Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06589g5.703ON58358329650.0
Smik_9.195.703ON57259813750.0
YIL150C (MCM10)5.703ON57159613720.0
Suva_9.385.703ON56959713630.0
Skud_9.185.703ON57159513171e-176
Kpol_1043.715.703ON58558912991e-173
TDEL0B021705.703ON56759312891e-172
KAFR0D022105.703ON58459912501e-166
NCAS0G002205.703ON59258212491e-165
ZYRO0G06578g5.703ON56959012401e-164
NDAI0F002805.703ON61061811941e-157
TPHA0E002105.703ON54456411861e-156
TBLA0G010205.703ON59461011581e-152
KNAG0L021505.703ON61663211511e-150
KLTH0E01034g5.703ON58358510621e-137
SAKL0E14938g5.703ON57462010211e-131
Kwal_55.196915.703ON4664779631e-124
AFR287W5.703ON6116419101e-114
KLLA0A00572g5.703ON5775948811e-110
Smik_5.1117.140ON43080724.0
KNAG0A025108.435ON84991714.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06589g
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...  1146   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   534   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   533   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   529   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   511   e-176
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   504   e-173
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   501   e-172
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   486   e-166
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   485   e-165
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   482   e-164
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   464   e-157
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   461   e-156
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   450   e-152
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   447   e-150
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   413   e-137
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   397   e-131
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   375   e-124
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   355   e-114
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   343   e-110
Smik_5.111 Chr5 complement(152669..153961) [1293 bp, 430 aa] {ON...    32   4.0  
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    32   4.9  

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/583 (95%), Positives = 557/583 (95%)

Query: 1   MVHIIDNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSK 60
           MVHIIDNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSK
Sbjct: 1   MVHIIDNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSK 60

Query: 61  QLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRK 120
           QLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQ        PNEEDIVRK
Sbjct: 61  QLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRK 120

Query: 121 ELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPY 180
           ELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPY
Sbjct: 121 ELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPY 180

Query: 181 SNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVK 240
           SNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVK
Sbjct: 181 SNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVK 240

Query: 241 LTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCV 300
           LTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCV
Sbjct: 241 LTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCV 300

Query: 301 NGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQM 360
           NGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQM
Sbjct: 301 NGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQM 360

Query: 361 RSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXX 420
           RSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITG          
Sbjct: 361 RSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKE 420

Query: 421 XXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQS 480
                   FSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQS
Sbjct: 421 KHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQS 480

Query: 481 KNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLINDLIH 540
           KNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLINDLIH
Sbjct: 481 KNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLINDLIH 540

Query: 541 FKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDSDSDLEIV 583
           FKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDSDSDLEIV
Sbjct: 541 FKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDSDSDLEIV 583

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/598 (47%), Positives = 395/598 (66%), Gaps = 48/598 (8%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           +DPRE+  +DPY  ++ D+ E E  I +ELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 2   DDPREILAVDPYNSVTSDE-EDEQAIAKELEFMERKRQALMERLK--RKQAFKKPNDPNF 58

Query: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDI--VRKELDV 124
           + I      EVP+SP +  +  +   Q+ V QVT  +         NE ++  ++K+ ++
Sbjct: 59  EAI------EVPQSPTKSRV--KSGSQNAVKQVTRLETSNA-----NESNLSQIQKQPEL 105

Query: 125 -VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183
            + TT+YF  KF+N+K DE+R +  ++ MM AR HTF   T     K I  +ELE +SN 
Sbjct: 106 PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTF--GTDNKKYKPIIANELEGFSNL 163

Query: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243
            +KKRYIP+D++ + LH IKILRL KLFAKVRPP F  P+Y+NW  +G IS K D+K T+
Sbjct: 164 WVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTS 223

Query: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303
           + KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GDIIA+LNPE+LPWRPSG  N I
Sbjct: 224 SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFI 283

Query: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363
           KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T
Sbjct: 284 KSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGT 343

Query: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSIT-GXXXXXXXXXXXX 422
           ++KRIEL+G YALGAPTKV +QPS+YK   ++R         F+I               
Sbjct: 344 SAKRIELNGGYALGAPTKVNSQPSLYKAKGENR---------FNIIRDARKGLSEEEERM 394

Query: 423 XXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS 478
                 F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K+  ++R L K +  +++S
Sbjct: 395 KKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESS 454

Query: 479 QSKNK-----QQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKKM 532
             ++K     Q++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++ +  ++ K 
Sbjct: 455 GLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKK 514

Query: 533 GLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-------QDTNDSDSDLEIV 583
            +INDL+H+KK+K+ L PS+    +KR+ RE +W++HF       + ++ S SDLEI+
Sbjct: 515 TVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/596 (47%), Positives = 386/596 (64%), Gaps = 45/596 (7%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPRE+  +DPY +++ D+ E E  I RELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 2   NDPREILAVDPYNNITSDE-EDEQAIARELEFMERKRQALVERLK--RKQEFKKPQDPNF 58

Query: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNE---EDIVRKELD 123
           + I      EVP+SP +  +       HN  Q    Q         NE     + ++   
Sbjct: 59  EAI------EVPQSPTKNRVKVG---SHNATQ----QGTKFEGSNINEVRLSQLQQQPKP 105

Query: 124 VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183
             +TT+YF  KF+N+K +E++ +  ++ MM+AR HTF  ST       I  +ELE +SN 
Sbjct: 106 PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTF--STDEKKYVPIITNELESFSNL 163

Query: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243
            +KKRYIP+D++ + LH IKILRL KLFAK+RPP F EP+Y+NW  +G IS K D+K T+
Sbjct: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTS 223

Query: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303
           + KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N I
Sbjct: 224 SEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 283

Query: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363
           KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T
Sbjct: 284 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGT 343

Query: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXXX 423
           ++KRIEL+G YALGAPTKV +QPS+YK           ++    I G             
Sbjct: 344 SAKRIELNGGYALGAPTKVDSQPSLYKAK--------GENGFNIIKGTRKRLSEEEERLK 395

Query: 424 XXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDASQ 479
                F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K++ + R L K +   ++S 
Sbjct: 396 KSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSG 455

Query: 480 SKNK-----QQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKS-RGTKTDDPTISKKMG 533
            ++K     Q++K  TE  LQTG+IQRLGFDP+ G+I++VL  S  G++  +  + KK  
Sbjct: 456 LEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKT 515

Query: 534 LINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-----QDTND-SDSDLEIV 583
           +INDL+H+KK+K+ L PS+    +KR  RE +W+KHF     ++T+D S SDLEI+
Sbjct: 516 VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/597 (47%), Positives = 391/597 (65%), Gaps = 49/597 (8%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           +DPRE+  +DPY +++ D+ E E  I +ELE +ERKKQ L+ RLK  +++   K  DPN 
Sbjct: 2   DDPREILAVDPYNNVTSDE-EDEQAIAKELEFMERKKQALMERLK--RKQDFKKPEDPNF 58

Query: 67  KNINSRGRVEVPRSPKRESL--PAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELDV 124
           +       VEVP+SP ++S+   +Q+ L+  +  V  N          NE  + ++  + 
Sbjct: 59  E------AVEVPQSPAKKSIVKKSQDALKQAIRPVASN---------INESMLSQQSQES 103

Query: 125 VA-TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183
            + TT+YF  KF+++K +E++ +  Y+ MM+AR HTF   T   + K I  +ELE +SN 
Sbjct: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTF--GTDNKEYKPIITNELESFSNL 161

Query: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243
            +KKRYIP++++ + LH IKILRLNKLFAK+RPP F EP Y+NW  +G IS K D+K T+
Sbjct: 162 WVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTS 221

Query: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303
           + KPVK+F FT+TDF+H+LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N I
Sbjct: 222 SEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFI 281

Query: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363
           KSFNLRI HDF CILEIG+SRDLGWC +VN    K C SPINT    CC++HRE+Q R T
Sbjct: 282 KSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGT 341

Query: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSIT-GXXXXXXXXXXXX 422
            +KRIEL+G YALGAPTKV +QPS+Y+   +++         F+I               
Sbjct: 342 GAKRIELNGGYALGAPTKVDSQPSLYRAKGENQ---------FNIVRSTRKGLSEEEERV 392

Query: 423 XXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS 478
                 F+N  +AKAFFD+ FQ+P +LANL+SKRRKI    K++ + R L K +  +D+S
Sbjct: 393 KRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSS 452

Query: 479 -----QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKKM 532
                    KQ++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++    I+ K 
Sbjct: 453 GLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKK 512

Query: 533 GLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQD------TNDSDSDLEIV 583
            +INDL+ +KK+K+ L PS+    +KR  RE +W++HF        ++ S SDLEIV
Sbjct: 513 TVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  511 bits (1317), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 270/595 (45%), Positives = 385/595 (64%), Gaps = 43/595 (7%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           +DPRE  + DPY +++ D+ ++++ I +ELE +ERKKQ L+ RLK  +++   +  DPN 
Sbjct: 2   DDPREFLVADPYNNVTSDEDDEQT-IAKELEFMERKKQALVERLK--RKQEFKRAEDPNF 58

Query: 67  KNINSRGRVEVPRSPK--RESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELDV 124
           + I      EVP+SP   R  + +Q  ++ ++     N           ++++       
Sbjct: 59  EAI------EVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSN---- 108

Query: 125 VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFH 184
             TT YF  KF+N+K +E +    Y+ MM+AR HTF   T   + +    +ELE +SN  
Sbjct: 109 --TTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTF--GTDKKEYRATIANELEEFSNIW 164

Query: 185 IKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNA 244
           +KKRYIP+D++ + LH IKILRL KLFAK+RPP F EP Y+NW  +G IS K DVK T++
Sbjct: 165 VKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSS 224

Query: 245 AKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIK 304
            KP K+F FT+TDF+H LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N IK
Sbjct: 225 DKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIK 284

Query: 305 SFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTA 364
           SFNLRI HDF CILEIG+SRDLGWC +VN  +++ C SPIN    +CC++HRE+Q R T+
Sbjct: 285 SFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTS 344

Query: 365 SKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXXXX 424
           +KRIEL+G YALGAPTKV  QP++Y+   ++ N N  +    +++               
Sbjct: 345 AKRIELNGGYALGAPTKVDAQPTLYRAKGEN-NFNLVRSIRKTLS-------EEEERMKK 396

Query: 425 XXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKAL-----NGE 475
               F N  +AKAFFD+ FQ+P +LANL+SKRRKI    K++ + R L K +     +G 
Sbjct: 397 NSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGL 456

Query: 476 DASQSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKKMGL 534
           +    + KQ++K+ TE  LQTG++QRLGFDP+ G+I+KVL  S  G +  +  +  K  +
Sbjct: 457 EDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTV 516

Query: 535 INDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF--QDTND----SDSDLEIV 583
           I+DL+++KK+K+ L PS+    +KR  RE +W+KHF  +DT++    S SDLEIV
Sbjct: 517 IDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  504 bits (1299), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 276/589 (46%), Positives = 380/589 (64%), Gaps = 29/589 (4%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPRE    D Y++LS D+ EQ+ +I  +L+ IER+KQDL+ RLK+ K +    +LDPN 
Sbjct: 2   NDPREHAKEDLYSNLSSDEGEQD-EISEQLKAIERQKQDLLERLKKKKER--KSKLDPNF 58

Query: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELDVVA 126
                   V+VP SPK+  +   +     +      +             ++ K+     
Sbjct: 59  --------VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVA-----LMTKDDSNYG 105

Query: 127 TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHIK 186
           TTSYF  KF NSK D  R V AY  MMS+R HTF+G+ S  + K    DEL+ YSN  ++
Sbjct: 106 TTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLR 165

Query: 187 KRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAK 246
            RYIP DE++ +L  IKILRL KLFAKVRPP F+EPQYSNWV  G I+SK+D+K T+++K
Sbjct: 166 SRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSK 225

Query: 247 PVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPS----GCVNG 302
           P KYFKFT++DF+HNLDV++FG K VE+YYNLRVGD++A+LNPEILPWRPS    G  + 
Sbjct: 226 PTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGST 285

Query: 303 IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRS 362
           IKSFNLRI H F+CILEIGASRDLGWC + N  ++ +C +PIN   +  C++HRE+Q R 
Sbjct: 286 IKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRK 345

Query: 363 TASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXX 422
           T S R+ELSG+YALGAPTKV  +P++Y++   S N+   K     ++             
Sbjct: 346 TTSNRVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNM-VSDSHYQKRKDSNKL 404

Query: 423 XXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNGEDASQSKN 482
                 FS   +AKAFFD+ FQ+P +L NL+SKRRKIK SKM+RNL+KAL      +SKN
Sbjct: 405 ETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKN 464

Query: 483 KQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRG-TKTDDPTISKKMGLINDLIHF 541
            + +K  T+ TLQTG++QRLGFDP+GG+++ V+  S   T+  +    +K   ++DL+ F
Sbjct: 465 FKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTF 524

Query: 542 KKDKIKLKPSREIQLEKRHRREAIWKKHF-------QDTNDSDSDLEIV 583
           +KD + LKPS++  +++R  R+  WKK F        + +DS SDL+I+
Sbjct: 525 RKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  501 bits (1289), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 270/593 (45%), Positives = 385/593 (64%), Gaps = 43/593 (7%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPREV   DP+ +L+ D+++Q  +++ ++  IER+K+DL+ RLK +KR+L SK  DPN 
Sbjct: 2   NDPREVVQTDPFGELTSDEEDQR-ELEDQIVEIERQKRDLVERLK-SKRQLKSK--DPNF 57

Query: 67  KNINSRGRVEVPRSPKR---ESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELD 123
             I      +V  SP +   ES+  + +    V  + +           NE+ +  +   
Sbjct: 58  DAI------QVESSPVKKPAESIKVEPSRTKRVLDIEN----------LNEKKVESRSQI 101

Query: 124 VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183
              TTSYF + F+NSK +E +     Q+++S R HTF G       K +  +E+E YS+ 
Sbjct: 102 PANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDL 161

Query: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243
            +K+RYI +D++ K+LH +KILRL+KLFAK++PP F+EPQYSNW  IG IS+K  VK ++
Sbjct: 162 WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221

Query: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGI 303
           + KP+KYFKFTLTDF++NLDVYVFGKK VERYYNLRVGDI+A+LNPE+LPWRPS   N I
Sbjct: 222 SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFI 281

Query: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363
           KSFNLRI HDF CILEIG SRD+ WC+  N  Q+K C +PIN   ++CC+FHRE+Q RS 
Sbjct: 282 KSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSN 341

Query: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXXX 423
            +KRIEL+GS+ALGAPTKV + P++Y      R  +   H+ F +               
Sbjct: 342 HAKRIELNGSFALGAPTKVDSGPALY------REKSAGAHRNFKVL-PNHYQKSVGKNSD 394

Query: 424 XXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI---KASKMDRNLLKALNGEDAS-- 478
                FSN  AAKAFF+D FQ+P +L NL+SKRRK    K S + +  LK +N   A+  
Sbjct: 395 LRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIE 454

Query: 479 ---QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLI 535
               SK  +++ E TE TLQ+G+IQ LGFDP+ G+I  VL ++   K+++  ++KK   +
Sbjct: 455 IEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEV 514

Query: 536 NDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQD-----TNDSDSDLEIV 583
           + L+ FKK+ ++LKP++E+ L+++  RE  W+++F D     ++DSDSD+EIV
Sbjct: 515 SSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSVNLSSDSDSDIEIV 567

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  486 bits (1250), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 268/599 (44%), Positives = 376/599 (62%), Gaps = 38/599 (6%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           +DPRE+   D Y +++ D KE    I+ ELE IE  K+DL+ RL  +++K+  ++ DPN 
Sbjct: 2   SDPREIAPNDLYQNITPD-KEDARRIELELEKIENVKRDLLERL--HRKKIEIERRDPNF 58

Query: 67  KNINSRGRVEVPRSP-KRESLPAQENLQHNVPQVTHNQXXXXXXXXPNE---EDIVRKEL 122
                   V+VP SP K+  L   E     +  +   +        PNE   +   +K+ 
Sbjct: 59  TG------VQVPASPVKKHELQLVEQKDQKLKNINRFEESNEN---PNELCLQQRFQKQT 109

Query: 123 ----DVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELE 178
               D  A+T YF  KF+++K  E   +  ++ MM +R HTFNG    ++ + +  DELE
Sbjct: 110 ARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELE 169

Query: 179 PYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKED 238
            YSN  I KRY P   +  +LH +KILRLNKLFAKVRPP F EPQYSNWV +G +S K D
Sbjct: 170 QYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSD 229

Query: 239 VKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSG 298
           +K T + KP KY KFTLTDF+H +D Y+FGK+ VERYYNLR+GDIIAVLNPEILPWRPSG
Sbjct: 230 IKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSG 289

Query: 299 CVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHREL 358
             N IKSFNLRI H + CILEIG SRDL  C +V    SK C  PIN K DRCCE+HRE+
Sbjct: 290 KQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREM 349

Query: 359 QMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSIT-GXXXXXXX 417
           ++R   SKR++LSG YALGAPTK+ +QP++Y    +       K + F +T         
Sbjct: 350 EIRKGPSKRLDLSGQYALGAPTKLESQPALY----RGHTAQNVKIQNFKLTPSYSQNNPH 405

Query: 418 XXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALN 473
                      FSN+ AAKAFFDD FQ+P +++NL++KRRKI    K++ ++R L + L 
Sbjct: 406 LIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLR 465

Query: 474 GEDASQSKNKQQV---KEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPT-IS 529
            +   + K +++V   K+ T++TLQ+G+ Q++GFDP+GG+I+++L     +K  +P  +S
Sbjct: 466 KDQDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLS 525

Query: 530 KKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-----QDTNDSDSDLEIV 583
           +K   ++DL+ FKK+ I L PS+   L K+++RE +W+++F      D ++SDSDLEIV
Sbjct: 526 QKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSESDSDLEIV 584

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  485 bits (1249), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 273/582 (46%), Positives = 377/582 (64%), Gaps = 40/582 (6%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPREV   DPY ++S D++++E+ I R+LE +ERK+QDL++R+KE +     K LDPN 
Sbjct: 2   NDPREVLTTDPYDNVSSDEQDEEA-ILRDLENVERKRQDLLNRIKEKQES--KKLLDPNF 58

Query: 67  KNINSRGRVEVPRSPKRES---LPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELD 123
           +      +++VP SP +++   +P       N  ++ H          PNE  I  K   
Sbjct: 59  Q------QLQVPCSPVKKTETNVPVAMKKSTNEMEIPHEN--------PNELRIREKSGQ 104

Query: 124 VVA-TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSN 182
           + + TT+YF  KF+ SK +E   +   + MM+AR HTF       + K IQ +E+E YSN
Sbjct: 105 LPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSN 164

Query: 183 FHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLT 242
             +KKRYIP+ E+ K+LH IKILRL+KLFAKVRPP FSEPQYSNW A+G IS+K D K T
Sbjct: 165 IWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFT 224

Query: 243 NAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNG 302
              KP KY KFT+TDF+H LDVY+FGK  VERYYNLRVGD+IA+LNPE+ PWRPSG    
Sbjct: 225 TTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQF 284

Query: 303 IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRS 362
           IKSFNLRI HDF CILEIG+S+DLG+C++ +   + +CN+PIN   +  C++H+E++ R 
Sbjct: 285 IKSFNLRINHDFKCILEIGSSKDLGFCKVTSRNGT-LCNTPINMSKEDRCDYHQEIRFRD 343

Query: 363 TASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXX 422
             SKRIEL+GS+ALGAPTKV   P++Y+  N     +    + FS++             
Sbjct: 344 NNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSA--SFGSINKDQF 401

Query: 423 XXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDAS 478
                 FSN  +AKAFFD+ FQ+P +L NL SKRRKI    K +++D+ L KA+ G  AS
Sbjct: 402 DLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAI-GNRAS 460

Query: 479 ------QSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKM 532
                  +   +Q+K  TE TLQ+GVIQRLGFDP+ G+IA VL ++  +K +  T+S++M
Sbjct: 461 DDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVL-RTTHSKEEKDTLSEQM 519

Query: 533 G----LINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570
                 +NDL+HF+K  + L P+R   +E+R RRE IW+++F
Sbjct: 520 SGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENF 561

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  482 bits (1240), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 272/590 (46%), Positives = 379/590 (64%), Gaps = 38/590 (6%)

Query: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67
           DPREV   D Y D+   + E+E++I+ ++  IER+K+DL+ RL  N +K   K LDPN+ 
Sbjct: 3   DPREVLNNDLY-DVLTSEGEEENEIEAQIAEIERQKKDLLQRL--NVKKTNPKPLDPNLS 59

Query: 68  NINSRGRVEVPRSPKRES---LPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELDV 124
           +I      +V  SPK+ +   LP     Q    +V +           NE     +E   
Sbjct: 60  HI------QVESSPKKVTNSVLPPTVQQQEPRGEVRNENL--------NELKAQSQEQIP 105

Query: 125 VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFH 184
             TTS+F  K+  SK  ++  V A + ++S R HTF G+    + K I  +ELE +SN  
Sbjct: 106 ANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLW 165

Query: 185 IKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNA 244
           I KRYIPK+E   +   IKILRL+KLFAKV+PP F+EP YSNW  IG IS+K +VK T+A
Sbjct: 166 ISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSA 225

Query: 245 AKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIK 304
           A P KYFKFTLT+F++++D Y+FGK+ VERYYNLRVGDIIA+LNP++LPWRPSG    IK
Sbjct: 226 ASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIK 285

Query: 305 SFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTA 364
           SFNLRI H F CILEIGASRDLGWC M N  +++IC +PIN   + CCE+HREL+ RST 
Sbjct: 286 SFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTN 345

Query: 365 SKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXXXX 424
           +KR+ELSG+YALGAPT++  QP++Y+  +  +N N   + + +  G              
Sbjct: 346 AKRVELSGTYALGAPTRIDAQPALYRGGSSQKNLN---YNIIT-NGADGGSNKEINPLDI 401

Query: 425 XXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDASQS 480
               FSN+ AAKAFFD+ FQ+P  L NLE+KRRK+    K++ ++R L K  N E   + 
Sbjct: 402 NARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK--NSELDIKH 459

Query: 481 KNKQQVKEI---TEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLIND 537
           K+ +++ EI   TE T+ +G+++ LGFDP+ G+IA V    R + +D   +++K   +  
Sbjct: 460 KSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQR-SDSDKKPLTEKDSSVAS 518

Query: 538 LIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF----QDTNDSDSDLEIV 583
           L+ FKKD +KLKPS+EI ++++ RRE +WK+HF     + +DSDSDLEIV
Sbjct: 519 LLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSGGDEKDDSDSDLEIV 568

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  464 bits (1194), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 260/618 (42%), Positives = 379/618 (61%), Gaps = 50/618 (8%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPRE    DP+ DLS D +E E  +  ELE ++R+K DL+ RLKE K +   K+ DPN 
Sbjct: 2   NDPRECSPEDPFADLS-DKEENEDAVLEELEDLDRRKSDLLGRLKELKER--QKRRDPNF 58

Query: 67  KNINSRGRVEVPRSPKRES---LPAQENLQHN----VPQVTHNQXXXXXXXXPNEEDIVR 119
                   V++P +P+ ++     +++ +  N      +V   +        PNE  +  
Sbjct: 59  ------DEVQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVRE 112

Query: 120 KELDV----VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQ-- 173
           +E ++      TTSYF  KF++ K  E       ++M+ AR H F G    S    I+  
Sbjct: 113 REENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQ 172

Query: 174 ---CDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAI 230
               +E+E YS   I+KRYIPK E++ +   IKILRLNKLFAKVRPP F EPQYSNWV +
Sbjct: 173 PEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTL 232

Query: 231 GAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPE 290
           G I+ K  +K T++ KP KYFKFT++DF++N+D+++F K  VERYYNLR+GDIIA+LNPE
Sbjct: 233 GIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPE 292

Query: 291 ILPWRPSGCVN--GIKSFNLRIGHDFNCILEIGASRDLGWCQMVNH-GQSKICNSPINTK 347
           +LPWRPS   N  GIKSFNLRI H+++CI+E+G S+DLG+C + N   +S  C++PI+  
Sbjct: 293 VLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDIS 352

Query: 348 TDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFS 407
            +  C +H+E++ R+  SKRIEL+GS+ALGAP KVG QP +Y++NN         ++   
Sbjct: 353 KEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNV 412

Query: 408 ITGXXXXXXXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASK 463
           + G                  FS+  +AKAFFD+ FQ+P +L NL++KRRKI    +++ 
Sbjct: 413 VKGSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNY 472

Query: 464 MDRNLLKALNGEDASQ-SKNK-----QQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDK 517
           +D+ L KA+  + +++ S NK      ++K  TE TLQTGVIQRLGFDP+ G+IAKVL  
Sbjct: 473 LDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQT 532

Query: 518 SRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF------- 570
            + +  D+   + K+  + DL+ FKK K+ L P++E  +++++RRE +W+KHF       
Sbjct: 533 GKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLA 592

Query: 571 -----QDTNDSDSDLEIV 583
                 D + S+SDLEIV
Sbjct: 593 EQPLNDDVDTSESDLEIV 610

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  461 bits (1186), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 254/564 (45%), Positives = 339/564 (60%), Gaps = 47/564 (8%)

Query: 47  ISRLKENKRKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQ--- 103
           + RLK  K     K+LDPN  +I      ++ RSP++         + + P  T N    
Sbjct: 1   MKRLKAKKED--QKKLDPNFTDI------QIQRSPEK---------KKSNPNTTVNPIPL 43

Query: 104 XXXXXXXXPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGS 163
                   PNE  +V        TTSYF   F  +K +E + V  YQQ MS+R H+F G+
Sbjct: 44  KRLVEDVNPNEAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGA 103

Query: 164 TSLSDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQ 223
                 ++I  +ELE YS F+I KRY+PK+EV K LH IKILRLNKLFAK+RPP FSEP 
Sbjct: 104 NLSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPD 163

Query: 224 YSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDI 283
           Y+NW   G I SKED+KLT++  PVK+FKFT+T+F+H LD+++FG   VE+YYNLRVGDI
Sbjct: 164 YANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDI 223

Query: 284 IAVLNPEILPWRPSGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSP 343
           I +LNPE+LPWRP    N IKSFNLRI H F+CILEI  S+D+ WCQ +N      CN+P
Sbjct: 224 IFILNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTP 283

Query: 344 INTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKH 403
           IN      C++H+E+Q RS  +KR+ELSG+YALGAPT++ ++P++Y+  N S N  P  +
Sbjct: 284 INKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS-NLKPGNN 342

Query: 404 KMFSITGXXXXXXXXXXX-XXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKAS 462
             F+I                     FS+  +AKAFFD+ FQ+P +L NLE+KRRKIK  
Sbjct: 343 --FNIVADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDD 400

Query: 463 KMDRNLLKAL-----NGEDASQSKNKQQVKEI---TEKTLQTGVIQRLGFDPSGGQIAKV 514
           K D  L +AL     N +   + K+ Q+++ +   T+ TLQ G IQ+LGFDP+GGQI  V
Sbjct: 401 KRDVMLQRALRESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVV 460

Query: 515 LDKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRRE---AIWKKHF- 570
           L+KS    T      +K   + +L+ FKK  + LKPSRE+ LEK H RE   A +KK   
Sbjct: 461 LEKSADKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSII 520

Query: 571 ----------QDTNDSDS-DLEIV 583
                        ND+DS DLEI+
Sbjct: 521 AAENRDRKSASTKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 260/610 (42%), Positives = 373/610 (61%), Gaps = 50/610 (8%)

Query: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66
           NDPREV   D + ++S D+ E E ++Q+++E+IER+K+DL  RL E KRK+ S+ +DPN 
Sbjct: 2   NDPREVFENDLFDNISPDEDE-ELELQKQIELIERQKRDLQERL-EYKRKV-SRAVDPNF 58

Query: 67  ----KNIN--SRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNE---EDI 117
                N++  S  R++VP SP++     +++ Q     VT  +        PNE   ++ 
Sbjct: 59  ISTEGNVDATSESRIQVPGSPEK---IKRKHTQLAATPVT--KKNTGIQDNPNELKLKNQ 113

Query: 118 VRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLS-DNKTIQCDE 176
           +        +T+YF N F +SK  E + +  Y+ +MSAR H+F   T+L  +++ I  +E
Sbjct: 114 IEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEE 173

Query: 177 LEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSK 236
            E YS   I +RY+ ++ +D+LL  IKILRLNKLFAK+RPP F  PQYSNWVA+G I+ K
Sbjct: 174 KEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEK 233

Query: 237 EDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRP 296
              KLT++  P KYFKFT+ DF+ N+ ++VF ++ + +YYNLRVGDII +LNP I PWRP
Sbjct: 234 SGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRP 293

Query: 297 SGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQM-VNHGQSKICNSPINTKTDRCCEFH 355
           S     IKSFNL I   ++CI+EIG SRDLGWC + V     K C +PIN   D+CCEFH
Sbjct: 294 SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFH 353

Query: 356 RELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXX 415
           RE + R+ A+KRIEL+GS+ALGAPTK  T PS+Y    K +  N      F++       
Sbjct: 354 RETEFRNAAAKRIELNGSFALGAPTKADTNPSLY----KKKTNNIYSKNQFNVV--RRRN 407

Query: 416 XXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN-- 473
                        F +   AKAFF+D FQ+P +++NL+SKRRK+K +K D  L+K LN  
Sbjct: 408 ARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKT 467

Query: 474 --GEDAS----QSKNKQQVKE---ITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTD 524
              ED      + K+K+ VKE   ITE  +Q G+++ +G+DP+ G++  ++ KS G    
Sbjct: 468 LTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGK--- 524

Query: 525 DPT-ISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTNDS------- 576
           DP+  S +   +NDL+HFKKDK+ LKP +   L K+ +R+ IW ++F D + S       
Sbjct: 525 DPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILS 584

Query: 577 ---DSDLEIV 583
              DSDLEIV
Sbjct: 585 SGDDSDLEIV 594

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  447 bits (1151), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 276/632 (43%), Positives = 371/632 (58%), Gaps = 75/632 (11%)

Query: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67
           DPR+V   DPY +++ D+ E ES IQRELE +ER+K+DL  RLK     L    + P   
Sbjct: 4   DPRDVITADPYDNITSDEDE-ESKIQRELEEMERRKKDLEKRLK-----LKRAHVKPT-- 55

Query: 68  NINSRGRVEVPRSPKRESLPA----------QENLQHNVPQVTHNQXXXXXXXXPNEEDI 117
           ++N +  V+VP SP++ S+ A           E ++     +  N          NE   
Sbjct: 56  DLNLQLDVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNL---NEARF 112

Query: 118 VRKELD-----VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTI 172
            + + D     V ATTSYF  KF+ SK  E   + A + M+SAR HTF G      +K  
Sbjct: 113 AQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGV-----DKEF 167

Query: 173 QCD---ELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVA 229
           Q +   ELE +S+  I KRYIPK  +++ L  +K+LRLNKLFAKVRPP F EPQYSNW  
Sbjct: 168 QLEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAV 227

Query: 230 IGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNP 289
           +  IS K +VK T +  P K+ +FTLT+F+  LD++VFG   V+RYYNLR GDI+AVLNP
Sbjct: 228 LAIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNP 287

Query: 290 EILPWRPSGC---VNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINT 346
           EILPWRPSG       IKSFNL+I H F CILEIG SRDLG+C +     ++ C S IN 
Sbjct: 288 EILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINL 347

Query: 347 KTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNN-----KSRNTNPA 401
             DR CE+HRELQMR  +SKR++L+G +ALGAPTKVGTQP ++++ +      +R+    
Sbjct: 348 ARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRD 407

Query: 402 KHKMF----SITGXXXXXXXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRR 457
           + K F    S                     F++  AAKAFFDD FQ+P +L NL++KRR
Sbjct: 408 QGKRFYTEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRR 467

Query: 458 KIKASKMDRNL---LKALNGED---ASQSKNKQQ---VKEITEKTLQTGVIQRLGFDPSG 508
           K++ SK  R L   LK L  +D   A+  KN  +   +K  TE  L TG+IQRLGFDP+ 
Sbjct: 468 KLQDSKKSRQLDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTH 527

Query: 509 GQIAKVL---DKSRGTKT-DDPTISKKMGLINDLIHFKKDKIKLKPSREIQL--EKRHRR 562
           G+ A V+   D  RG+   +D  +S+K  ++N+L+ +K+DK  L PS E QL   K+HRR
Sbjct: 528 GRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPS-ETQLAHRKQHRR 586

Query: 563 EAIWKKHFQ-----------DTNDSDSDLEIV 583
           E +W++ F            D +DSD DLEIV
Sbjct: 587 E-VWRETFGKKGTPVDSQPVDNDDSD-DLEIV 616

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  413 bits (1062), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/585 (40%), Positives = 352/585 (60%), Gaps = 51/585 (8%)

Query: 6   DNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKEN-KRKLLSKQLDP 64
           + DPREV  LD + D+   D+++++ I+++L+ +ER+++DL  RL++   RK   +Q   
Sbjct: 4   ETDPREVLQLDVH-DIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQ--- 59

Query: 65  NMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDI-VRKELD 123
                 S  RVEVP SPK      +E      PQ   +          N + I V  +  
Sbjct: 60  ------SLERVEVPASPK------EERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNG 107

Query: 124 VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNF 183
              TTSYF   F N++  E + +     ++S R HTF G  SL  ++ +  DE E YS F
Sbjct: 108 PSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGF 167

Query: 184 HIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTN 243
           +I +RY+   E+D+++  IK+LRL KLF+KVRPP F+EP Y+NWVAIG IS K +VKLT+
Sbjct: 168 NISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTS 227

Query: 244 AAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNG- 302
           ++KP KYFK TLTDF HNLD+Y+F  K VE+YYNLRVGDIIA+LNP+ILPWRPS   N  
Sbjct: 228 SSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDE 287

Query: 303 -----IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPIN-TKTDRCCEFHR 356
                +KSFNL I H+F+C+LEIG S+DLG+C++ N    K C +PIN   TDR CE+H+
Sbjct: 288 FSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDR-CEYHQ 346

Query: 357 ELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTN--PAKHKMFSITGXXXX 414
           +++ R   ++R+EL+GS +L +P K G + ++Y  +   R     P KH   +  G    
Sbjct: 347 DVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDG---- 402

Query: 415 XXXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN- 473
                         FSN   AKAFFDDS+Q+P +L NLE+KRRK+K S+ +R L   LN 
Sbjct: 403 -------ESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNS 455

Query: 474 --GEDASQSKN------KQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDD 525
             G+   QS N      ++Q+K+ TE+ L +G+++ +GFDP  G++ +VL   +  K  +
Sbjct: 456 AIGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVL---KFGKNVN 512

Query: 526 PTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF 570
             ++ K   + +++ FKK  + L PS+  Q ++  RRE +W++HF
Sbjct: 513 SGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  397 bits (1021), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/620 (38%), Positives = 349/620 (56%), Gaps = 92/620 (14%)

Query: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKE-NKRKLLSKQLDPNM 66
           DPRE + +D + +LS D   ++ D+ + L+ +ER+K+DL  RL++ ++RK   K++DPN 
Sbjct: 3   DPREPREIDIFDELSCD---EDDDLHKRLDELEREKKDLKQRLQDISQRK---KKIDPNF 56

Query: 67  KNINSRGRVEVPRSPK----------------RES-LPAQENLQHNVPQVTHNQXXXXXX 109
                   VEVPRSP                 RES  PA ENL                 
Sbjct: 57  SG------VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENL----------------- 93

Query: 110 XXPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDN 169
              NE  + +K      +T YF   F +SK  +        +M++ R HTF+G   + + 
Sbjct: 94  ---NELQVQKKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREY 150

Query: 170 KTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVA 229
             I  +E E +S   I KRYI  ++  K+L   K+LRL KLFAKVRPP+F+EPQYSNWV 
Sbjct: 151 SPIAVNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVT 210

Query: 230 IGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNP 289
           IG IS+K  VK+T   KP +YF  TLTDF+H +++Y+FG K VE+YYNL+VGDIIAVLNP
Sbjct: 211 IGIISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNP 270

Query: 290 EILPWRPSGCVNG------IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSP 343
           EI PWRPS   +       IKSFNL I H+FN ILEIG SRD G+C + N  Q K C +P
Sbjct: 271 EIWPWRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTP 330

Query: 344 INTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSR-NTNPAK 402
           IN   +  C +H+E+Q R   +KR+EL+G+ +L +PTK G +  +Y  N   + +  P +
Sbjct: 331 INKSVEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDR 390

Query: 403 HKMFSITGXXXXXXXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKAS 462
           +                         FSN  AA+AFFDD +Q+P  L NL+SKRRK++  
Sbjct: 391 Y-----------APQTQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVG 439

Query: 463 KMDRNLLKALN---GEDASQ------SKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAK 513
           K ++ L K L    G+  S       S  + +++  T+  L++G+I+++GFDP+ G+++ 
Sbjct: 440 KKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSS 499

Query: 514 VL-DKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQ- 571
           VL + S+G K        K   + +++  KK+KI+LKPS+E   +K  +RE +W  HF+ 
Sbjct: 500 VLKNNSKGLKE-----QAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKK 554

Query: 572 --------DTNDSDSDLEIV 583
                   +++D DS+LEIV
Sbjct: 555 EENPNPGVESSDGDSELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  375 bits (963), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 200/477 (41%), Positives = 288/477 (60%), Gaps = 42/477 (8%)

Query: 135 FKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHIKKRYIPKDE 194
           F NS+  E   +    +M+ +R HTF G  +    K I  +E EP S   + +RYI  DE
Sbjct: 4   FANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIASDE 63

Query: 195 VDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFT 254
           + ++L  IKILRL KLF+KVRPP F+EP Y+NWVA+G +  K  VK+T+++KP KYFK T
Sbjct: 64  LAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFKMT 123

Query: 255 LTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVN------GIKSFNL 308
           +TDF H+LDVYVF    VE+YYNLRVGDIIA+LN +ILPWRPS   N       +KSFNL
Sbjct: 124 ITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSFNL 183

Query: 309 RIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTASKRI 368
            I  +++C+LEIG SRDLG+CQ+ N  + K+C +PIN      C++H+E++ R   ++R+
Sbjct: 184 SIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQRV 243

Query: 369 ELSGSYALGAPTKVGTQPSIYKDNNKSRNTN--PAKHKMFSITGXXXXXXXXXXXXXXXX 426
           EL+GS +L +P K G + ++Y  +   R  N  P KH                       
Sbjct: 244 ELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPDKH-----------APQQQDRESQNT 292

Query: 427 XXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALN---GEDASQ---S 480
             FSN   AKAFFDD++Q+P LL NL+SKRRK++ ++ +R L   L+   G+D  Q    
Sbjct: 293 LYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSE 352

Query: 481 KNKQ---QVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSRGTKTDDPTISKKMGLIND 537
           K KQ   Q+K+ TE+T+ +G+++ +GFDP+ G++  VL   + +K    T S +   + +
Sbjct: 353 KTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQ---VRE 409

Query: 538 LIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTND-----------SDSDLEIV 583
           +I  +K  + L PS+  Q ++  RRE +WK+HF+   D           SDSDLEIV
Sbjct: 410 IIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  355 bits (910), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 224/641 (34%), Positives = 340/641 (53%), Gaps = 89/641 (13%)

Query: 1   MVHIIDNDPREVKLLDPYTDLS-EDDKEQE--------------------SDIQRELEMI 39
           M+    NDPRE+     Y  LS E+D  +E                    S ++  L+ I
Sbjct: 1   MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQI 60

Query: 40  ERKKQDLISRLKENK-RKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQ 98
           E ++ DL++RL+E K R     +  P          VEVPRSP +      E        
Sbjct: 61  ESERSDLLARLEELKHRSKKKAKKSPT---------VEVPRSPTKAKCVEDEPAPSTSAS 111

Query: 99  VTHNQXXXXXXXXPNEEDIVRKELDV-VATTSYFQNKFKNSKTDENRMVTAYQQMMSART 157
            T+          P E +  R  L     TTSYF  KF  ++      +   Q+++  R 
Sbjct: 112 TTY-------VEEPEENENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRV 164

Query: 158 HTFNGSTSLSDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPP 217
           +TF+   +  +  T   DE+E YSN  I KRY+P++++ ++LH IK+LRL KLFAKVRPP
Sbjct: 165 YTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPP 224

Query: 218 SFSEPQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYN 277
            FSEP Y+NWV +GAIS K DVK T+  KP KYF   +TDF +++ + VFG+K VE+YY 
Sbjct: 225 KFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYK 284

Query: 278 LRVGDIIAVLNPEILPWRPSGCVNG------IKSFNLRIGHDFNCILEIGASRDLGWCQM 331
           LRVGD+IA+LNPEI PW+ S    G       +SF L I H+ NCILEIG S++LG+C  
Sbjct: 285 LRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPA 344

Query: 332 VNHGQSKICNSPINTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKD 391
           +N  +   C +PIN   ++ C +H+E  +RS  +KR+EL+G+ +L APT+ G Q + Y  
Sbjct: 345 MNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYM- 403

Query: 392 NNKSRNTNPAKHKMFSITGXXXXXXXXXXXXXXXXXXFSNKRAAKAFFDDSFQDPSLLAN 451
              +RN++  K  +                       F++  A +A+FD  + +P +L N
Sbjct: 404 ---TRNSHGTKIGLLP----DVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQN 456

Query: 452 LESKRRKIKASKMDRNLLKALN---GEDASQSKNK------QQVKEITEKTLQTGVIQRL 502
           LESKRRKI+ SK D+ + K L+   G++ +Q K++      QQ ++ T+  ++TG+++ +
Sbjct: 457 LESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHI 516

Query: 503 GFDPSGGQIAKVL---DKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKR 559
           GFDP+GG++A VL   D        +P+IS       +++  KK  I LKPS+E + ++ 
Sbjct: 517 GFDPTGGRMAAVLYQGDHGPADTVREPSIS-------EILANKKRNIDLKPSKEARRKRI 569

Query: 560 HRREAIWKKHFQD-----------------TNDSDSDLEIV 583
            +R  ++   F++                  + SD +LEIV
Sbjct: 570 QQRNEVYNSIFKEEAVATPQGSCETAQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 212/594 (35%), Positives = 335/594 (56%), Gaps = 41/594 (6%)

Query: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67
           DPRE+   DPY +LS+D+ E E  ++R +  I+ +K+DL +RL E ++K   K  DPN  
Sbjct: 7   DPREITAFDPYEELSDDESEIER-VKRRIVEIDTEKRDLTNRLLELEKKRNLK--DPNFD 63

Query: 68  NINSRGRVEVPRSPKRE--SLPAQENLQHNVPQVTHNQXXXXXXXXPNEEDIVRKELDVV 125
           +I      +VP SPK+   +    E+++H  P     +           ED VR+++  +
Sbjct: 64  SI------DVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVN-----EDYVREKVKKL 112

Query: 126 ATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHI 185
            TTSYF  K ++  T+E+  +   +++++ R +TFNG     + + I  DE +  S   I
Sbjct: 113 GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDM-FDEYEPITVDEKDDLSGLVI 171

Query: 186 KKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAA 245
            +RY+P   + K    IK+LRL KLF+KVR P FSEP Y NW+ +G IS K + ++TN+ 
Sbjct: 172 DRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSV 231

Query: 246 KPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWR--PSGCVNGI 303
           KPVK+F  T++DF+  L+V  FGK  VE+YY LR+GD+IA+LNPEI+P +   +G     
Sbjct: 232 KPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSY 291

Query: 304 KSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRST 363
            +F+L++  D N ILE+G S++ G CQ     + K+C +PIN   D  C +H+E +MR  
Sbjct: 292 ATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQN 351

Query: 364 ASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGXXXXXXXXXXXXX 423
           +S+R+E+S S A+ AP   G Q +I K  +     N  K  +                  
Sbjct: 352 SSRRVEISSSVAMRAPVVKGYQQTIVKSQH-----NNGKTSIRYQQNPDKPFVREPAAAE 406

Query: 424 XXXXXFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKASKMDRNLLKALNG-EDASQSKN 482
                FS+  A+ AFFDD +++P +LANL++KRRKI+  + +RNL K L G  D   SK 
Sbjct: 407 TNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNLEKKLKGLSDKLLSKK 466

Query: 483 KQQVKEITEKT-----LQTGVIQRLGFDPSGGQIA-KVLDKSRGTKTDDPTISKKMGLIN 536
           + +V +  +KT      Q G+  ++G+DP+ G+ + ++L+ S  T+   P   K++  I 
Sbjct: 467 EDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYS--TENKAPKNDKQLA-IT 523

Query: 537 DLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQDTND-------SDSDLEIV 583
           D+ + KKD + LKPS++   EK  +R AI+ +  + + +       S  DLEI+
Sbjct: 524 DICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>Smik_5.111 Chr5 complement(152669..153961) [1293 bp, 430 aa] {ON}
           YEL002C (REAL)
          Length = 430

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 3   HIIDNDPREVKLLDPY--TDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSK 60
           HI D+   E+K +DPY    LS    + E+      E +   +  + + L + ++  LS 
Sbjct: 307 HIADDIQFELKQVDPYYRLTLSPSGNDSETQFYSTGEFVLPDRHGVFTFLTDYRKIGLSS 366

Query: 61  QLDPNMKNINSRGRVEVPRS 80
             D ++K I      E PRS
Sbjct: 367 TTDKDVKAIRHLANDEYPRS 386

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 18  YTDLSEDDKEQESDIQRELEMIERKK--QDLISRLKENKRKLLSKQLDPNMK--NINSRG 73
           +TD SE  +EQ  D++RE E++E+++  Q+ ++        LL+  LD  M+  N+  + 
Sbjct: 679 WTDCSEQQREQ--DLEREKELVEQEQSLQNYLANEDWANAFLLAITLDHPMRLFNVLRQS 736

Query: 74  RVEVPRSPKR-ESLPAQENLQHNVPQVTHNQ 103
               P S KR E++   + L H +  +T +Q
Sbjct: 737 LHYSPESEKRDETVIFNKELDHVISTLTSDQ 767

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,001,824
Number of extensions: 2904074
Number of successful extensions: 15009
Number of sequences better than 10.0: 136
Number of HSP's gapped: 15588
Number of HSP's successfully gapped: 138
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)