: 898 VLSTLESIFDIS----------EARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYT 947

Query: 962 YYDKNGNVNKGAIYSNW 978
            +DKNG     ++Y++W
Sbjct: 948 CFDKNGEFLSASLYTSW 964

 Score =  214 bits (545), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 113/237 (47%), Positives = 154/237 (64%), Gaps = 32/237 (13%)

Query: 1051 NSRKVDKYYTNQRDLDTIFKTIKINGEMRVAY-----YSTYFIFDATTWLRHFAHIYKIA 1105
            N+ + +  Y N+R+ + +F     +    +AY      +TYF+FDAT+WLRH A I+K+A
Sbjct: 971  NNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWLRHSARIFKLA 1030

Query: 1106 YSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASH 1165
             + LL F ICLTTFQELRFLR+S+DENVMEAATR +I IR LY   KV+PLRF G +A+H
Sbjct: 1031 QNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATH 1090

Query: 1166 IEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTK 1225
            IEE+LEFEEQITWR+HV+EFVIE++ K+QE         E+AK                 
Sbjct: 1091 IEENLEFEEQITWRTHVDEFVIESIMKAQEKL-------ENAK----------------- 1126

Query: 1226 QRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282
                 N S++     VL++DD  M  KA+E+ IRT STRF+FS+C++LG +  +CT+
Sbjct: 1127 ---QPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/726 (49%), Positives = 497/726 (68%), Gaps = 36/726 (4%)

Query: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
           +S+QAL+ KLQDIYK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L+NNY  FI
Sbjct: 286 KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345

Query: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
           TTALLPSQ   D+LIG+EI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+C QFI HV
Sbjct: 346 TTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405

Query: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
           FIS++ +   IP K +IPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  G
Sbjct: 406 FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465

Query: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS-SN 509
           KLYYHM+TVQQN+L AF+NLGKSVFC+D F P+QQY+QLVIDNIYQR ++ R    +  N
Sbjct: 466 KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRN 525

Query: 510 VQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVK 569
             ++DYLKH+E+M+LP+F+ + +LQ++   YF ++FG D+  NN FDT+ MF Q    ++
Sbjct: 526 PDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLR 585

Query: 570 FYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKT--------- 620
           F+FRH+P FA++HILQ+VG+GN  N FALL+ELPK++K+    +++ KSK+         
Sbjct: 586 FFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSST 645

Query: 621 ---GVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLP-----PNVDIWIQSLQYT 672
               VD+ + D ++     N+ H++    +  E +D   TL      P++  WI+SL + 
Sbjct: 646 APKTVDDQATDNVN--EGTNDDHELTATLSGPEYLDNIETLKYAIETPDICTWIKSLDFI 703

Query: 673 NTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRI 732
           N T + C M+VL+KFL GP + ALPH LPW  F+I+   K+  L +  +  FW++ ++RI
Sbjct: 704 NMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRI 763

Query: 733 FPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWG 792
           FPW+TI +FLNVL+A++ DN  + +++ +LC  YS + LD++L +F+++E+LPEVW CWG
Sbjct: 764 FPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWG 823

Query: 793 SLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFK 852
           +LW+D I NK+          GI D  FLD P DGI FD ED+ G KFWKRA R++FLFK
Sbjct: 824 TLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFK 883

Query: 853 GYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQV 912
           G ++KFD GL+++               + EK     L +F  T+ L   DE ++     
Sbjct: 884 GISKKFDFGLKISHEAGVYC--------RNEKAADSPLRRF--TFKLESYDEPTS----- 928

Query: 913 YSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKG 972
            S F E +P  E +S  N    A P LSV+ GE+IF+Y+GY+ L      +DKNG +   
Sbjct: 929 -SKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSS 987

Query: 973 AIYSNW 978
           +IY++W
Sbjct: 988 SIYTSW 993

 Score =  217 bits (553), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 139/205 (67%), Gaps = 28/205 (13%)

Query: 1085 TYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVI 1144
            T+FIFDAT+WLRHFAHIYKIA +G+L F +CLTTFQELRFLR+S+DENV+EAA RA+I +
Sbjct: 1098 TFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITM 1157

Query: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204
            R LY+  +++PLRF G +A+ IEEHLEFEEQITWRSHV+EFVIEAV K+Q+         
Sbjct: 1158 RQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDK-------- 1209

Query: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLS-------VLVTDDRNMDSKAKERG 1257
                            + +TKQ            L         LVT+D+NM  KA+++G
Sbjct: 1210 -------------FTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQG 1256

Query: 1258 IRTCSTRFIFSICSQLGMKYGICTN 1282
            I+T ST F+FS+CS+LGM   +CTN
Sbjct: 1257 IKTFSTDFVFSLCSKLGMSLDLCTN 1281

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
           [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/744 (48%), Positives = 498/744 (66%), Gaps = 34/744 (4%)

Query: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
           RS+ ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +Y+IN EL+NNYV FI
Sbjct: 264 RSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFI 323

Query: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
           TTALLPSQ   DLLIGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI HV
Sbjct: 324 TTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 383

Query: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
           F+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY Y  G
Sbjct: 384 FVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHG 443

Query: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNV 510
           KLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   +  N 
Sbjct: 444 KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNS 503

Query: 511 QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570
            +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN +  K+
Sbjct: 504 LLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKY 563

Query: 571 YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFI--------------KDNEISRQRK 616
           +FRH+P FAQ+HILQ+VG+G   N FA+L+ELPK++               D+ ++    
Sbjct: 564 FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESST 623

Query: 617 KSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNV--DIWIQSLQYTNT 674
            +    +N   + +S   S ++   + E+FN ++ + +   LP  +  + W+++L++ N 
Sbjct: 624 GNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNM 682

Query: 675 TGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFP 734
           T + CGM+VL+KFL GP   ALPH+LPW+YF+I+   K   L D  S+ FW + ++R+FP
Sbjct: 683 TSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFP 742

Query: 735 WNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSL 794
           W+TI+ F+NVLIA+L DN     ++ +LC  Y  L+L  +L +F+E+EELPE+WNCWG+L
Sbjct: 743 WDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTL 802

Query: 795 WFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLF 851
           WFDTI  K+  S S     +  GIKD   LDAP DGI+FD++D++G KFWKRACRI+FLF
Sbjct: 803 WFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLF 862

Query: 852 KGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQ 911
           +  +  F  G+ ++                +     + ++K +P  ++      SN    
Sbjct: 863 RELSRTFPIGVIVSNDPLIKCSSSQSSIILR-----NLVYKLEPLSNI-----RSNT--P 910

Query: 912 VYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNK 971
           + +     +   E+ S+NNI L AVP+LSV  G++IF Y GYKKL P Y  +D+NG    
Sbjct: 911 ILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLS 970

Query: 972 GAIYSNWEAFNQLGNGLKPRMENG 995
            ++Y+ W   N  GN +   + N 
Sbjct: 971 ASLYTRWYLPN--GNNISEALVNS 992

 Score =  197 bits (500), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/203 (50%), Positives = 138/203 (67%), Gaps = 27/203 (13%)

Query: 1080 VAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATR 1139
            + + +TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR
Sbjct: 1013 IDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATR 1072

Query: 1140 AVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF 1199
             +I IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE    
Sbjct: 1073 GIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQE---- 1128

Query: 1200 DELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIR 1259
             +L N                       G  + +       VL++DD  M  KA+E+ I+
Sbjct: 1129 -KLENA----------------------GQPHVTPRHSNYVVLISDDDTMKKKAEEKEIK 1165

Query: 1260 TCSTRFIFSICSQLGMKYGICTN 1282
            T ST+F+FS+C++LG K  +CT+
Sbjct: 1166 TLSTKFVFSLCTKLGEKRHLCTD 1188

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
           YIL151C (REAL)
          Length = 1118

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/960 (41%), Positives = 561/960 (58%), Gaps = 101/960 (10%)

Query: 40  PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97
           P     LHQKRH+SS++N T ++  VKRR+P   +  P+G  F+D  +     +Q   TP
Sbjct: 34  PTTVALLHQKRHSSSSHNDTPESSFVKRRVPGVVE--PVGKGFIDGIASGQVSVQN--TP 89

Query: 98  GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157
                           TD + R  +I      +  + ++  + N                
Sbjct: 90  SK--------------TDDISRRPSI------SRKAMETTPKVNTA-------------- 115

Query: 158 IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217
              S + +D+P SP+Y+     +  +E            S     ES+           N
Sbjct: 116 ---SISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATS--------N 164

Query: 218 SNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALI 277
               N +      +SDF + P        +T     TR         LP+   +  Q  I
Sbjct: 165 GIYSNSQPQSQVTLSDFRTAP------AFATSPPPVTRQ--------LPSA--QPNQTFI 208

Query: 278 SKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPS 337
            KLQ+IY+ I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI TALL +
Sbjct: 209 KKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTT 268

Query: 338 QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANM 397
           Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ FIS+++M
Sbjct: 269 QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSSM 328

Query: 398 SDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMA 457
            + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH+A
Sbjct: 329 LEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIA 388

Query: 458 TVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSSNV 510
           TVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R        E +  N 
Sbjct: 389 TVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAHRNS 448

Query: 511 QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570
           Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ FDT+ MF QN ES+++
Sbjct: 449 QLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPESLRY 508

Query: 571 YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTL 630
           YFRH+P FA++ +LQ++G+GN  N FALL++LPK++K     R++KKS         D  
Sbjct: 509 YFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEVPQYRDPF 568

Query: 631 SFQVSGNEIHDVGEYFNSLENIDKEF-TLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQ 689
             Q+S         YF +++++   F  +P N++IW+ SL + N T I C + VL KFL 
Sbjct: 569 DDQISSE------SYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLH 622

Query: 690 GPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFL 749
            P V ALPH L W++F++++  K+ET+       FW  F+RR  PWN+++N  NVL+ ++
Sbjct: 623 APLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYM 682

Query: 750 KDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSG 809
            DN      + +  E +  L LD+++  F+ENE LPE+W CWGSLWFD IK K +     
Sbjct: 683 LDNIH--PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIK-KCDV---- 735

Query: 810 LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTXXX 868
           ++  G++D  F D+P DGIVFDE+D+ G +FW R+ R + + KG A+KF D GL++    
Sbjct: 736 MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVN--- 792

Query: 869 XXXXXXXXXFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISE 928
                    F ++ +     FL  F  T+ L   +E  +          + +   E I  
Sbjct: 793 ----FQAPVFCRRNDISPDYFLKNF--TFKLDEYEENDHNDNNELDELYDTIEINEKIER 846

Query: 929 NNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGL 988
            N  L A P LSV+ GE+IF+Y GY +L P Y+ +DKNG  N   IYS W   + +GNG+
Sbjct: 847 VNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW---SNVGNGM 903

 Score =  212 bits (540), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 142/199 (71%), Gaps = 26/199 (13%)

Query: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143
            S YF+ DAT+WLRHFAHI+K+A + +L F ICLTTFQELR+LR S+D+NV+EAATR+VI 
Sbjct: 946  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1005

Query: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203
            IR LY  KK+IPLRF G IA+++EE+LEFEEQITW +HV+EFVI+A+AK  +N   + L 
Sbjct: 1006 IRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLI 1065

Query: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263
            +                    K +  +NA       +VLVTDD NMD KAK++ I+TC+T
Sbjct: 1066 D--------------------KNKNKNNA------YAVLVTDDDNMDGKAKDKMIKTCNT 1099

Query: 1264 RFIFSICSQLGMKYGICTN 1282
            +++FS+ S++G+  G+CTN
Sbjct: 1100 KYLFSLGSKIGINSGLCTN 1118

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
           unknown function that may interact with ribosomes, based
           on co-purification experiments; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus
           and cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/737 (49%), Positives = 495/737 (67%), Gaps = 36/737 (4%)

Query: 263 SILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVEL 322
           S  P +  RS  ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L
Sbjct: 262 SCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321

Query: 323 VNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEI 382
           VNNYV FITTALLPSQ   DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+
Sbjct: 322 VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381

Query: 383 CCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEA 442
           CCQFI HVF+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EA
Sbjct: 382 CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441

Query: 443 MKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISR 502
           MKY Y  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R
Sbjct: 442 MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501

Query: 503 GEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFV 562
              +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MFV
Sbjct: 502 NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561

Query: 563 QNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRK------ 616
           QN +  K++FRH P FAQ+HILQ+VG+G   N FA+L+ELPK++K+ +  ++RK      
Sbjct: 562 QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND 621

Query: 617 ----KSKTG---VDNMSIDTLSFQVSGNEIHD-VGEYFNSLENIDKEFTLPPNV--DIWI 666
               +S TG    DN   D +    +    HD + E+FN ++ + +   LP  +  + W+
Sbjct: 622 SSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWL 680

Query: 667 QSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWK 726
           ++L++ N T + CG++VL+KFL GP   ALPH+LPW+YF+IS+  K   L D  S+ FW 
Sbjct: 681 ETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWM 740

Query: 727 LFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPE 786
           + ++R FPW+T++ F+NVLI +L DN  S S++  LC+ Y +LSL E+L  F+E EELPE
Sbjct: 741 IIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPE 800

Query: 787 VWNCWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKR 843
           +  CWG+LWFDTI  K+  S S     +  GIKD   LD+P DGI+FDE+D+NG KFWKR
Sbjct: 801 ILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKR 860

Query: 844 ACRILFLFKGYAEKFDQGLRLTXXXXXXXXXXXXFTKKQEKRNI--DFLFKFDPTYDLLP 901
           ACR +FLF+  +  F  G+ +             +    +  NI    +FK +P  ++  
Sbjct: 861 ACRTIFLFRELSRSFPIGVII-------RNDPLIYRSSFQNTNILGSLVFKLEPLCNI-- 911

Query: 902 IDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYY 961
                +    V       +   E+ SENN  L AVP+LSV +G++IF YVGYKKL   Y 
Sbjct: 912 -----HNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYT 966

Query: 962 YYDKNGNVNKGAIYSNW 978
            +DKNG     ++Y+ W
Sbjct: 967 CFDKNGEFLSASLYTTW 983

 Score =  196 bits (497), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 27/203 (13%)

Query: 1080 VAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATR 1139
            + + +TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR
Sbjct: 1020 IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATR 1079

Query: 1140 AVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF 1199
             +I IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE+V K+QE    
Sbjct: 1080 GIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKL-- 1137

Query: 1200 DELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIR 1259
                 ESA           ++   + +R N           VL++DD  M  KA+E+ I+
Sbjct: 1138 -----ESA-----------SEPRLSPRRFN---------YVVLISDDDAMKKKAEEKEIK 1172

Query: 1260 TCSTRFIFSICSQLGMKYGICTN 1282
            T STRF+FS+C++LG +  +CT+
Sbjct: 1173 TLSTRFVFSLCTKLGEQRHLCTD 1195

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
           Putative protein of unknown function, predicted to
           contain a PINc domain
          Length = 1118

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/971 (40%), Positives = 572/971 (58%), Gaps = 123/971 (12%)

Query: 40  PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97
           P     LHQKRH+SS++N T ++   KRR+P   D  P+G  F+D  +  +S +    TP
Sbjct: 34  PTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIVD--PVGKGFIDGIT--NSQISAQNTP 89

Query: 98  -----GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGN 152
                 SR  S+++K   +++T  V  S                                
Sbjct: 90  SKTDDASRRPSISRKV--MESTPQVKTS-------------------------------- 115

Query: 153 SLLDNIANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLI 212
                   S   +D+P SP+Y+     +  ++          V S +  +++  P++   
Sbjct: 116 --------SIPTMDVPKSPYYVNRTMLARNMK----------VVSRDTYEDNANPQMRAD 157

Query: 213 EEQYNSN--LENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWN 270
           E    SN    N +      +SD    P   A+                     LP+   
Sbjct: 158 EPLVASNGIYSNSQPQSQVTLSDIRRAPVVAASPPPMIRQ--------------LPSA-- 201

Query: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
           +  Q  I KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI
Sbjct: 202 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261

Query: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            TALL +Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ 
Sbjct: 262 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321

Query: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
           FIS++NM + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG G
Sbjct: 322 FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381

Query: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSS-- 508
           KLYYH+ATVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R   S++  
Sbjct: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNN 441

Query: 509 -----NVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQ 563
                N Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ FDT+ MF Q
Sbjct: 442 EIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQ 501

Query: 564 NLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVD 623
           N ES+++YFRH+P FA++ +LQ++G+GN  N FALL++LPK++K  +  R++K+S+    
Sbjct: 502 NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATET 561

Query: 624 NMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFT-LPPNVDIWIQSLQYTNTTGIFCGMM 682
           +   D    Q+S         YF +++ ++  F  +P N++IW+ SL + N T I C + 
Sbjct: 562 SSYTDPFDVQISSE------SYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIH 615

Query: 683 VLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFL 742
           VL KFL  P V ALPH L W++F++++  K+E +       FW  F+RR  PWN+I+   
Sbjct: 616 VLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLG 675

Query: 743 NVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNK 802
           NVL+ ++ DN      + +  E +  L LD+++  ++ENE LPE+W CWG+LWFD IK K
Sbjct: 676 NVLVCYMLDNLH--PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIK-K 732

Query: 803 SETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQG 861
            +     ++  G++D  F D+P DGIVFDE+D+ G KFW R+ R + L KG A+KF D G
Sbjct: 733 CDV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG 788

Query: 862 LRLTXXXXXXXXXXXXFTKKQEKRNIDFL----FKFDPTYDLLPIDEASNKYFQVYSLFT 917
           L+++            F ++ +     FL    FK D  YD    ++  N   ++  L+ 
Sbjct: 789 LKVS-------FQASVFCRRNDIPPDYFLKNLTFKLD-AYD----EDNYNDNNELDDLY- 835

Query: 918 EKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSN 977
           + +   E I   N+   A P LSV+ GESIF+Y GY +L P Y+ +DKNG  N   IYS 
Sbjct: 836 DTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895

Query: 978 WEAFNQLGNGL 988
           W   + +GNG+
Sbjct: 896 W---SNVGNGV 903

 Score =  213 bits (541), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 142/199 (71%), Gaps = 26/199 (13%)

Query: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143
            + YF+ DAT+WLRHFAHI+K+A +  L F ICLTTFQELR+LR S+D+ V+EAATR+VI 
Sbjct: 946  TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVIT 1005

Query: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203
            IR LY  KK+IP+RF G IA+H+EE+LEFEEQITW++HV+EFVI+A+AK  +        
Sbjct: 1006 IRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR------- 1058

Query: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263
                   F AE +    + + K +G        K  +VLVTDD NM+ KAK+R I+TC+T
Sbjct: 1059 -------FQAERL----TDENKNKG--------KEFAVLVTDDDNMNQKAKDRMIKTCNT 1099

Query: 1264 RFIFSICSQLGMKYGICTN 1282
            +++FS+ S+LG+  G+CTN
Sbjct: 1100 KYLFSLGSKLGINSGLCTN 1118

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/745 (48%), Positives = 497/745 (66%), Gaps = 49/745 (6%)

Query: 271  RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
            +S+Q L+ KLQDIYK+I+ QE+ELQ  C  +T+SQTT+LK +W +Y++N ELV+NY+ FI
Sbjct: 379  KSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFI 438

Query: 331  TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            TTA+ P+Q ++D  IG+EII++YKIERRLWVYGTITFLD+LK+FSNFMDPE+CCQFI HV
Sbjct: 439  TTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHV 498

Query: 391  FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
            FISI+NM   IP+K+ + W+ +LGDLSRMA ALYP    DWKLSAE WY  AM++TYG G
Sbjct: 499  FISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHG 558

Query: 451  KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYI-SRGEESSSN 509
            KLYYHM+TVQQN+L AF+NLGKS+FC++ FVP+QQYLQLVI NIYQRAY  S    +  N
Sbjct: 559  KLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRN 618

Query: 510  VQIL-DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDF--VGNNFFDTRSMFVQNLE 566
             Q+L DY+KH E+ +LPNF E+ ELQ++  +YF +KFG D+    NN F +R MFVQN +
Sbjct: 619  DQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNND 678

Query: 567  SVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV---- 622
              K ++R+S  FA++ ILQ+VGYGN+ + F+LL+ELPK++KD +  ++++K KT +    
Sbjct: 679  QFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKI 738

Query: 623  ------DNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTG 676
                        TL    + N      E+F +++ I+    +P +VDIW  SLQY N   
Sbjct: 739  TQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVS 798

Query: 677  IFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWN 736
            I C M+V +KFL  PF+ ALPH LPW YF+IS+  +++  ++     FW  F+RRIFPWN
Sbjct: 799  IKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWN 858

Query: 737  TIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWF 796
            +I+ FLNVL+A++ DN    S++N+LC  Y+ +SLDE+LT F+ENEELPEVW C GSLWF
Sbjct: 859  SIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWF 918

Query: 797  DTIK--------------NKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWK 842
            DTI               N S+ + +  K  G+KD  F D P DG  FDE D+ G +FWK
Sbjct: 919  DTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWK 978

Query: 843  RACRILFLFKGYAEKFD--QGLRLTXXXXXXXXXXXXF---TKKQEKRNIDFLFKFDPTY 897
            RA R++FLFK  AE +    GL L+            +   T  QE   ++F FK + + 
Sbjct: 979  RAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQEL--LEFSFKLNASS 1036

Query: 898  DLLPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLL 957
            D + +D+               + +FE+  E N      P LS++DG+SIFDYVGYK++ 
Sbjct: 1037 DGVMLDDI--------------IESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVC 1082

Query: 958  PCYYYYDKNGNVNKGAIYSNWEAFN 982
            P +Y +DKNG+    + +++W   N
Sbjct: 1083 PNFYSFDKNGDFISTSFFNSWSIKN 1107

 Score =  203 bits (517), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 133/187 (71%), Gaps = 22/187 (11%)

Query: 1085 TYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVI 1144
            TYFI DAT+WLRHFAHIYKIA S +L F ICLTTFQELR+LR+S+D NV+EAATRA+I +
Sbjct: 1182 TYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITL 1241

Query: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204
            R LY    ++PLRF G +A+HIEEHLEFEEQITWRSHV+EFVIEAV K++E    D L++
Sbjct: 1242 RQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRT-DRLND 1300

Query: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTR 1264
                      NMDT    D K++        S    +LVTDD  M +KA +R I+T STR
Sbjct: 1301 ---------INMDT----DEKEK--------SIFGIILVTDDITMKNKAMDRKIKTFSTR 1339

Query: 1265 FIFSICS 1271
            FIFS+ +
Sbjct: 1340 FIFSMAN 1346

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  434 bits (1115), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/382 (56%), Positives = 277/382 (72%), Gaps = 43/382 (11%)

Query: 268 TWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYV 327
           T   S+QALI KLQDIYK I+ QE++LQ+ CS +T+SQTTDLK +W +YKIN++L+NNY+
Sbjct: 390 TTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYI 449

Query: 328 IFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFI 387
            FIT ALLP+QS+ DL IG+EII++Y+IERRLWVYGTITFLDVLK FSNFMDPE+CCQFI
Sbjct: 450 NFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFI 509

Query: 388 IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTY 447
            HVFI+I+ + + IP K+SI W  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY
Sbjct: 510 SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTY 569

Query: 448 GVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS 507
             GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+QQY+QLVIDNIYQRA++ R   + 
Sbjct: 570 SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH 629

Query: 508 SNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFG--------------------- 546
            N+Q+++YLKH E+M+LP F+E+ +LQ +  VYF  KFG                     
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 547 ----------------------QDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHIL 584
                                 + F   + F  + MF+QN + +K++FRHS  FAQ+HIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 585 QVVGYGNIGNAFALLYELPKFI 606
           Q+VG+G+  N FALL+ELPKF+
Sbjct: 750 QLVGFGDPKNPFALLFELPKFL 771

 Score =  347 bits (890), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 220/610 (36%), Positives = 330/610 (54%), Gaps = 93/610 (15%)

Query: 644  EYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWV 703
            E+F +++ +   + +P  ++IW++SL+  N   + C ++VL+KFL GP + ALPHLL W+
Sbjct: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926

Query: 704  YFLISVAFKIE-TLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDN--SDSCSLVN 760
            +F+IS+  KIE ++ D  S+ FW  F++ I PWN+I+NFLNVL+ +L DN   ++  L+ 
Sbjct: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986

Query: 761  QLCETYSQLS---LDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY---------- 807
             L   Y+ +S   L+E+L  F++NE LPE+W CWG+LWFD I NK+  S           
Sbjct: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046

Query: 808  --------------------SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRI 847
                                  L+  GI+D   LD P DGI F   D++G  F+KR+ R+
Sbjct: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106

Query: 848  LFLFKGYAEKF-DQGLRLTXXXXXXXXXXXXFTKKQEKRNID-FLFK----FDPTYDLLP 901
            +FL K   E F + GL+++             TK  +   ++ F FK    +DP+  ++P
Sbjct: 1107 IFLCKSMIETFPNLGLKISHETSNYCRN----TKIPQNFILNNFAFKLTNLYDPSLIIIP 1162

Query: 902  I--------------DEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDG-ES 946
                           D   NK   + S   E     E I E N+ L   P LS++ G E+
Sbjct: 1163 QTEQNIENENENENDDLEFNK--SILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNEN 1220

Query: 947  IFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDS 1006
            IF+Y+GY           K  N N  + + N E  +            GS +    +D +
Sbjct: 1221 IFNYLGY-----------KRLNFNIQSFHENGEIIS------------GSIYSSWPIDYN 1257

Query: 1007 KNFEIREKRLFAKYLECDESQESSD-HLAXXXXXXXXXXXXXXXXNSRKVDKYYTNQRDL 1065
            K  E ++++   ++L  D + ++ +  +                    K+     N +  
Sbjct: 1258 KFKEQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQ 1317

Query: 1066 DTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFL 1125
            +T    + IN       + T+F+FDAT+WLRHFAHIYK++ +G L F +CLTTFQELRFL
Sbjct: 1318 NTHKMGVSINK------HRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFL 1371

Query: 1126 RRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEF 1185
            R+S+D NV+EA+TRA+I +R LYK  K++PLRF G +A+ IEEHLEFEEQITWRSHV+EF
Sbjct: 1372 RKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1431

Query: 1186 VIEAVAKSQE 1195
            VIEA+ +SQE
Sbjct: 1432 VIEAIIRSQE 1441

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  397 bits (1021), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/422 (46%), Positives = 275/422 (65%), Gaps = 76/422 (18%)

Query: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330
           +S Q LI KLQ+IYK I+ QE+ELQ+ C+ +++SQ+T LK +W +YK+N +L+NNY++FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390
            T+L PSQS  D LIG+EI+++YKIERRLW+YGTITFLD+LK+F+NFMDPEI  QFI HV
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450
           F SI+NM   +P  F  PW+ RLGDLSRMA ALYP    DWKLS+EYWY E+MK+T+  G
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEES---- 506
           KLYYH++TVQQN L AF+NLGKSVFC D F+P+Q+Y+QLVIDNIYQRA+I R   S    
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 507 ----------------SSNVQ---ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQ 547
                           + N Q   +++YLKH+E+M+LPNF+EN  L+ +   YF+  FG+
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 548 DFVGNN----------------------------------------------------FF 555
             + +N                                                     F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 556 DTRSMFVQ-NLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQ 614
           + R++F Q N + +K++F++S  FA++HILQ++G+G+  N FALL++LPK++K+ +  R+
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYLKERKTKRK 683

Query: 615 RK 616
            K
Sbjct: 684 SK 685

 Score =  232 bits (591), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 162/245 (66%), Gaps = 10/245 (4%)

Query: 624  NMSIDTLSFQVSGNEIHD-------VGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTG 676
            NM +DT   Q +G E  D         ++FN+LE++   F LP +++IW +SL+Y N   
Sbjct: 764  NMDVDT-ELQNNGMEDEDEMLDNLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIIS 822

Query: 677  IFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWN 736
            + C ++VL+KFL GP   +LPH+LPW YF+IS+A +IE+L +  S+ FW  FIR+IFPWN
Sbjct: 823  LNCSIIVLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWN 882

Query: 737  TIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENE-ELPEVWNCWGSLW 795
            +I+++LNV+I+ L DN    S++ +L   YS  +LDE+L  F+ENE ELPEVW C+GSLW
Sbjct: 883  SIVSYLNVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLW 942

Query: 796  FDTI-KNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGY 854
            FD I +N    S    K   +KD   L+ P DG+ FDE ++NG  FWKR+CR++FLFK  
Sbjct: 943  FDVIAENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002

Query: 855  AEKFD 859
              +F+
Sbjct: 1003 ITRFN 1007

 Score =  231 bits (588), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 204/376 (54%), Gaps = 59/376 (15%)

Query: 923  FESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFN 982
            FE  S  N  L+  P LS+I+ ES+F+Y GYK+ +P +  +DKNG +   ++Y+      
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT------ 1203

Query: 983  QLGNGLKPRMENGSSFIIDGLD-DSKNFEIREKRLFAKYLECDESQESSDHLAXXXXXXX 1041
                          S IID ++  S N  I      A     DES   S   A       
Sbjct: 1204 --------------STIIDTINGSSSNANIINTTTNAN----DESNNDSSATAGSNQNKE 1245

Query: 1042 XXXXXXXXXN-----------SRKVDKYYTNQRDLDTIFKTIKINGEM----RVAYYSTY 1086
                     N           ++ +D  Y N   +D I++     GEM     + +  TY
Sbjct: 1246 SSNSTTNIDNKELFLMEKEIFNKILDPDYKN---IDEIWR-----GEMFHDTSIQFSDTY 1297

Query: 1087 FIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRL 1146
            F+ DAT+WLRHFAH+YK+A +G+L F ICLTTFQELRFLR+S+DENVMEAATRA+I +R 
Sbjct: 1298 FVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQ 1357

Query: 1147 LYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNES 1206
            LY  K+++PLRF G IA+HIEEHLEFEEQITWRSHV+EFVIEA+ ++Q       L    
Sbjct: 1358 LYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQ-------LKRRD 1410

Query: 1207 AKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKER----GIRTCS 1262
             +   D+    + ++       N+     + ++ VLVTDD +M  K +E      I T S
Sbjct: 1411 NRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDDISMIKKRQEEKSDNDIITFS 1470

Query: 1263 TRFIFSICSQLGMKYG 1278
            T+F+FS+C+ L  K+ 
Sbjct: 1471 TKFVFSLCNMLVNKFN 1486

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score =  127 bits (319), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 129/592 (21%), Positives = 251/592 (42%), Gaps = 93/592 (15%)

Query: 312 IWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVL 371
           +  ++K++ ++V+ Y  FI  AL  + +Q DL+ G+E +   ++  RL  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 372 KHFSNFM----------DPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMAT 421
           +++ N M          + +   +FI    I I +M + IP KF   W   +GDL+R+  
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 422 ALYPPGATDWKLSAEYWYG-----EAMKYTYGVGK----------LYYHMATVQQNSLAA 466
            L       ++L++ + Y       A+ Y+   GK           Y++++ VQ +SLA 
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 467 FINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG--EESSSNVQILDYLKHNEIMVL 524
            + L K +   +  V  +   QL ID I  +    +   ++S     IL  +K+  ++ L
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTIL--MKYFTLLSL 381

Query: 525 ----PNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMF-----VQNLESVKFYFRHS 575
                +  +   ++R +  YF  +F  ++   N+   R         + +    FYF ++
Sbjct: 382 FFGSTSSSQLSGMERSSLHYFWNEFANEY-HLNYSSLRKPVNCKYRQKEINYSMFYFNNA 440

Query: 576 PLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLSFQVS 635
           PLF+   I++ +      N F  +Y+                     D+  I ++S    
Sbjct: 441 PLFSLISIVETIIMNKKLNPFFCVYK-------------------SSDDFEIKSVS---- 477

Query: 636 GNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTA 695
                        L N             W   ++  + T +    ++ +KFL      +
Sbjct: 478 -------------LSN-------------WKILIEQMDDTLLHSNKLLFKKFLMLNVAIS 511

Query: 696 LPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDNSDS 755
            P +LPW+ F ISVA ++  + D +    WK  ++ + PW+ I+ +LN  I  +  +S +
Sbjct: 512 QPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSIN 571

Query: 756 CSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLKTAGI 815
              +  L +     SL ++L          E+  C G +WFD++ +K + +      + +
Sbjct: 572 SKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNESLM 631

Query: 816 KDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKG----YAEKFDQGLR 863
           K  ++ +A  D +++D++D    K W RA  I+ L K     Y E  D  +R
Sbjct: 632 KFKSY-NASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPELIDVSIR 682

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 81/187 (43%), Gaps = 34/187 (18%)

Query: 1086 YFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRR-SRDENVMEAATRAVIVI 1144
            YF+ D   WL+H   + +      +  ++ ++   +L  L+  S  E+V  +A+R +IVI
Sbjct: 803  YFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVI 862

Query: 1145 RLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN 1204
              LY + ++  L+             EFE  I              +K+ +N    ++ N
Sbjct: 863  NYLYAMNQINILK-------------EFESPI--------------SKALKNIDGSQILN 895

Query: 1205 ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTR 1264
             + K   D   + T ++   +Q        ++    V+V+DD+   +  K++G    ST+
Sbjct: 896  FNGKFKND---LLTKENGPGQQLNMIELRMDN---VVVVSDDKLSLATFKKKGYNVVSTK 949

Query: 1265 FIFSICS 1271
             +FS+ S
Sbjct: 950  VLFSVAS 956

>SAKL0F12210g Chr6 complement(950838..951430,951636..951660) [618 bp,
            205 aa] {ON} highly similar to uniprot|P25451
            Saccharomyces cerevisiae YER094C PUP3 Beta subunit of the
            20S proteasome involved in ubiquitin-dependent catabolism
            human homolog is subunit C10
          Length = 205

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 9/120 (7%)

Query: 1097 HFAHIYKIAYSGLLNFVICLT-TFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIP 1155
            H+ H++ +  +GL   V  L+ TF+    L + R++  +E  T A ++   LY+ K+  P
Sbjct: 45   HYGHVF-LGLTGLATDVTTLSETFRYKTNLYKLREDRSIEPETFAQLISSTLYQ-KRFGP 102

Query: 1156 LRFNGKIASHIEEHLEFE-----EQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKAD 1210
              F G + + I    E       + I       +F++   A  Q  GM + L+  + +AD
Sbjct: 103  Y-FVGPVVAGINSKTEKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEAD 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,340,149
Number of extensions: 6567238
Number of successful extensions: 24375
Number of sequences better than 10.0: 230
Number of HSP's gapped: 25240
Number of HSP's successfully gapped: 290
Length of query: 1282
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1161
Effective length of database: 39,606,813
Effective search space: 45983509893
Effective search space used: 45983509893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)