Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06567g5.700ON1169116950760.0
ZYRO0G06644g5.700ON116690925670.0
AFR284W5.700ON1103114724430.0
TDEL0B022105.700ON109589823690.0
NCAS0G002505.700ON118369422110.0
Kpol_1043.685.700ON104289121420.0
Smik_9.225.700ON123077219780.0
Skud_9.215.700ON122177419570.0
YIL147C (SLN1)5.700ON122076719530.0
Suva_9.415.700ON121978619450.0
Kpol_2001.745.700ON111369218660.0
SAKL0E14872g5.700ON114070318420.0
KNAG0L021105.700ON120072317990.0
Kwal_55.197075.700ON114369917510.0
KLLA0A00638g5.700ON115569817400.0
Ecym_40205.700ON112568617000.0
TBLA0I016805.700ON121474316550.0
NDAI0F003105.700ON125935713811e-169
KAFR0D022405.700ON118735712801e-155
KLTH0E01100g5.700ON117735511081e-131
TPHA0E002505.700ON106844710601e-125
TPHA0D045905.700ON112735810491e-123
TBLA0E021005.700ON11403598555e-96
ADL388W4.385ON4821531567e-10
KNAG0M001804.385ON6151311541e-09
Ecym_74744.385ON4961291513e-09
Skud_8.2734.385ON6231631514e-09
KAFR0B069904.385ON5451291504e-09
YHR206W (SKN7)4.385ON6221631496e-09
NCAS0A064504.385ON6091291496e-09
Suva_15.4124.385ON6171631497e-09
CAGL0F09097g4.385ON6301291488e-09
Smik_8.2964.385ON6251351471e-08
SAKL0B12408g4.385ON4651291451e-08
KLTH0D17182g4.385ON4641291452e-08
TDEL0D003204.385ON5471291442e-08
TBLA0A107004.385ON5871221442e-08
KLLA0A10219g4.385ON4751291432e-08
ZYRO0G00484g4.385ON6471291416e-08
Kpol_265.24.385ON5491271399e-08
NDAI0D034304.385ON5971191399e-08
Kwal_47.167704.385ON4611291389e-08
TPHA0C001504.385ON5101291391e-07
Kwal_33.152885.230ON5871591381e-07
KNAG0B051405.230ON6481431362e-07
KAFR0J007005.230ON6201541291e-06
Ecym_50775.230ON7951461292e-06
TDEL0E039805.230ON7301351282e-06
CAGL0D02882g5.230ON6671591282e-06
ZYRO0A11154g5.230ON7761711255e-06
YLR006C (SSK1)5.230ON7121591211e-05
KLTH0B02684g5.230ON5951561192e-05
ADR343C5.230ON7491391193e-05
KLLA0E09505g5.230ON6351021183e-05
Smik_12.685.230ON7121591174e-05
Skud_12.725.230ON7021591175e-05
Kpol_1004.45.230ON7141621175e-05
Suva_10.845.230ON6951591157e-05
NCAS0D029005.230ON7621511131e-04
TBLA0D031705.230ON7651761112e-04
NDAI0I020005.230ON8901551103e-04
TPHA0N008505.230ON6701501030.002
SAKL0G12100g5.230ON73881960.013
KLLA0E04533g7.222ON42181860.19
CAGL0K12562g8.34ON1682140850.33
KLTH0G18612g8.34ON1524131840.40
SAKL0F08184g7.222ON41294781.5
KLTH0D11066g8.669ON49365772.4
Ecym_70488.555ON194587754.6
Kwal_14.11598.34ON1521127737.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06567g
         (1169 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...  1959   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   993   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   945   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   917   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   856   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   829   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   766   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   758   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   756   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   753   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   723   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   714   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   697   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   679   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   674   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   659   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   642   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   536   e-169
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   497   e-155
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   431   e-131
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   412   e-125
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   408   e-123
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   333   5e-96
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    65   7e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    64   1e-09
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    63   3e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   4e-09
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    62   4e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    62   6e-09
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    62   6e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    62   7e-09
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    62   8e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    61   1e-08
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    60   1e-08
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    60   2e-08
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    60   2e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    60   2e-08
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    60   2e-08
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    59   6e-08
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    58   9e-08
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     58   9e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    58   9e-08
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    58   1e-07
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    58   1e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    57   2e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    54   1e-06
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    54   2e-06
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    54   2e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    54   2e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    53   5e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    51   1e-05
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    50   2e-05
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    50   3e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    50   3e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    50   4e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    50   5e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    50   5e-05
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    49   7e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    48   1e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    47   2e-04
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    47   3e-04
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    44   0.002
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    42   0.013
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    38   0.19 
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    37   0.33 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    37   0.40 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    35   1.5  
KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} simila...    34   2.4  
Ecym_7048 Chr7 (95931..101768) [5838 bp, 1945 aa] {ON} similar t...    33   4.6  
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    33   7.8  

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score = 1959 bits (5076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1169 (83%), Positives = 981/1169 (83%)

Query: 1    MDSTESAXXXXXXXXXXXXIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDR 60
            MDSTESA            IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDR
Sbjct: 1    MDSTESAPRRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDR 60

Query: 61   LYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXX 120
            LYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQK  
Sbjct: 61   LYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFL 120

Query: 121  XXXXXXXXXRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTD 180
                     RVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTD
Sbjct: 121  SSSNLFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTD 180

Query: 181  PVLNGTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIV 240
            PVLNGTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIV
Sbjct: 181  PVLNGTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIV 240

Query: 241  SARYSNYTKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTK 300
            SARYSNYTKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTK
Sbjct: 241  SARYSNYTKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTK 300

Query: 301  DVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWA 360
            DVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWA
Sbjct: 301  DVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWA 360

Query: 361  VKPIVRLQKATELIAEXXXXXXXXXXXXXXXXXXXXXMKKDINDLNFISRLSLSEKNHRP 420
            VKPIVRLQKATELIAE                     MKKDINDLNFISRLSLSEKNHRP
Sbjct: 361  VKPIVRLQKATELIAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRP 420

Query: 421  AYDSASDSNYATDGSLSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYRRLF 480
            AYDSASDSNYATDGSLSHDLQTSQA                     NLNEARLPDYRRLF
Sbjct: 421  AYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLF 480

Query: 481  SDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHE 540
            SDELSDLTNTFNAMTDALDQHYALLEDRVRART                 TVFIANISHE
Sbjct: 481  SDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHE 540

Query: 541  LRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTALEK 600
            LRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSG            FSKNVLKRTALEK
Sbjct: 541  LRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEK 600

Query: 601  RNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNAL 660
            RNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNAL
Sbjct: 601  RNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNAL 660

Query: 661  KFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHXXX 720
            KFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKH   
Sbjct: 661  KFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHLST 720

Query: 721  XXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXXXXXXXXXXXXXXXXXNALFNTQFKK 780
                        KYNEKTYDEDDDEHSITNI                   NALFNTQFKK
Sbjct: 721  SSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSSTSSYDNALFNTQFKK 780

Query: 781  TPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGG 840
            TPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGG
Sbjct: 781  TPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGG 840

Query: 841  TGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPES 900
            TGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIK            NPES
Sbjct: 841  TGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPES 900

Query: 901  KKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEP 960
            KKNRRVKFKD             VDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEP
Sbjct: 901  KKNRRVKFKDSTRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEP 960

Query: 961  DNLPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNVPTMADVTMRF 1020
            DNLPKVG                       VHLDRPFLQSTGTATSSRNVPTMADVTMRF
Sbjct: 961  DNLPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMADVTMRF 1020

Query: 1021 KILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMP 1080
            KILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMP
Sbjct: 1021 KILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMP 1080

Query: 1081 KVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEE 1140
            KVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEE
Sbjct: 1081 KVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEE 1140

Query: 1141 YCPNWIEMXXXXXXXXXXXXVEENKPKKE 1169
            YCPNWIEM            VEENKPKKE
Sbjct: 1141 YCPNWIEMKKSKENKDGDKKVEENKPKKE 1169

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/909 (57%), Positives = 621/909 (68%), Gaps = 28/909 (3%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           +GIRAQLTALVSIVA +SLIILAV+TGVYFT NYKNLRS+RLY+AAQLKS+Q+DQNLNY+
Sbjct: 17  LGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQIDQNLNYM 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYWL+SRDTLQ ALA+YVAGNKT  NW +S NVIQK            +YD  F PV
Sbjct: 77  YYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYDATFTPV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           L+ TNNGTG+ +PES  ++L PLS + PLPSSL + G+LT+PVLNGT YLMSMSLPIFAN
Sbjct: 137 LSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +   VYGYIT+VMSA+ L++VF+DTTALEKSNVAI+SA Y     + SY FVF P
Sbjct: 197 PSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSYNFVFAP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
            GV  SIL  T  + + +FL+ A +Q KGG++++TKF YTK VA+GY PCS  FVNW+AV
Sbjct: 257 LGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVNWIAV 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEXXX 379
           V Q+E+VF+ P+TKLTKIISGTVVGI VFV L+TFPLA WAVKPIVRLQKATELI E   
Sbjct: 317 VLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITEGRG 376

Query: 380 XXXXXXXXXXXXXXXXXXMKKDINDLNFISRLSLS----EKNHRPAYDSASDSNYATDGS 435
                                  ++     R  ++    EK H    +      +A +GS
Sbjct: 377 LRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSRVTDNHNEKGHDLHGEQIQHGFFAMNGS 436

Query: 436 LSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYRRLFSDELSDLTNTFNAMT 495
           ++H L  S A                     NL EAR+P YRR FSDELS+LT+TFN MT
Sbjct: 437 INHSLAASIA---SSGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMT 493

Query: 496 DALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAIS 555
           DALDQHYALLEDRVRART                 TVFIANISHELRTPLNGILGMTAIS
Sbjct: 494 DALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAIS 553

Query: 556 MEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTALEKRNFCITDVALQIKSI 615
           MEE DI KI+NSLKLIFRSG            FSKNVLKRT LEKRNF +TDVALQIKSI
Sbjct: 554 MEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSI 613

Query: 616 FGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKL 675
           FGKVAKDQ VRLSI+L PN+IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKVNV + L
Sbjct: 614 FGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSL 673

Query: 676 LGEYDEEATKADNFKQIHTIADSDA-------------HQQHPVSSSPNGVLVKHXXXXX 722
           LGEYD E ++ +N K+++ I  ++               ++  + ++PN     +     
Sbjct: 674 LGEYDAERSENENHKKVYVIPGTEPKGNDEKDKGGIEEKERFSIENTPNDT-SSNSSNKH 732

Query: 723 XXXXXXXXXXKYNEKTYDEDDD--EHSITNIXXXXXXXXXXXXXXXXXXXNALFNTQFKK 780
                       +EK   +D D  E  + +                    + +F++QFKK
Sbjct: 733 SDTETTPGLNDTDEKQASDDMDGGEEDVED-----ADEVSSFSTSTSSYNDTVFHSQFKK 787

Query: 781 TPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGG 840
           TP + +DS++ LG E+ D+K WV +I VEDTGPGID  LHESVFEPFVQGDQ LSRQYGG
Sbjct: 788 TPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGG 847

Query: 841 TGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPES 900
           TGLGLSICRQLATMM+GTM L+SK+GVGS+FTFTVPL QTR I             NP+S
Sbjct: 848 TGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDS 907

Query: 901 KKNRRVKFK 909
           KKNR+VKFK
Sbjct: 908 KKNRKVKFK 916

 Score =  234 bits (596), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%), Gaps = 3/154 (1%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050
            V LDRPFLQSTGTA+S+ N+ T + +    KILVAEDN VNQEVIKRMLNLEG++NI+L 
Sbjct: 956  VRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRMLNLEGVHNIELV 1012

Query: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110
            CDGQ+A DKV+ LVE  + Y++IFMD+QMPK+DGLLSTKMIRRDLNY   IVALTAFADD
Sbjct: 1013 CDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADD 1072

Query: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPN 1144
            SNI+EC++AGM+GFL+KPIKR +L+ I+EE+CP+
Sbjct: 1073 SNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD 1106

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1147 (47%), Positives = 696/1147 (60%), Gaps = 95/1147 (8%)

Query: 21   GIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYLY 80
            G+R QLT LV I+A  SLIILA TTGVYFTSNY+ LR+DRL++AA+L SSQ+DQ+L  LY
Sbjct: 20   GLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVDQSLTLLY 79

Query: 81   YQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPVL 140
            YQC  L+++DT+QNAL+ Y AGN++ ENW E+  ++              +YD  ++ VL
Sbjct: 80   YQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDEMYQEVL 139

Query: 141  NTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFANP 200
            +  NN T   + E    +L PL  D    +  +   + T P  N T  LMSM+LP+ A  
Sbjct: 140  SRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMTLPVEA-- 196

Query: 201  SIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPPY 260
            S I     V G++T+VMSA+ + +V NDT+ L +S V+I++   ++   +  YRFVFPP 
Sbjct: 197  STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKYRFVFPPG 255

Query: 261  GVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYT--------KDVAIGYYPCSFN 312
                S+    + + ++SFL  AF       +  T  FY         K VA+GY  C F 
Sbjct: 256  ETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYSACKFR 315

Query: 313  FVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATE 372
             ++WVAVVSQ ESVFLSP+ KLTKII GTV+G+AVF+ ++TF LASWAVKPIVRLQKATE
Sbjct: 316  QLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRLQKATE 375

Query: 373  LIAEXXXXXXXXXXXXXXXXXXXXXMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYAT 432
             IA                              + + R    +K+H   +   ++++ A 
Sbjct: 376  FIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPF--VTENHAAN 433

Query: 433  DGSLS---------------HDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYR 477
             GS S               HD +TS                       N  + R+P YR
Sbjct: 434  SGSCSSMSDHERYLHHIARYHDGETS--------TNILSDHEKGSTSATNWIDTRVPVYR 485

Query: 478  RLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANI 537
            RLF+DELS+LT+TFN MTD LD+ Y +LEDRVRART                 TVFIANI
Sbjct: 486  RLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANI 545

Query: 538  SHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTA 597
             HELRTPLNGILGMTAI+M E D  KI+NSLKLIFRSG            FSKNVLKRT 
Sbjct: 546  FHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTK 605

Query: 598  LEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVS 657
            LE+R+F I D+ALQ+KSIFGK+AKDQHV+LSI L PN IRTMVLWGDSNRIIQIVMNLVS
Sbjct: 606  LEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVS 665

Query: 658  NALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKH 717
            NALKFTPVDGKV+VRIKL+GEYD   ++A NF +++ +  ++      V++ P  V  + 
Sbjct: 666  NALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEV-TNSSVNNIPTVVEEEE 724

Query: 718  XXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXXXXXXXXXXXXXXXXXNALFNTQ 777
                           K  +    +D D  SI++                    +A+ + Q
Sbjct: 725  KACEEEPTADDTPERKKKDSETVDDADAISISS-------------SVATSYDDAVLHAQ 771

Query: 778  FKKTP---DLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTL 834
             KK P   DL +  N+   ++L   ++WV  IEV+DTGPGI+P LHESVF+PFVQGDQTL
Sbjct: 772  LKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTL 831

Query: 835  SRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXX 894
            SRQYGGTGLGLSICRQLATMM GTMKLESKVG GSKFTFTVPL+QT  +K          
Sbjct: 832  SRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFED 891

Query: 895  XXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQSSEGHSTSFKISEVKDEDI 954
              N  SKKNR+VKF+                   N SG  +  + ++++     + +  I
Sbjct: 892  EFNIFSKKNRKVKFQ------------------LNRSGKSRKGKMNNSN-GAGSIAESAI 932

Query: 955  EQSPEPDNLPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNVPTMA 1014
            E   + ++    G                       V +DRPFLQSTGTATS+R+VPT++
Sbjct: 933  ESFGKSESEASFG----------------------SVRVDRPFLQSTGTATSTRSVPTLS 970

Query: 1015 DVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIF 1074
                  +ILVAEDN+VNQEVIKRML+LEG +NIDLACDG+DA+ KV +LVEQ + YD+IF
Sbjct: 971  SAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIF 1030

Query: 1075 MDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKL 1134
            MD+QMP++DGLL+TK++R+ L+Y+  IVALTAFADDSNIKEC+E+GMN FL+KPIKRP L
Sbjct: 1031 MDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPML 1090

Query: 1135 KMILEEY 1141
            K IL E+
Sbjct: 1091 KKILLEH 1097

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/898 (55%), Positives = 604/898 (67%), Gaps = 31/898 (3%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IR QLTALVS+VA +SLIILAVTTGVYFTSNYK+LRS+RLY+AAQLKSSQ+DQNLNYL
Sbjct: 17  ISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQIDQNLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYWL+S+ TLQ +LA+YV+GNKT+ NW +S++V+QK           RVYD DF+ V
Sbjct: 77  YYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYDADFQTV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD + + +  +L PLS+++ LP+SL + GMLTDPVLNGT YLMSMSLPI+AN
Sbjct: 137 LNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLPIYAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII ++ +VYGY+T++MSA+ L+SV++D TALEKS+V IVSA Y     + SYRFVF P
Sbjct: 197 PSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRFVFAP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG +P IL+ T+ ++++SFL+ A +Q K GS ++T  FY +  A+GY PCSF FVNWVA+
Sbjct: 257 YGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVNWVAI 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEXXX 379
           +SQ+E+VF+ PST+LTKII G VVGI  FV + TFPLA WAV+PIVRLQKATE+I E   
Sbjct: 317 ISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIITEGRG 376

Query: 380 XXXXXXXXXXXXXXXXXXMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHD 439
                              ++     +  S     EK    A   AS     T+GS ++D
Sbjct: 377 LRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKG---AVGRAS-----TEGSFNYD 428

Query: 440 LQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYRRLFSDELSDLTNTFNAMTDALD 499
                                      NL EAR+P YR  FSDE S+LT+TFN MT+ALD
Sbjct: 429 ---QAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALD 485

Query: 500 QHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEET 559
           QHYALLEDRVRART                 TVFIANISHELRTPLNGILGMTAISMEE 
Sbjct: 486 QHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEER 545

Query: 560 DIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTALEKRNFCITDVALQIKSIFGKV 619
           DI KI++SLKLIFRSG            FSKNVL+RT LEKR+F ITDVA+QIKSIFGKV
Sbjct: 546 DIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKV 605

Query: 620 AKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEY 679
           AKDQ V+ SI+L PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+VR++LLGEY
Sbjct: 606 AKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEY 665

Query: 680 DEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTY 739
           D++ ++ ++FK ++ I D    ++  +   P     K                K+NE+  
Sbjct: 666 DKQRSENEDFKAVYVI-DGTEPREDGLIPPPVKQFEKQ-----EDLEKEKISEKHNEEEA 719

Query: 740 DEDDDEHSITNI--------XXXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDG 791
              D E   TN+                           + +F+TQFKK      D N  
Sbjct: 720 STSDSEK--TNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTSSSGDEN-- 775

Query: 792 LGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQL 851
            G  L   K W  ++EVEDTGPGIDP LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQL
Sbjct: 776 -GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQL 834

Query: 852 ATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFK 909
           ATMM+GTMKL+SK+GVGSKFTFT+PL QTR I+            NP SKKNR+VKFK
Sbjct: 835 ATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIE-FEDENAFEDEFNPLSKKNRKVKFK 891

 Score =  245 bits (625), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 112/152 (73%), Positives = 135/152 (88%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050
            V LDRPFLQSTGTA+SS+NV  +++V   ++ILVAEDNHVNQEVIKRML LEGI+ IDLA
Sbjct: 934  VSLDRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLA 993

Query: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110
             DGQDAFDKV++L E+ + Y++IFMD+QMPKVDGLL+TKMIR+DL+Y+  IVALTAFADD
Sbjct: 994  ADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADD 1053

Query: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYC 1142
            SNI+ C+EAGMNGFLSKPIKRPKLK I+ +YC
Sbjct: 1054 SNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/694 (62%), Positives = 512/694 (73%), Gaps = 21/694 (3%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           +GIR QLT LVS+VA  SL+ILA+TTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQNLNYL
Sbjct: 17  LGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQNLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ YWL+SRDTLQ  L +YVAGNKT ENW +S  VIQK           ++YD  F  V
Sbjct: 77  YYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYDSSFNAV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           L  TNNGTGD +PES+  +L+PL+T+ PL SSL T G+LTDPVLNG+ Y+MSMSLPIFAN
Sbjct: 137 LTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D KVYGYIT+VMSAEGL++VFNDTTALE+SNVAIVS  Y+N + +++Y FVF P
Sbjct: 197 PSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAYHFVFAP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG    ++N TF + ++SFLN A ++ KGGS+KKTKFFYTK++A+GY PC+F+FVNW+A+
Sbjct: 257 YGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSFVNWIAI 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEXXX 379
           VSQ ESVFLSPSTKL KIISGTVV I VFV L+TFPLA WAVKPIVRLQKATEL++E   
Sbjct: 317 VSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATELMSEGRG 376

Query: 380 XXXXX--XXXXXXXXXXXXXMKKDI------------NDLNFISRLSLSEKNHRPA---- 421
                               ++ +I            ++L+  +   L+++   P     
Sbjct: 377 LKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQRGLTPTPMPT 436

Query: 422 --YDSASDSNYATDG-SLSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYRR 478
               S SDSN+AT+  S ++  Q + +                     NL EAR+PDYRR
Sbjct: 437 TDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRR 496

Query: 479 LFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIS 538
           LFSDELSDLT+TFNAMTDALDQHYALLEDRVRART                 T+FIANIS
Sbjct: 497 LFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANIS 556

Query: 539 HELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTAL 598
           HELRTPLNGILGMTAISMEETDIAKIR+SLKLIFRSG            FSKNVLKRT L
Sbjct: 557 HELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTL 616

Query: 599 EKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSN 658
           EKR+FCITDVALQIKSIFGKVAKDQ VRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSN
Sbjct: 617 EKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSN 676

Query: 659 ALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQI 692
           ALKFTPVDGKVNVRIKL+GEYDE  ++  NFK++
Sbjct: 677 ALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKV 710

 Score =  267 bits (683), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050
            V++DRPFLQSTGTATS+R + T+ D   +FKILVAEDNHVNQEVIKRMLNLEG+ NI+LA
Sbjct: 1016 VNMDRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELA 1075

Query: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110
             DGQDAF++V+++VEQ + +DMIFMD+QMPKVDGLLSTKMIR DL+Y   IVALTAFADD
Sbjct: 1076 RDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADD 1135

Query: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
            SNIKEC+EAGMNGFLSKPIKRPK+K ILEEYCPNW
Sbjct: 1136 SNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNW 1170

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/891 (48%), Positives = 569/891 (63%), Gaps = 46/891 (5%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           + +R QLT LV  VA +SL+ILA++TGVYFT NY++LR  +LYIAA+LKSSQ+DQ +N L
Sbjct: 16  VKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTINLL 75

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQC WL  RD +++AL  Y AGN++ ENW  +++V+              +YD  F  +
Sbjct: 76  YYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQFNLI 135

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNN T D +P+ + + L PLS    LPS L T G+LTDPVLN + YLMSMSLPI AN
Sbjct: 136 LNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPIIAN 195

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PS+  SD +V+GY+TVVMSAE +R+V NDTTALEKS VA++S+  +N T    Y FVFPP
Sbjct: 196 PSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYHFVFPP 255

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           +G S  I+N  + +++S+FL+ AF   +GGSI K+K  Y+K VAIGY+PCSF   NWV  
Sbjct: 256 HGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLANWVGT 315

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEXXX 379
           VSQ E VF+S S KLTKII+GTV+ I VFV ++TFPL+ W+V+PIVRLQKATE+I++   
Sbjct: 316 VSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISKRDG 375

Query: 380 XXXXXXXXXXXXXXXXXXMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHD 439
                              ++  +  +  S  +L E   +  Y     +N +T+ SLS +
Sbjct: 376 NEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEK--YTEIGKANKSTE-SLSKE 432

Query: 440 LQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLPDYRRLFSDELSDLTNTFNAMTDALD 499
             T  +                     NL + ++P  RR   DELS+LT T+  MTDALD
Sbjct: 433 NITDYS----------SSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALD 482

Query: 500 QHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEET 559
           +H  LLE RV+ RT                 TVFIAN++HELRTPLNGILGMTAI+MEET
Sbjct: 483 EHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEET 542

Query: 560 DIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTALEKRNFCITDVALQIKSIFGKV 619
           D+ +I++SLKLI+RSG            FSKNVLK+T LEK +FC+ D+ALQI+SIFGK+
Sbjct: 543 DMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKI 602

Query: 620 AKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEY 679
           +KDQHV+LSI + PN +R+MVLWGD NRI+Q++MNLVSNALKFTPVDGK+ V IKLLGEY
Sbjct: 603 SKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEY 662

Query: 680 DEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTY 739
           D++ + A+N+K ++     ++          NG  +K                  + K+ 
Sbjct: 663 DKDRSAAENYKDVYMKEIRNS----------NGDKIKPLMTLISSKDTMSVADNISNKSV 712

Query: 740 DEDDDEHSITNIXXXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQ 799
             D +  +                       N +++ +FK   + ++D++D +G  L  +
Sbjct: 713 ASDTERST----------------------NNTIYSNKFKNGSN-FQDTDDAIGVPLDKK 749

Query: 800 KTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTM 859
           + WV ++EVEDTGPGI+P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +MHGTM
Sbjct: 750 RKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTM 809

Query: 860 KLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKD 910
           KLES+VGVGSKF FTVPL QTR I+            N  SKKNR VKF++
Sbjct: 810 KLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQE 860

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 73/124 (58%), Positives = 98/124 (79%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            FK+L+ EDN VNQ V+ RML LEGI N  +ACDGQ+A +K++ +  + + Y ++ MDIQM
Sbjct: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            PKVDG+ +TK+IR++L Y   IVALTAFADDSNI+ C ++GM+GFL+KPIKR +LK IL 
Sbjct: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036

Query: 1140 EYCP 1143
            E+CP
Sbjct: 1037 EFCP 1040

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/772 (54%), Positives = 480/772 (62%), Gaps = 47/772 (6%)

Query: 413  LSEKNHRPAYDSASDSNYATDGSLSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEAR 472
            L  ++ +   ++ +D+  + DGSL+HDL    +                     NL EAR
Sbjct: 451  LPSEDEKKIPNNNTDAKVSMDGSLNHDLLAPNSLRNNDTDRSSNRSHILTTSA-NLTEAR 509

Query: 473  LPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTV 532
            LPDYRRLFSDELSDLT TFN MTDALDQHYALLEDRVRART                 TV
Sbjct: 510  LPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTV 569

Query: 533  FIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNV 592
            FIANISHELRTPLNGILGMTAISMEETD+ KIRNSLKLIFRSG            FSKNV
Sbjct: 570  FIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNV 629

Query: 593  LKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIV 652
            L+RT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRIIQIV
Sbjct: 630  LQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIV 689

Query: 653  MNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT-----------------I 695
            MNLVSNALKFTPVDG V+VR+KLLGEYD++ ++   FK++H                  I
Sbjct: 690  MNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDI 749

Query: 696  ADSDAHQQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXX 755
              S  H++H    S    +  +                 NE  Y   +D   ++      
Sbjct: 750  PISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRMNDAEKLS-----S 804

Query: 756  XXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGI 815
                           +A+FN+QF K P   ED    LG  + + KTWV +IEVEDTGPGI
Sbjct: 805  DDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIEVEDTGPGI 864

Query: 816  DPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTV 875
            DP L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MM+GTM+LESKVGVGSKFTFT+
Sbjct: 865  DPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTL 924

Query: 876  PLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHS---- 931
            PL QT+ I             NPES+KNRRVKF                   TN S    
Sbjct: 925  PLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLIN 984

Query: 932  ------GDKQSSEGHSTSFKISEVKDED------IEQSPEPDNLPK---VGXXXXXXXXX 976
                  G K  +E     F+ S +K E       IEQ  +  N+                
Sbjct: 985  DVLPEIGSK--NENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKT 1042

Query: 977  XXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNVPTMAD---VTMRFKILVAEDNHVNQE 1033
                          V+LDRPFLQSTGTATSSRNVPT+ D        KILV EDNHVNQE
Sbjct: 1043 VPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQE 1102

Query: 1034 VIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRR 1093
            VIKRMLNLEGI NI+LACDGQ+AFDKV+ L  +  +Y+MIFMD+QMPKVDGLLSTKMIRR
Sbjct: 1103 VIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRR 1162

Query: 1094 DLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
            DL YK  IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL E+C  +
Sbjct: 1163 DLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY 1214

 Score =  492 bits (1267), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 246/357 (68%), Positives = 290/357 (81%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           IGIRAQLTALVSIVA +SLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQ LNYL
Sbjct: 17  IGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ Y+LASRD LQ++L S+VAGNK+ +NW +S +V+QK           +VYD  F  V
Sbjct: 77  YYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAKVYDSSFTTV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD +PE + + LFPLSTD PLPSSL T G+LTDPV+N TDYLMSMSLPIFAN
Sbjct: 137 LNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D +VYGYIT++MSAEGL+SVFNDTTALEKSNVAI+SA Y+N  K   Y F+FPP
Sbjct: 197 PSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKASGYHFIFPP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG + ++    F + +++F++ AF+  KGGS+K+T  F  K++A+GY PCSF  VNWVAV
Sbjct: 257 YGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCSFQLVNWVAV 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQ ESVFLSP+TKL KII+GTV+ I VFV LLT PLA WAV+PIVRLQKATELI E
Sbjct: 317 VSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/774 (53%), Positives = 487/774 (62%), Gaps = 46/774 (5%)

Query: 410  RLSLSEKNHRPAYDSASDSNYATDGSLSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLN 469
            +LS SE+ ++   ++ +D   + DGSL+HDL    +                     NL 
Sbjct: 449  KLSPSEEENKIP-NNHNDVKISMDGSLNHDLLAPNSLRNNDTDRSSSRSHILTTSA-NLT 506

Query: 470  EARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXX 529
            EARLPDY+RLFSDELSDLT TFN MTDALDQHYALLEDRVRART                
Sbjct: 507  EARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEA 566

Query: 530  XTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFS 589
             TVFIANISHELRTPLNGILGMTAISMEETD+ KIRN+LKLIFRSG            FS
Sbjct: 567  KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGELLLHILTELLTFS 626

Query: 590  KNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRII 649
            KNVL+RT LE+R+FCITDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRII
Sbjct: 627  KNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRII 686

Query: 650  QIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT--------IADSDAH 701
            QIVMNLVSNALKFTPVDG V+VR+KLLGEYD+++++   FK++H         + +S   
Sbjct: 687  QIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDK 746

Query: 702  QQHPVS---------SSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIX 752
            +  P S          S    +                    NE  Y + +D    +N  
Sbjct: 747  RDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDREKSSN-- 804

Query: 753  XXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTG 812
                              +A+FN+QF K  D   D +  +G  + + KTWV +IEVEDTG
Sbjct: 805  ---DDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTG 861

Query: 813  PGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFT 872
            PGI+P L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKLES+VGVGSKFT
Sbjct: 862  PGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFT 921

Query: 873  FTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITN--- 929
            FT+PL QT+ I             NPESKKNRRVKF                  +TN   
Sbjct: 922  FTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNT 981

Query: 930  ---------HSGDKQSSEGHSTSFKISEVKDED--IEQSPEPDNLP---KVGXXXXXXXX 975
                      S D++  E      K  E ++E+   +Q P+  N                
Sbjct: 982  LANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQK 1041

Query: 976  XXXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNVPTM----ADVTMRFKILVAEDNHVN 1031
                           V++DRPFLQSTGTATSSRNVPT+     D T   KILV EDNHVN
Sbjct: 1042 TVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGT-SIKILVVEDNHVN 1100

Query: 1032 QEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMI 1091
            QEVI+RMLNLEGI+NI+LACDGQ+AFDKV+ L  + ++Y+MIFMD+QMPKVDGLLSTKMI
Sbjct: 1101 QEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMI 1160

Query: 1092 RRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
            RRDL YK  IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKL  IL E+C  +
Sbjct: 1161 RRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAY 1214

 Score =  500 bits (1287), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 252/357 (70%), Positives = 291/357 (81%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           IGIRAQLTALVSIVA +SL ILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQ LNYL
Sbjct: 17  IGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQTLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ Y+LASRD LQ++L SYVAGNK+E+NW +S +V+QK           RVYD  F  V
Sbjct: 77  YYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSSFTTV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD +PE + + LFPLSTD+PLPSSL T G+LTDP++N TDYLMSMSLPIFAN
Sbjct: 137 LNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D +VYGYIT+VMSAEGL+SVFNDTTALEKSNVAI+SA Y+   +   Y FVFPP
Sbjct: 197 PSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHFVFPP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG   SI  R F +++++F++  F+  KGGS+KKT  F TK++A+GY PCSF  VNWVAV
Sbjct: 257 YGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVNWVAV 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQ ESVFLSP+TKLTKII+GTV+ I VFV LLT PL  WAVKPIVRLQKATELI E
Sbjct: 317 VSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITE 373

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/767 (54%), Positives = 481/767 (62%), Gaps = 44/767 (5%)

Query: 415  EKNHRPAYDSASDSNYATDGSLSHDLQTSQAXXXXXXXXXXXXXXXXXXXXXNLNEARLP 474
            E+N  P  ++ +D+  + DGSL+HDL    +                     NL EARLP
Sbjct: 455  EENKIP--NNHTDAKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSA-NLTEARLP 511

Query: 475  DYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXTVFI 534
            DYRRLFSDELSDLT TFN MTDALDQHYALLE+RVRART                 TVFI
Sbjct: 512  DYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFI 571

Query: 535  ANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLK 594
            ANISHELRTPLNGILGMTAISMEETD+ KIRNSLKLIFRSG            FSKNVL+
Sbjct: 572  ANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQ 631

Query: 595  RTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMN 654
            RT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRIIQIVMN
Sbjct: 632  RTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMN 691

Query: 655  LVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIH---------TIADSDAHQQHP 705
            LVSNALKFTPVDG V+VR+KLLGEYD+E ++   +K+++          +  +D +    
Sbjct: 692  LVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPT 751

Query: 706  VSSSPNGV--------LVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXXXX 757
            +S+    V        L  +                 NE  Y + +D    +N       
Sbjct: 752  LSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASN-----DD 806

Query: 758  XXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDP 817
                         NA+FN+QF K P   ++    LG  + + KTWV +IEVEDTGPGIDP
Sbjct: 807  VSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDP 866

Query: 818  KLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPL 877
             L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKLESKVGVGSKFTFT+PL
Sbjct: 867  SLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPL 926

Query: 878  KQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHS------ 931
             QT+ I             NPES+KNRRVKF                   TN S      
Sbjct: 927  NQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDV 986

Query: 932  -------GDKQSSEGHSTSFKISEVKDE-DIEQSPEPDNLPKVGXXXXXXXXXXXXXXXX 983
                   G  ++ +  + +    E  D   +EQ  E +  P +                 
Sbjct: 987  LPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKH 1046

Query: 984  XXXXX--XXVHLDRPFLQSTGTATSSRNVPTMAD---VTMRFKILVAEDNHVNQEVIKRM 1038
                     V+LDRPFLQSTGTATSSRN+PT+ D        KILV EDNHVNQEVIKRM
Sbjct: 1047 RSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRM 1106

Query: 1039 LNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYK 1098
            LNLEGI NI+LACDGQ+AFDKV+ L  + ++Y+MIFMD+QMPKVDGLLSTKMIRRDL Y 
Sbjct: 1107 LNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYT 1166

Query: 1099 GSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
              IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL E+C  +
Sbjct: 1167 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAY 1213

 Score =  484 bits (1247), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 284/357 (79%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           IGIR QLTALVSIVA  SLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQ LNYL
Sbjct: 17  IGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ Y+LASRD LQ++L SYVAGNK+ +NW +S +VIQK           +VYD  F  V
Sbjct: 77  YYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSFNAV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD +PE + + LFPLSTD PLPSSL T G+LTDPVLN TDYLMSMSLPIFAN
Sbjct: 137 LNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D +VYGYIT++MSAEGL+SVFNDTTALE S +AI+SA Y++  K   Y FVFPP
Sbjct: 197 PSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFVFPP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG    +  + F + + +F++ AF+  KGGS+K+T    T++ A+GY PCSFN VNWVA+
Sbjct: 257 YGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNWVAI 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQ ESVFLSP+TKL KII+GTV+ I VFV LLT PLA WAV+PIVRLQKATELI E
Sbjct: 317 VSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/786 (54%), Positives = 478/786 (60%), Gaps = 48/786 (6%)

Query: 398  MKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHDLQTSQAXXXXXXXXXXXX 457
            MK  +N  N   +LS  E+  R   D  +++  + DGSL+HDL    A            
Sbjct: 439  MKSAMNIGN--EKLSPLEEEKRTPNDH-NNAKISMDGSLNHDLLAPNALRHSDNDRSSSR 495

Query: 458  XXXXXXXXXNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXX 517
                     NL EARLPDYRRLFSDELSDLT TFN MTDALDQHYALLEDRVRART    
Sbjct: 496  SHILTTSA-NLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLE 554

Query: 518  XXXXXXXXXXXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXX 577
                         TVFIANISHELRTPLNGILGMTAISMEETD+ KIRNSLKLIFRSG  
Sbjct: 555  AAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGEL 614

Query: 578  XXXXXXXXXXFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIR 637
                      FSKNVL+RT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSISL PN IR
Sbjct: 615  LLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIR 674

Query: 638  TMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT--- 694
            TMVLWGDSNRIIQIVMNLVSNALKFTPVDG V VR+KLLGEYD+E ++   FK++H    
Sbjct: 675  TMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKG 734

Query: 695  ---IADSDAHQQHPVSSSPN-----------GVLVKHXXXXXXXXXXXXXXXKYNEKTYD 740
               I D     +H    S N             +  +                 NE  Y 
Sbjct: 735  TEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYK 794

Query: 741  EDDDEHSITNIXXXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQK 800
            +  D    +N                    +A+FN+QF K     +D    LG  + + K
Sbjct: 795  KTRDREKSSN-----DDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDLGKPIENPK 849

Query: 801  TWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 860
            TW  +IEVEDTGPGIDP L ESVF PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMK
Sbjct: 850  TWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909

Query: 861  LESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXX 920
            LESKVGVGSKFTFT+PL QT+ I             NPES++NRRVKF            
Sbjct: 910  LESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSA 969

Query: 921  XXXVDRITNHSG----------DKQSSEGHSTSFKISEVK------DEDIEQSPEPD--N 962
                    N  G            +  EG      I E K      DE  +Q  E +  N
Sbjct: 970  SSIATPTANRCGLTNEMLRKSRSNEEEEGRKI-INIEEGKEGGNELDEAHQQLQEKNVKN 1028

Query: 963  LPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNVPTMADVTM---R 1019
                                        V+LDRPFLQSTGTATS+RN+PT+++       
Sbjct: 1029 SISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNSDKSDSS 1088

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
             KILV EDNHVNQEVIKRMLNLEGI NI+LACDGQDAFDKV+ L  + +SY+MIFMD+QM
Sbjct: 1089 IKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQM 1148

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            PKVDGLLSTKMIRRDL Y   IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKLK IL 
Sbjct: 1149 PKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILI 1208

Query: 1140 EYCPNW 1145
            E+C  +
Sbjct: 1209 EFCAAY 1214

 Score =  497 bits (1279), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 250/357 (70%), Positives = 291/357 (81%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IRAQLTALVSIVA +SL+ILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQ LNYL
Sbjct: 17  ISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ Y+LASRD LQN+L  YVAGNK+ +NW +S +++QK           +VYD  F  V
Sbjct: 77  YYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAKVYDSSFTTV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD +P+ I ++LFPLSTD+ LPSSL T G+LTDP+LN TDYLMSMSLPIFAN
Sbjct: 137 LNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLMSMSLPIFAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D +VYGYIT++MSAEGL+SVFNDTTALEKSNVAI+SA Y+N +K  +Y FVFPP
Sbjct: 197 PSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKAYAYHFVFPP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG S SI    F + +++F++ AFK  KGGS+KKT  F  K++A+GY PCSF  VNWVAV
Sbjct: 257 YGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCSFQLVNWVAV 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQ ESVFLSPSTKL KII+GTV+ I VFV LLT PLA WAV+PIVRLQKATELI E
Sbjct: 317 VSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITE 373

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/692 (56%), Positives = 456/692 (65%), Gaps = 62/692 (8%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            NL +AR+P Y R   DELS+LT+TFNAMT+ALDQHY LLEDRVRART             
Sbjct: 459  NLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAA 518

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                TVFIANISHELRTPLNGILGMTAISMEE D  KI+ +LKLIFRSG           
Sbjct: 519  NEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELL 578

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKNVLKRT LEKR+FCIT++ALQIKSIFGKVA+DQHV+L I L PN IR+MVLWGDSN
Sbjct: 579  TFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSN 638

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPV 706
            RIIQIVMNLVSNALKFTP+DGKV+VRIKLLGEYDEE +  D++K+++  + ++     P+
Sbjct: 639  RIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL----PI 694

Query: 707  SSSPNGVLVKHXXXXXXXX-----------XXXXXXXKYNEKTYDEDDDEHSITNIXXXX 755
             +     +V+                           K ++   DE+ +  S        
Sbjct: 695  GNGKKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNND 754

Query: 756  XXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGI 815
                           +A    QFKKTPDL +D  + LG EL++ KTWV ++EVEDTGPGI
Sbjct: 755  IEILSMTTSSTRSYDDAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGPGI 813

Query: 816  DPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTV 875
            +PKL E+VFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMHGTMKLES VGVGSKF FTV
Sbjct: 814  EPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTV 873

Query: 876  PLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQ 935
            PLKQTR I             N ESKKNRR+KFK               D   +H  + +
Sbjct: 874  PLKQTREIHFDDEKFEDEF--NAESKKNRRIKFK-------------IYDSSKSHDSNDE 918

Query: 936  SSEGHSTSFKISEVKDEDI-EQSPEPDNLPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLD 994
              EG  +S  I    +E   E    PDN  KV                          LD
Sbjct: 919  DEEGIKSSRDIDSSNNEHKDENGTSPDNHSKV-------------------------RLD 953

Query: 995  RPFLQSTGTATSSRNVPTM-----ADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDL 1049
            RPFLQSTGTATSS+ +PT+      ++    +ILVAEDNHVNQEVIKRMLNLE I+NIDL
Sbjct: 954  RPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDL 1013

Query: 1050 ACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFAD 1109
            ACDGQDAFDKV+SL +  + YD+IFMD+QMPKVDGL+STKMIR+DLNYK  IVALTAFA+
Sbjct: 1014 ACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFAN 1073

Query: 1110 DSNIKECIEAGMNGFLSKPIKRPKLKMILEEY 1141
            D NIKEC++AGM+GFL KPIKRPKLK IL+EY
Sbjct: 1074 DDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

 Score =  454 bits (1167), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/357 (63%), Positives = 277/357 (77%), Gaps = 1/357 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IRAQLTALVS+VA +SLIILAVTTGVYFT NYK LRS RL IAA+LKSSQ+DQ LNYL
Sbjct: 15  ITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQIDQTLNYL 74

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           +YQC +L SRDTLQNAL +Y AGNKT ENW ES NV+QK           R+YD +FK V
Sbjct: 75  FYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDLNFKQV 134

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           +N TNNGTGD +P  + ++LFPLST+  LPSSL  +G+LTDPVLNG+ YLMSMSLPI  N
Sbjct: 135 VNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSLPILTN 194

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII S  +VYGYIT+VMSA+GL++V+ + TALE SNV ++SA Y++  K+D + FVF  
Sbjct: 195 PSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFHFVFEV 254

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
                S L   + + + ++L+ A  + K GSIKKTK+ + +++AIGY PCSF+  NWVA+
Sbjct: 255 ENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLSNWVAL 313

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           V+Q E+VFLSPSTKL KIISGTVV IAVFV L+TFPL+ WAVKPIVRLQKATELI++
Sbjct: 314 VTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELISQ 370

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/703 (55%), Positives = 461/703 (65%), Gaps = 68/703 (9%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            NL +AR+P Y RLFSDELS+LT+TFN MTD LD+HYALLEDRVRART             
Sbjct: 476  NLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAA 535

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                TVFIANISHELRTPLNGILGMTAISM E D+ K++NSLKLIFRSG           
Sbjct: 536  NEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELL 595

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKNVL+RT LE+RNF I DVALQ+KSIFGK+AKDQHV LSI L+PNVIRTM+LWGDSN
Sbjct: 596  TFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSN 655

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT-----IADS--- 698
            RIIQIVMNLVSNALKF+PVDGKV VRIKLLGEYD + +K  N+  +       I D+   
Sbjct: 656  RIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASAS 715

Query: 699  ------------DAHQQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEH 746
                        DA Q+   S S +   +K                + +E   D D D+ 
Sbjct: 716  KSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDE-SEADTDTDTDKR 774

Query: 747  SITNIXXXXXXXXXXXXXXXXXXXNALFNTQFKKTPDL--YEDSNDGLGTELADQKTWVF 804
            S + I                   +A+ + Q +K P     EDS D LG +L   KTWV 
Sbjct: 775  SNSEI----SDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVI 830

Query: 805  AIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESK 864
            AIEVEDTGPGI+P LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKLESK
Sbjct: 831  AIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESK 890

Query: 865  VGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXV 924
            VGVGSKFTFTVPL QTR +             N  SKKNR+VKFK               
Sbjct: 891  VGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFK--------------- 935

Query: 925  DRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGXXXXXXXXXXXXXXXXX 984
              +  +SG  +S    +TS  ++   D   E+    ++   VG                 
Sbjct: 936  --MNKNSGGSKSRPSVNTS--LNSGTDSTAEKMALSESEVSVG----------------- 974

Query: 985  XXXXXXVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGI 1044
                  V +DRPFLQSTGTATS+R++ T+  +   FKILVAEDN+VNQEV+KRMLNLEG+
Sbjct: 975  -----SVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEVVKRMLNLEGL 1029

Query: 1045 NNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVAL 1104
            ++IDLACDGQ+AFDKV++L E ND Y +IFMD+QMP+VDGLLSTKMIR++L Y   IVAL
Sbjct: 1030 SDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVAL 1089

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIE 1147
            TAFADDSNIK C+++GMNGFLSKPIKRPKLK +L E+CP+++E
Sbjct: 1090 TAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVE 1132

 Score =  484 bits (1245), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 230/355 (64%), Positives = 283/355 (79%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           +GIR QL ALV +VA LSL+ILAVTTGVYFT+NYK+LR+DRL++AAQLKSSQ+DQNLNYL
Sbjct: 17  VGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQIDQNLNYL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYWL++RDTLQ++L  Y AGN T+ENW E+  V++K           R+YD  FK V
Sbjct: 77  YYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDSTFKTV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNG+G+ VPE +   LFPLSTD PL SSL T+G+LTDPVLN T Y+MSMSLPIFA+
Sbjct: 137 LNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSLPIFAS 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSI+ ++ ++ GYITVVMSAE L+ VFNDTTAL+KS+VAI+SA YSN +   SY FVFPP
Sbjct: 197 PSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYHFVFPP 256

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           +GV   I++ +F +++ SF+  AF   K GS+K+T FFY KDVA+GY PC F  V WVAV
Sbjct: 257 HGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQVQWVAV 316

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374
           +SQ E+VFLSPST+LT II GT +GIAVF+ L+TFPLA WAVKPIVRLQKATE+I
Sbjct: 317 ISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEII 371

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/723 (54%), Positives = 458/723 (63%), Gaps = 62/723 (8%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            NL +AR+P YR LF DELSDLT TFN MTDALDQHYALLE+RVRART             
Sbjct: 480  NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                TVFIANISHELRTPLNGILGMTAISMEETDI KIRNSLKLIFRSG           
Sbjct: 540  NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELL 599

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKNVLKRT LEKRNFCITDVALQIKSIFGKVAKDQHVRLSI L+PN+IR+MVL+GDSN
Sbjct: 600  TFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHP- 705
            RIIQIVMNLVSNALKFTPVDGKV+VR+K+LG YDE  ++  N  +++    ++     P 
Sbjct: 660  RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719

Query: 706  --VSSSPNG-------VLVKHXXXXXXXXXXXXXXXKYNEKTYDED----DDEHSITNIX 752
              V S   G          K+               +  +++ DED    D+E  I++  
Sbjct: 720  LNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQES-DEDNMYEDNESMISS-- 776

Query: 753  XXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLY-EDSNDGLGTELADQKTWVFAIEVEDT 811
                              +A+FN+QFKKT +LY ED    +G EL   KTWV + EVED+
Sbjct: 777  ------------TTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDS 824

Query: 812  GPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKF 871
            GPGID  L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M LESKVGVGSKF
Sbjct: 825  GPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKF 884

Query: 872  TFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDR-ITNH 930
            TFT+PL QTR I             N +SKKNR+VKF+              V    ++H
Sbjct: 885  TFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSH 944

Query: 931  SGDKQSSEGHSTSFKISE-VKDEDIEQSPE--PDNL---PKVGXXXXXXXXXXXXXXXXX 984
                  +   S   K    V D  +  SPE   +N+    +                   
Sbjct: 945  HSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERL 1004

Query: 985  XXXXXXVHLDRPFLQSTGTATSSRNVPTM------------------ADVTMR------- 1019
                  + LDRPFLQSTGTATS+R++P +                  A+ T +       
Sbjct: 1005 SASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGA 1064

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            +KILVAEDNHVNQEVIKRML LEG+ +IDLACDGQDAFDKV+ L ++   Y++IFMD+QM
Sbjct: 1065 YKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQM 1124

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            PKVDGL STKMIR DL+    IVALTAFADDSNIKEC++AGM+GFLSKPIKR KLK IL+
Sbjct: 1125 PKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILK 1184

Query: 1140 EYC 1142
            E+C
Sbjct: 1185 EFC 1187

 Score =  532 bits (1370), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 251/357 (70%), Positives = 297/357 (83%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           +GIRAQLT LVSIVA +SL+ILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ+DQNLNYL
Sbjct: 16  VGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQNLNYL 75

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYW+ASRDTLQ  LA+YVAGNK++ NW +S +V++K           RVYD  F  V
Sbjct: 76  YYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSSFTTV 135

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LNTTNN TGD +PE +  QL PLST+VPLPSSL TNG++T+PV NG+ YLMSMSLPIFAN
Sbjct: 136 LNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLPIFAN 195

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +D +VYGY+TVVMSAEGL SVFNDTTALE+S VAIVSA Y+N TK+D+YRFVFPP
Sbjct: 196 PSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRFVFPP 255

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           +G + SILN TF L++++FL+ A +Q KGG++K T+ FY   +A+GY P + N  NWVA+
Sbjct: 256 FGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLANWVAI 315

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           V+QAESVF+SP+TKL KII+GTVVGI VF  L+TFPLA WAVKPIVRLQKATELI E
Sbjct: 316 VAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELITE 372

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/699 (52%), Positives = 446/699 (63%), Gaps = 68/699 (9%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            NL EAR+P Y+RLFSDELS+LT TFN MTD LD+HYALLEDRVRART             
Sbjct: 483  NLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                TVFIANISHELRTPLNGILGMTAI+M E D AK+++SLKLIFRSG           
Sbjct: 543  NEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELL 602

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKNVLKRT LE+R+F I D+ALQ++SIFGK+AKDQHV L+IS+ PN++R+MVLWGDSN
Sbjct: 603  TFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSN 662

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTI----------- 695
            RI+QIVMNLVSNALKFTPVDGKV+V+ +LLGEYDEE +KA  +K++  +           
Sbjct: 663  RIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTE 722

Query: 696  ADSDAHQQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNE-------KTYDEDDDEHSI 748
            A  + + +  V S  N + +                   +E       ++ DEDD+    
Sbjct: 723  AKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDT 782

Query: 749  TNIXXXXXXXXXXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEV 808
             +I                   +A+F T+ +K     E+     G  L   K WV ++EV
Sbjct: 783  KSI----------GSGNTSSYDDAIFQTRLRKDSSNEENEE---GRALESPKKWVISMEV 829

Query: 809  EDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVG 868
             DTGPGIDP LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKL+S+VGVG
Sbjct: 830  HDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVG 889

Query: 869  SKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRIT 928
            SKF+FTVPL QT+ +             NP+SKKNR+VKF+                   
Sbjct: 890  SKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFR-MGKSNKRSKSRSESSGTE 948

Query: 929  NHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGXXXXXXXXXXXXXXXXXXXXX 988
             + G+    EG   +             SP   +   VG                     
Sbjct: 949  GNGGNSPGVEGSGGN-------------SPGTGSEVSVG--------------------- 974

Query: 989  XXVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNID 1048
              V +DRPFLQSTGTA S+  V T + +  R KILVAEDN+VNQEVIKRMLNLEG+ +++
Sbjct: 975  -SVRVDRPFLQSTGTALSTTLV-TTSSLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVE 1032

Query: 1049 LACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFA 1108
            LACDGQDAFDKV++       YD+IFMD+QMP+VDGL +T+MIR++L Y   IVALTAFA
Sbjct: 1033 LACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFA 1092

Query: 1109 DDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIE 1147
            DDSNIKEC++AGMNGFLSKPIKRPK+K IL+EYCP  I+
Sbjct: 1093 DDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPID 1131

 Score =  466 bits (1198), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 216/355 (60%), Positives = 275/355 (77%), Gaps = 1/355 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           + IR QLTALV +VA LSLIILAV TGVYFTS++K+LR++RL++AAQLKSSQ+DQNLNYL
Sbjct: 23  VSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQIDQNLNYL 82

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYWL++RD LQNAL  Y+AGN + ENW +++  + K           RVYD  F+ V
Sbjct: 83  YYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSFQDV 142

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN +NNG+G+ +PE++  QLFPLSTDV LPSSL   GMLTDPVLNG+ YLMSMSLPIFAN
Sbjct: 143 LNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPIFAN 202

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII S  KVYGYITVV+SAEGL+SV+NDTTAL+ S+V IVS  Y ++ ++  Y  VFPP
Sbjct: 203 PSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-ELAGYHLVFPP 261

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           Y + P ++N  +++++ SFL  A K  KGGSIK T+FF  K +A+GY PC+     WVA+
Sbjct: 262 YNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQWVAI 321

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374
           ++Q E++FLSPST+L KII GT + IAV   ++TFPL+ WAV+PIVRLQKATE+I
Sbjct: 322 ITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEII 376

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/698 (52%), Positives = 452/698 (64%), Gaps = 63/698 (9%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            NL EA +P YRR F DELS+LT+TFN MTD LD+HYALLE+RVRART             
Sbjct: 490  NLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESA 549

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                TVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIFRSG           
Sbjct: 550  NEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELL 609

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKNVLKRT LE+R+F + D+ALQIKSIFGK+AKDQHV+LSI+LTPN IRT+VLWGDSN
Sbjct: 610  TFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSN 669

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAH----- 701
            RIIQIVMNLVSNALKFTPVDGKV+VRIKLLGEYD + +++ +++++  +  S+A+     
Sbjct: 670  RIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEF 729

Query: 702  -------QQHPVSSSPNGV--LVKHXXXXXXXXXXXXXXXKYNE-KTYDEDDDEHSIT-- 749
                    + P +SS   V    K                  +E  T   D+DE SI   
Sbjct: 730  NLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLE 789

Query: 750  ----NIXXXXXXXXXXXXXXXXXXXNALFNTQFKKT-PDLYEDSNDGLGTELADQKTWVF 804
                                     +A+F++QFKK       D+ +    +L   KTWV 
Sbjct: 790  SKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVI 849

Query: 805  AIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESK 864
            ++EVEDTG GIDP L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL+SK
Sbjct: 850  SMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSK 909

Query: 865  VGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXV 924
            VGVGSKF FTVPL+QT+ I             N  S+KNR+VKFK               
Sbjct: 910  VGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFK-----------INSS 958

Query: 925  DRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGXXXXXXXXXXXXXXXXX 984
             +       K S +GHS +  +SE K  +  ++        VG                 
Sbjct: 959  RKSVQTKKSKSSIDGHSDN-NVSERKASNSTEN-------SVG----------------- 993

Query: 985  XXXXXXVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGI 1044
                  V +DRPFLQSTGTATS+R++ ++A    R ++LVAEDN+VNQEVIKRML LEG+
Sbjct: 994  -----NVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGL 1048

Query: 1045 NNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVAL 1104
             ++D+ACDGQ+A++KV+ +++  +SY MIFMD+QMP+VDGLL+TKMIR DL YKG IVAL
Sbjct: 1049 TDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVAL 1108

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYC 1142
            TA+ADDSNIK C+E+GM+GFL KPIKRP LK I+ +YC
Sbjct: 1109 TAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYC 1146

 Score =  409 bits (1051), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 261/355 (73%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           +G+R QL  LV  +  LSL I+ VTTGVYFT+NYK++R++RL +AAQLKSSQ+DQNLNYL
Sbjct: 24  VGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQNLNYL 83

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ YWL++RDTLQ+AL ++ AGN + +NW  + + ++K           RVYD  F  V
Sbjct: 84  YYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTSFNTV 143

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           +N+TNNG+GD +PE++  +LFPLS   PL SSL+T G++TDPV N T+YL+SMSLP+  N
Sbjct: 144 INSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLPVSTN 203

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII +  ++ GYITV+ SAE L++V NDT AL+KS+V+I+SA + + + +  Y FVFPP
Sbjct: 204 PSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHFVFPP 263

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           +G S      TF + + +F+  AF+  K GS+ KT     +++A+GY P +F  VNWVAV
Sbjct: 264 HGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVNWVAV 323

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374
           V+Q E VFLSP+ +L KII+GTV  IAVF+ LLTFP+A WAV+PIVRLQKATE+I
Sbjct: 324 VTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEII 378

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/686 (52%), Positives = 443/686 (64%), Gaps = 73/686 (10%)

Query: 467  NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
            N  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLEDRVRART             
Sbjct: 480  NWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESA 539

Query: 527  XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
                T+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG           
Sbjct: 540  NEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELL 599

Query: 587  XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
             FSKN+LKR  LE+RNF + DVALQ+KSIFGK+AKDQ+V+ SI L PN+IR MVLWGDSN
Sbjct: 600  TFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSN 659

Query: 647  RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADN-----FKQIHTIADSDAH 701
            RIIQIVMNLVSNALKFTPVDGKV++RIKLLGEYDEE ++  N      KQ   I+D   +
Sbjct: 660  RIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKN 719

Query: 702  QQHPVSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXXXXXXXX 761
                ++        K+               +   +  D+ D+   +++           
Sbjct: 720  VFDTITEE------KYVSCSGESTDDTIETGQEGAQKPDKADNISVVSS----------- 762

Query: 762  XXXXXXXXXNALFNTQFKKTP---DLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPK 818
                     +A+F+++FKK P   D+ E     +G     +K WV +IEVEDTGPGIDP 
Sbjct: 763  ---GTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKKVWVISIEVEDTGPGIDPS 818

Query: 819  LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLK 878
            L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+TMM GTMKL S+VGVGSKF FTVPL+
Sbjct: 819  LQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLR 878

Query: 879  QTRVIKXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQSSE 938
            QT  ++            N +SK NRRVKFK                   N  G  + S 
Sbjct: 879  QTGTVEDLDDEDLFEDEFNAQSKINRRVKFK------------------LNKGGKSRQS- 919

Query: 939  GHSTSFKISEVKDEDIEQSPEPDN-LPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLDRPF 997
                S  + E+       S  PD+ L  +G                       V +DRPF
Sbjct: 920  ----SLSVPEI-------SGVPDSPLNSMG-------------RSESELSVSSVRVDRPF 955

Query: 998  LQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAF 1057
            LQSTGTATS+R++PT+  +   FK+LVAEDN+VNQEVIKRML LEGI +I+LACDG++A 
Sbjct: 956  LQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEAL 1015

Query: 1058 DKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECI 1117
            +KV +L  Q D Y+++FMD+QMPK+DGL++T+ IR++LNY   IVALTAFADDSNIK C+
Sbjct: 1016 EKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCL 1075

Query: 1118 EAGMNGFLSKPIKRPKLKMILEEYCP 1143
            E+GM+GFLSKPIKR KL+ IL EYCP
Sbjct: 1076 ESGMDGFLSKPIKREKLRKILLEYCP 1101

 Score =  343 bits (880), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/356 (51%), Positives = 246/356 (69%), Gaps = 1/356 (0%)

Query: 21  GIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYLY 80
           G+  QLT LV I+A  SLIILAVTTGVYFT+NYK+LR+DRL +AAQL S+Q++Q LN +Y
Sbjct: 30  GLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQINQTLNIIY 89

Query: 81  YQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPVL 140
           YQCYWL+SRD++QNAL SY  GN +  N + +  V+ K            +YD  F  VL
Sbjct: 90  YQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYDSAFNEVL 149

Query: 141 NTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFANP 200
           + + N TG+ + + +   L PLS++ PLPSS++ +GML++PV NG+ + MSMSLP+ A  
Sbjct: 150 SVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSMSLPVSAKA 209

Query: 201 SIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPPY 260
           SI++      GYIT+VMSA+ + SV     AL  S V++++  Y     ++SY+ +FPP 
Sbjct: 210 SILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSYQVLFPPS 269

Query: 261 GVS-PSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
            V  P +L   F + ++SFL  AF     GS+ KT  FY  +VA+GY  CSF  VNWVAV
Sbjct: 270 IVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFKLVNWVAV 329

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIA 375
           V+Q E+VFLSPSTKLTKII GTV+GIA F+ ++TF +A+WAVKPIVRLQKATELIA
Sbjct: 330 VAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATELIA 385

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/743 (49%), Positives = 444/743 (59%), Gaps = 85/743 (11%)

Query: 470  EARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXX 529
            E ++P YRRLF DELS+LT+TFN M+DALDQHYALLE+RVRART                
Sbjct: 476  ETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEAANEA 535

Query: 530  XTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFS 589
             TVFIANISHELRTPLNGILGMTAISMEE DI  I++SLKLIFRSG            FS
Sbjct: 536  KTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTELLTFS 595

Query: 590  KNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRII 649
            KNVL+RT LE+R+FCITDVALQIKSIFGKVAKDQHV+LSI L PN IRT+VLWGDSNRII
Sbjct: 596  KNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRII 655

Query: 650  QIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSS 709
            QIVMNLVSNALKFTP+DGKV+VR+ LLGEYD+E +KA ++K++     ++  + +   S 
Sbjct: 656  QIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENY---SK 712

Query: 710  PNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDD---DEHSITNIX-------XXXXXXX 759
                L                  ++NE   +++D   + H  +N                
Sbjct: 713  ILQKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDTL 772

Query: 760  XXXXXXXXXXXNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKL 819
                         +FN QFKK   L +   + LG E+ + KTWV  IEVEDTGPGI P L
Sbjct: 773  SLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPAL 832

Query: 820  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQ 879
             ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM LESKVG GSKFTFTVPL Q
Sbjct: 833  QESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQ 892

Query: 880  TRVI---KXXXXXXXXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQS 936
            TR I   +            N  SKKNR+VKF                  + N S   + 
Sbjct: 893  TREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTT---------LANSSLKSRK 943

Query: 937  SEGHSTSFKISEVK--DEDIEQSPEPDNLPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLD 994
            S+G   S  + E++  +E  E +    ++   G                         LD
Sbjct: 944  SKGSLNSSFVGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPS------LD 997

Query: 995  RPFLQSTGTATSSRNVPTMADVT------------------------------------- 1017
            RPFLQSTGTATS+  +P + D +                                     
Sbjct: 998  RPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNS 1057

Query: 1018 ----------MRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLV--- 1064
                         +ILV EDNHVNQEVIKRML LE ++NIDLACDG++A+ KV+ +    
Sbjct: 1058 SIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSIS 1117

Query: 1065 --EQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMN 1122
              ++ + YD+IFMD+QMP++DGL STK+IR +L Y   IVALTAFAD+SNIKEC++ GM+
Sbjct: 1118 NPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMD 1177

Query: 1123 GFLSKPIKRPKLKMILEEYCPNW 1145
            GFLSKPIKRPKLK IL E+CP +
Sbjct: 1178 GFLSKPIKRPKLKDILNEFCPGY 1200

 Score =  487 bits (1253), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/358 (65%), Positives = 279/358 (77%), Gaps = 1/358 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           IGIR QLTALV  VAC+SLIILAV TG+YFT NYK++R DRL IAA+LKSSQ+DQ LN+L
Sbjct: 17  IGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQTLNFL 76

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCYWL+ RDTLQ A+A+Y AGNK+   W +S  V++K           R+YD +F  V
Sbjct: 77  YYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDANFNLV 136

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           +N TNNGTG+ VP  +  +L PLS+  PLP+SL ++GMLTDPVLN T YLMSMSLPI AN
Sbjct: 137 MNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSMSLPILAN 196

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYT-KIDSYRFVFP 258
           PSII +D KVYGYIT++MSAE L SV+NDTTALEKSNVAIVS  YS+Y+  +  Y FVFP
Sbjct: 197 PSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEYHFVFP 256

Query: 259 PYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVA 318
           PYG +P I++  + L + SFL  A    K GSI KTKFFY  DVAIGY PCSF+ V+WVA
Sbjct: 257 PYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDLVSWVA 316

Query: 319 VVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           +VSQ ESVFLSPSTKLT+II+GTVV IAVFV  +TFPL+ WAVKPIVRLQKATELIAE
Sbjct: 317 IVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATELIAE 374

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  536 bits (1381), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 253/357 (70%), Positives = 301/357 (84%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           IGIRAQLTALVSIVAC+SL+ILA+TTGVYFT+NYKNLRSDRLYIAAQLKSSQ+DQ LNYL
Sbjct: 15  IGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQTLNYL 74

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCY+++SRDTLQ AL +YVAGNK+ ENW +S +++QK           +VYD  F  V
Sbjct: 75  YYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDASFTTV 134

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN TNNGTGD++P+SI  +L PLST++PL SSL T G+LTDPVLN + YLMSMSLPIFAN
Sbjct: 135 LNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSLPIFAN 194

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PS+I ++ +VYGY+TVVMSAEGLR+VFNDTTALEKSNVAIVSA Y+N + + +YRFVF P
Sbjct: 195 PSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYRFVFAP 254

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
            G    I+N T+ L + SFL+ A ++ KGGS+K TKFFY+K+VAIGY PC+F+FVNWVAV
Sbjct: 255 MGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFVNWVAV 314

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQAESVFLSPSTKL KII+GTVV I VFV ++TFPLA WAVKPIVRLQKATELI+E
Sbjct: 315 VSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELISE 371

 Score =  527 bits (1357), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 281/466 (60%), Positives = 317/466 (68%), Gaps = 23/466 (4%)

Query: 467 NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
           NL EAR+PDYRRLFSDELSDLT+TFN MTDALDQHYALLEDRVRART             
Sbjct: 525 NLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERA 584

Query: 527 XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
               TVFIANISHELRTPLNGILGMTAISMEETDI+KIR+SLKLIFRSG           
Sbjct: 585 NEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELL 644

Query: 587 XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
            FSKNVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ V+LSI+LTPN IRTMVL+GDSN
Sbjct: 645 TFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSN 704

Query: 647 RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSD-AHQQHP 705
           RIIQIVMNLVSNALKFTPVDGKVNV++KL+GEYDE  +  +NFK+++    ++     +P
Sbjct: 705 RIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNP 764

Query: 706 VSS------SPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSIT---------- 749
           +        SP                        +EK+ D+ DDE   T          
Sbjct: 765 IEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIATKDAENENTDD 824

Query: 750 --NIXXXXXXXX---XXXXXXXXXXXNALFNTQFKKTPDLY-EDSNDGLGTELADQKTWV 803
             N+                      +A+FN+QFKK+P LY +D N+  G  + D KTWV
Sbjct: 825 TENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWV 884

Query: 804 FAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLES 863
             I VEDTGPGID  L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKL+S
Sbjct: 885 IQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKS 944

Query: 864 KVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXXNPESKKNRRVKFK 909
           +VGVGS FTFTVPLKQTR I             NPES+KNR+VKFK
Sbjct: 945 EVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFK 990

 Score =  271 bits (693), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/161 (77%), Positives = 141/161 (87%), Gaps = 6/161 (3%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTMA------DVTMRFKILVAEDNHVNQEVIKRMLNLEGI 1044
            V LDRPFLQSTGTATSSRNVP ++      D     KILVAEDNHVNQEVIKRMLNLEG+
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1045 NNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVAL 1104
            N IDLACDGQ+AFDKV++L EQNDSY++IFMD+QMPKVDGLLSTKMIR+DL+Y   IVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
            TAFADDSNIKEC+E+GMNGFLSKPIKRPKL+ I++EYCP W
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score =  497 bits (1280), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 234/357 (65%), Positives = 289/357 (80%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IR QL A+VS+VA LSL+ILAVTTGVYFTS+YKNLR++RLYIAAQLKSSQ+DQ L YL
Sbjct: 29  ISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQTLTYL 88

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ YW+++RDTLQ++LA++VAGNK+  NWE + +V++K           +VYD +F  V
Sbjct: 89  YYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDENFDTV 148

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           L+ TNNGTG+++   +  +LFPLST++PL SSL T G+LTDPVLNGT YLMSMSLP+FAN
Sbjct: 149 LSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLPVFAN 208

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII S  +VYGYIT++M+A+GL SVFNDTTA+EKSNVAIVSA Y+N +++D+Y    PP
Sbjct: 209 PSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHLALPP 268

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG + S+ +  F+L +SSFLNGA KQ KGGSIKKT F Y K VA+GY PCSF   NWV+V
Sbjct: 269 YGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELANWVSV 328

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           VSQAESVF  PSTKLTKII+G VVGI+VFV L+T PLA +AVKPIVRL+KATE+I E
Sbjct: 329 VSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIITE 385

 Score =  443 bits (1140), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 258/373 (69%), Gaps = 23/373 (6%)

Query: 771  NALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQG 830
            +A+FN+QFKKTPDLYED +  LG EL+ QKTWVF IEV DTGPGID  L ESVFEPFVQG
Sbjct: 817  DAIFNSQFKKTPDLYEDEDGNLGEELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQG 876

Query: 831  DQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXX 890
            DQTLSRQYGGTGLGLSICRQLATMM+GTM LES VG GSKF FTVPL QTRVIK      
Sbjct: 877  DQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEH 936

Query: 891  XXXXXXNPESKKNRRVKFKDXXXXXXXXXXXXXVDRITNHSGDKQSSEGHSTSFKISEVK 950
                  NP+SK NR+VKF               +   ++     +      T    S+V 
Sbjct: 937  PYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETRSNHSDVS 996

Query: 951  DEDIEQSPEPDNLPKVGXXXXXXXXXXXXXXXXXXXXXXXVHLDRPFLQSTGTATSSRNV 1010
              +  +S  P   P+ G                       ++LDRPFLQSTGTA SS NV
Sbjct: 997  TSNKNESASPQ--PESGSN---------------------LNLDRPFLQSTGTAISSANV 1033

Query: 1011 PTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSY 1070
            PT+A +     +LVAEDNHVNQEVIKRML+LEG+ NIDLACDGQDAFD V+SL E+ + Y
Sbjct: 1034 PTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFY 1093

Query: 1071 DMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIK 1130
            DMIFMD+QMPKVDGL +TKMIR DL Y+  IVALTAFADDSNIKEC++AGM+GFLSKPIK
Sbjct: 1094 DMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIK 1153

Query: 1131 RPKLKMILEEYCP 1143
            RP+LK IL EYCP
Sbjct: 1154 RPQLKTILLEYCP 1166

 Score =  337 bits (865), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 165/227 (72%), Positives = 183/227 (80%)

Query: 467 NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
           NL EAR+P  R+LF DELSDLT TFN MTDALD+HY LLEDRVRART             
Sbjct: 500 NLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAA 559

Query: 527 XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
               TVFIANISHELRTPLNGILGMTAISMEE DI KIR+SLKLIFRSG           
Sbjct: 560 NEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELL 619

Query: 587 XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
            FSKNVL+RT LEKRNFCITDVALQ+KSIFGKVAKDQHVRLSI L+PN++RTMVL+GDSN
Sbjct: 620 TFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSN 679

Query: 647 RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIH 693
           RIIQ+VMNLVSNALKFTPVDGKV V+IKLLGEYDEE++K   F++++
Sbjct: 680 RIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVY 726

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  431 bits (1108), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 221/355 (62%), Positives = 271/355 (76%), Gaps = 1/355 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IR QLTALV +VA LSLIILAV TGVYFTS++K++R++RLY+A+QLK+SQ+DQNL YL
Sbjct: 23  ISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQNLYYL 82

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCY+L++RD LQNAL  Y+AGN T ENW ++   + K           RVYD  F+ V
Sbjct: 83  YYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSSFQDV 142

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           LN +NN +G+ VPES+  QLFPLST+V LPSSL   GMLTDPVLN T YLMSMSLPIFAN
Sbjct: 143 LNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLPIFAN 202

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPP 259
           PSII S  KVYGYITVV+SAEGL++VFNDTTALE S+V +VS  Y N  ++  Y  VFPP
Sbjct: 203 PSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR-ELAGYHLVFPP 261

Query: 260 YGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAV 319
           YG+   I+++ + + + SFL  AFKQ+KGGSIK T F Y+K VAIGY PCS + V WVA+
Sbjct: 262 YGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQWVAI 321

Query: 320 VSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELI 374
           ++Q ES FL PST+L +II GT V IAV    +TFPL+ WAV+PIVRLQKATE+I
Sbjct: 322 ITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEII 376

 Score =  308 bits (788), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 174/222 (78%), Gaps = 2/222 (0%)

Query: 467 NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
           NL EAR+P Y RLFSDELS+LT TFN MTD LD+HYALLEDRVRART             
Sbjct: 483 NLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542

Query: 527 XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
               TVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG           
Sbjct: 543 NEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELL 602

Query: 587 XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
            FSKNVLKRT LE+R+F + ++ALQ++SIFGK+AKDQHV L+IS+ PNV+RTMVLWGDSN
Sbjct: 603 TFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSN 662

Query: 647 RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADN 688
           RI+QIVMNLVSNALKFTPVDG+VNV+  LLGEYDE  +KA N
Sbjct: 663 RIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDE--SKASN 702

 Score =  232 bits (592), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 106/157 (67%), Positives = 133/157 (84%), Gaps = 1/157 (0%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050
            V +DRPFLQSTGTA S+R+V T + V  + K+LVAEDN+VNQEVIKRMLNLEG++++DLA
Sbjct: 1009 VRVDRPFLQSTGTALSTRSVTTTS-VANKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLA 1067

Query: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADD 1110
            CDGQDAFDKV++  E    YD+IFMD+QMP+VDGL +T+MIR +L+Y   IVALTA+ADD
Sbjct: 1068 CDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYADD 1127

Query: 1111 SNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIE 1147
             NIKECI+AGMNGFL+KPI+RPK+K IL EYCP + +
Sbjct: 1128 RNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFK 1164

 Score =  166 bits (419), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 100/142 (70%), Gaps = 10/142 (7%)

Query: 771 NALFNTQFKKTPDLYEDSNDGL---GTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPF 827
           +A+F+++ +K        N G    G  L   +    A+EV+DTGPGI+P L ESVFEPF
Sbjct: 839 DAIFHSRLRK-------GNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPF 891

Query: 828 VQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXX 887
           VQGDQTLSRQYGGTGLGLSICRQLA MM+G+M L+SKVGVGSKFTFTVPL QT+ +    
Sbjct: 892 VQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEE 951

Query: 888 XXXXXXXXXNPESKKNRRVKFK 909
                    NP+SKKNR+VKFK
Sbjct: 952 DENPFEDEFNPDSKKNRKVKFK 973

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  412 bits (1060), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/447 (49%), Positives = 274/447 (61%), Gaps = 38/447 (8%)

Query: 472 RLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXXXXXT 531
           R+P +    +DEL++L  TFN M D+LD+H  LLE+RV+ART                 T
Sbjct: 469 RVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKT 528

Query: 532 VFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXXFSKN 591
           VFIANISHELRTPLNGILGMTAI++EE D  K++ SLKLI+RSG            FSKN
Sbjct: 529 VFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKN 588

Query: 592 VLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQI 651
           VL++T LEK +FCI D+ALQIKSIFGK+AKDQ V  SI ++PN+IRTMV +GDSNRIIQ+
Sbjct: 589 VLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQV 648

Query: 652 VMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT------IADSDAHQQHP 705
           +MNLVSNALKFTP+DG V+VRIKLLGEYDEE +  +N+ +++         D+DA    P
Sbjct: 649 IMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEP 708

Query: 706 VSSSPNGVLVKHXXXXXXXXXXXXXXXKYNEKTYDEDDDEHSITNIXXXXXXXXXXXXXX 765
           +S   +                     K   K+ D    ++S  NI              
Sbjct: 709 ISDKISFAGGSSSIHDYCSKTDENDNIKTEIKSDDSTISDYSEENIMGS----------- 757

Query: 766 XXXXXNALFNTQFKKTPDLYEDSNDG---LGTELADQKTWVFAIEVEDTGPGIDPKLHES 822
                              YE+ N G   LG  +   K WV +++VEDTGPGI P L +S
Sbjct: 758 ------------------YYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQKS 799

Query: 823 VFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRV 882
           VFEPFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKFTFTVPL Q R 
Sbjct: 800 VFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERK 859

Query: 883 IKXXXXXXXXXXXXNPESKKNRRVKFK 909
           I             N  SKKNR+V FK
Sbjct: 860 IIFSETEKAFEDEFNFNSKKNRKVNFK 886

 Score =  387 bits (994), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 195/357 (54%), Positives = 256/357 (71%), Gaps = 1/357 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           + +RAQL  L  IV+ +SL+IL+++TGVYFT+NYK+LR+++L+IAAQLKSSQLDQ+LNYL
Sbjct: 16  MNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQSLNYL 75

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQ  W    D L +AL  Y +GNKT ENW ES + +              +YD +F  +
Sbjct: 76  YYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTNFMEI 135

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
            N +NNGTG  +P+ I  QL PLS+D  LP+S+ T G LTDPVLN ++YLMS+SLPIF N
Sbjct: 136 YNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLPIFGN 195

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTK-IDSYRFVFP 258
           PSII SD +VYGY+T++  A  + +VFNDTTALE SNVAI+SA+Y N T   D Y FVFP
Sbjct: 196 PSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYHFVFP 255

Query: 259 PYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVA 318
           PYG   S+++  + L ++SFL  AF +   GS+  T FFY+  VA+GY  C+F+  NWVA
Sbjct: 256 PYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLANWVA 315

Query: 319 VVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIA 375
           VVSQ ESVF S + KLTKIISGTVVGIA  V  +TF ++ + VKPI++L++ATELI+
Sbjct: 316 VVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELIS 372

 Score =  157 bits (396), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 94/122 (77%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            FK+L+ EDN VNQEVIKR+L LE I  I+ A DGQ+A D V+  + + D +D+IFMDIQM
Sbjct: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P VDG  +T++IR +LNY   IVALTAFADDSN KEC  +GMN FL+KPIKR +LK I++
Sbjct: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059

Query: 1140 EY 1141
            E+
Sbjct: 1060 EF 1061

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  408 bits (1049), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 269/358 (75%), Gaps = 1/358 (0%)

Query: 20  IGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYL 79
           I IRAQLTALVS+VA +SLIILAVT GVYFT+NYKNL++ RLYIAAQLK+SQ+DQ LNYL
Sbjct: 15  ISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQTLNYL 74

Query: 80  YYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPV 139
           YYQCY+L+S +TLQN+L SY AGN +  NW ES+ V++K           R+YD +F  +
Sbjct: 75  YYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDTNFNIM 134

Query: 140 LNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFAN 199
           +N TNN +G+ VPES+ ++LF LS ++ LPSSL T G+ TDPVLNG+++LMSMSLPIFAN
Sbjct: 135 INATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSLPIFAN 194

Query: 200 PSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFP- 258
           PSII SD ++YGY++V+MSAEGL+SVFNDTTALE S V ++SA YS  T ++ + F+F  
Sbjct: 195 PSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFNFLFAS 254

Query: 259 PYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVA 318
            Y  +    +  + +D+ +F+       KGG++KKT  F     A+GY  CSF+ VNW+A
Sbjct: 255 AYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSLVNWLA 314

Query: 319 VVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           +V+Q E+ F   +TKL +IISG VV +AVFV LLTFPL+ WAV+P++RLQKATE IAE
Sbjct: 315 IVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATERIAE 372

 Score =  324 bits (831), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 158/227 (69%), Positives = 181/227 (79%)

Query: 467 NLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXX 526
           NL EAR+P Y RL  DELS+LT+TFN MTDALDQHY LLE+RVRART             
Sbjct: 471 NLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESA 530

Query: 527 XXXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXX 586
               TVFIANISHELRTPLNGILGMTAISMEE D+ KIR +LKLIFRSG           
Sbjct: 531 NEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELL 590

Query: 587 XFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSN 646
            FSKNVL+RT LEKR+FCIT+VALQIKSIFGK+AKDQHV+LSI L PN++R+ VLWGDSN
Sbjct: 591 TFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSN 650

Query: 647 RIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIH 693
           RIIQ+VMNLVSNALKFTPVDG V+VRI LLGEYDEE +KA+++K+++
Sbjct: 651 RIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVY 697

 Score =  214 bits (544), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 129/167 (77%), Gaps = 12/167 (7%)

Query: 991  VHLDRPFLQSTGTATSSRNVPTM---ADVTMRFK---------ILVAEDNHVNQEVIKRM 1038
            V L+RPFLQSTGTATS++NVPT+    D   + K         ILVAEDNHVNQEVIKRM
Sbjct: 960  VRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRM 1019

Query: 1039 LNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYK 1098
            L LEGINNIDLA DGQDAFDK + L E N +YD+IFMD+QMP++DGL +TKMIR +LNY 
Sbjct: 1020 LKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYT 1079

Query: 1099 GSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145
              IVAL+AF  + N+KEC++ GMN FLSKPIKRP LK+IL++Y  ++
Sbjct: 1080 QPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDF 1126

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/133 (67%), Positives = 103/133 (77%), Gaps = 2/133 (1%)

Query: 777 QFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSR 836
           Q  K+ DL +D N  LG EL +QKTWV ++EV+DTG GIDPKL ESVFEPFVQGDQ LSR
Sbjct: 783 QLIKSTDLDDDENK-LGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSR 841

Query: 837 QYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKXXXXXXXXXXXX 896
           QYGGTGLGLSIC+QL+TMM+GTM+LES+VGVGSKF FT+PLKQTR I             
Sbjct: 842 QYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREI-SIPDDELFNDEF 900

Query: 897 NPESKKNRRVKFK 909
           N  SKKNR+VKFK
Sbjct: 901 NAVSKKNRKVKFK 913

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  333 bits (855), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 238/359 (66%), Gaps = 4/359 (1%)

Query: 22  IRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYLYY 81
           +RAQLT LV IVA +SL  LA+ TGVYFT++YK+L  +RLYIA+QLKSSQ+DQ LNYLYY
Sbjct: 25  LRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSSQIDQTLNYLYY 84

Query: 82  QCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKXXXXXXXXXXXRVYDYDFKPVLN 141
           QCYW+ASR+T+Q  + S   G        ES +V+ K            +YD + K ++N
Sbjct: 85  QCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDKNLKSIMN 144

Query: 142 TTNNGTGDEVPESIQNQLFPLS-TDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPI---F 197
           +TNN +G  V  SI ++L PLS T+  +P  +   G+LTDP+LN T YLMSMSLPI   +
Sbjct: 145 STNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYLMSMSLPISGPY 204

Query: 198 ANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVF 257
           +  + I +   +YGY+TVVMSAE L+SVFNDT  L  S  A++SA Y+N T    + FVF
Sbjct: 205 STATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTLPRYFHFVF 264

Query: 258 PPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWV 317
           PP+ +  SI++    + + +F   AF + K GS KK K    K+ AIGY P +F    WV
Sbjct: 265 PPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGYAPTNFPLCKWV 324

Query: 318 AVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAE 376
           AVV+  +  F S S KLTKII GTVVGIAVFV L++ PL+ WAV+PIVRLQ+A+ELI +
Sbjct: 325 AVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRASELITK 383

 Score =  243 bits (619), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 160/227 (70%), Gaps = 2/227 (0%)

Query: 468 LNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTXXXXXXXXXXXXXX 527
            +E ++P YR+LF DEL++LT+TFN M++ALD+HYALLE RV  RT              
Sbjct: 480 FDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAAN 539

Query: 528 XXXTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGXXXXXXXXXXXX 587
              TVFIANISHELRTPLNGILGMT+ S+EE DI KI++ LKLIFRSG            
Sbjct: 540 EAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLT 599

Query: 588 FSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTP-NVIRTMVLWGDSN 646
           FSKNVL +T LE R F I ++  QIK+IF K+ + Q V+L I L P   +++++ +GDSN
Sbjct: 600 FSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSN 659

Query: 647 RIIQIVMNLVSNALKFTP-VDGKVNVRIKLLGEYDEEATKADNFKQI 692
           RI+Q++MNL+SNA+KFTP V+GKV V + LLGEYDEE +K +N+ ++
Sbjct: 660 RILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKV 706

 Score =  163 bits (413), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 99/123 (80%)

Query: 1019 RFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQ 1078
            + K+LVAEDN VNQEVIKRML LE I++I+LA DG +AF+KV+  +     YD+IFMDIQ
Sbjct: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073

Query: 1079 MPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMIL 1138
            MPK+DGL ST  IR++L Y+G IVALTAFAD+SNIKEC +AGM+GF+ KPIKR  L  +L
Sbjct: 1074 MPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133

Query: 1139 EEY 1141
            EE+
Sbjct: 1134 EEF 1136

 Score =  135 bits (339), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 771 NALFNTQFKKTPDLYEDSNDGLGTE-LADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQ 829
           N +FN   K+  D   D ND    E +   K WV   EV D GPGID  LH+SVF+PFVQ
Sbjct: 800 NLMFNRLIKREGD--GDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQ 857

Query: 830 GDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQ 879
           GDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF +T+PL Q
Sbjct: 858 GDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQ 907

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 78/153 (50%), Gaps = 10/153 (6%)

Query: 996  PFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQD 1055
            P  Q+T +   + N PT   +   F +L+ ED+ V  ++  + L   G + +++  DG  
Sbjct: 297  PLAQATPSKEEA-NPPT--SLRPGFHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLS 352

Query: 1056 AFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKE 1115
            A + V+        YD++ MDI MP +DG  +T +I R  + +  I+A+T   +D ++  
Sbjct: 353  AIETVEKF-----QYDLVLMDIVMPNLDGATATSVI-RSFDNQTPIIAMTGNIEDQDLVT 406

Query: 1116 CIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEM 1148
             ++ GMN  L+KP  +  L  +L  Y  + I +
Sbjct: 407  YLQHGMNDILAKPFTKDDLHSMLVRYLKDRIPL 439

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1013 MADVTMR--FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSY 1070
            + +V +R  F +L+ ED+ ++ ++  + L   G   + +  DG  A   ++     N  Y
Sbjct: 394  LNNVELRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRY 447

Query: 1071 DMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIK 1130
            D++ MDI MP +DG  +T +I R  + +  I+A+T   DD ++   ++ GMN  L+KP  
Sbjct: 448  DLVLMDIVMPNLDGATATSII-RSFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFT 506

Query: 1131 RPKLKMILEEY 1141
            R  L  +L  Y
Sbjct: 507  RDDLHSMLIRY 517

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 68/129 (52%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G + +++  DG  A + V+        YD++ MDI M
Sbjct: 329  FCVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKF-----QYDLVLMDIVM 382

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T +I R  + +  I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 383  PNLDGATATSVI-RSFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1140 EYCPNWIEM 1148
             Y  + + +
Sbjct: 442  RYLKDRVPL 450

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 79/163 (48%), Gaps = 21/163 (12%)

Query: 1000 STGTATSSRNVPTMAD------------VTMR--FKILVAEDNHVNQEVIKRMLNLEGIN 1045
            S  T+T S  +P++ D            VT+R  F +L+ ED+ V+ ++  + L   G  
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGFHVLLVEDDVVSIQLCSKFLRKYGCT 404

Query: 1046 NIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALT 1105
             + +  DG  A   ++        YD++ MDI MP +DG  +T ++ R  + +  I+A+T
Sbjct: 405  -VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIV-RSFDNETPIIAMT 457

Query: 1106 AFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEM 1148
                + ++   ++ GMN  L+KP  R  L  IL  Y  + I +
Sbjct: 458  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 500

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ ++ ++  + L   G   +++  DG  A   ++        YD++ MDI M
Sbjct: 353  FHVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 406

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T +I R  + +  I+A+T   +D ++   ++ GMN  L+KP  R  L  +L 
Sbjct: 407  PNLDGATATSII-RSFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1140 EYCPNWIEM 1148
             Y  + + +
Sbjct: 466  RYLKDRVPL 474

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 78/163 (47%), Gaps = 21/163 (12%)

Query: 1000 STGTATSSRNVPTMAD------------VTMR--FKILVAEDNHVNQEVIKRMLNLEGIN 1045
            S  T+T S  +P + D            VT+R  F +L+ ED+ V+ ++  + L   G  
Sbjct: 343  SPATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT 402

Query: 1046 NIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALT 1105
             + +  DG  A   ++        YD++ MDI MP +DG  +T ++ R  + +  I+A+T
Sbjct: 403  -VQVVSDGLSAISTLEKY-----RYDLVLMDIVMPNLDGATATSIV-RSFDNETPIIAMT 455

Query: 1106 AFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEM 1148
                + ++   ++ GMN  L+KP  R  L  IL  Y  + I +
Sbjct: 456  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 498

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V+  +  + L   G   +++  DG  A   ++        YD++ MDI M
Sbjct: 381  FHVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 434

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T +I R+ + +  I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 435  PNLDGATATSII-RNFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1140 EYCPNWIEM 1148
             Y  + I +
Sbjct: 494  RYLKDRIPL 502

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 78/163 (47%), Gaps = 21/163 (12%)

Query: 1000 STGTATSSRNVPTMAD------------VTMR--FKILVAEDNHVNQEVIKRMLNLEGIN 1045
            S  T+T S  +P + D            VT+R  F +L+ ED+ V+ ++  + L   G  
Sbjct: 344  SPTTSTVSLQMPNLPDENSLTPNAQGNAVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT 403

Query: 1046 NIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALT 1105
             + +  DG  A   ++        YD++ MDI MP +DG  +T ++ R  + +  I+A+T
Sbjct: 404  -VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIV-RSFDNETPIIAMT 456

Query: 1106 AFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEM 1148
                + ++   ++ GMN  L+KP  R  L  IL  Y  + I +
Sbjct: 457  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKDRIPL 499

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        YD++ MDI M
Sbjct: 405  FHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKF-----RYDLVLMDIVM 458

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++ R  + +  I+A+T   +D ++   ++ GMN  L+KP  R  L  IL 
Sbjct: 459  PNLDGATATSIV-RSFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSILI 517

Query: 1140 EYCPNWIEM 1148
             +  + I +
Sbjct: 518  RHLKDRIPL 526

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 9/135 (6%)

Query: 1016 VTMR--FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMI 1073
            VT+R  F +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        YD++
Sbjct: 373  VTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLV 426

Query: 1074 FMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPK 1133
             MDI MP +DG  +T ++ R  + +  I+A+T    + ++   ++ GMN  L+KP  R  
Sbjct: 427  LMDIVMPNLDGATATSIV-RSFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDD 485

Query: 1134 LKMILEEYCPNWIEM 1148
            L  IL  Y  + I +
Sbjct: 486  LHSILIRYLKDRIPL 500

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G + +++  DG  A   ++        YD++ MDI M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 360

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   + +  I+A+T   +D ++   +E GMN  L+KP  +  L  +L 
Sbjct: 361  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1140 EYCPNWIEM 1148
             Y  + + +
Sbjct: 420  RYLKDRVPL 428

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ +  ++  + L   G   +++  DG  A   ++        YD++ MDI M
Sbjct: 305  FHVLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 358

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   + +  I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 359  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 417

Query: 1140 EYCPNWIEM 1148
             Y  N + +
Sbjct: 418  RYLRNRVPL 426

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G   +++  DG  A   ++        YD++ MDI M
Sbjct: 334  FHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIVM 387

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   N+   I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 388  PNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 446

Query: 1140 EYCPNWIEM 1148
             Y  + + +
Sbjct: 447  RYLKDRVPL 455

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G   + +  DG  A       V +N  +D++ MDI M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAIS-----VLENHRFDLVLMDIVM 469

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   NY   I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 470  PNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1140 EY 1141
             Y
Sbjct: 529  RY 530

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 70/129 (54%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G + +++  DG  A   + +L +Q   +D++ MDI M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSA---ISTLEKQ--RFDLVLMDIVM 382

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   + +  I+A+T   DD ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 383  PNLDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1140 EYCPNWIEM 1148
             Y  + I +
Sbjct: 442  RYLKDRIPL 450

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V  ++  + L   G   +++  DG  A   ++        YD++ MDI M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++ R  +    I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 430  PNLDGATATSIV-RSFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1140 EYCPNWIEM 1148
             Y  + + +
Sbjct: 489  RYLRDRVPL 497

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        +D++ MDI M
Sbjct: 382  FHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKF-----RFDLVLMDIVM 435

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T +IR + + +  I+A+T   +  ++   ++ GMN  L+KP  R  L  IL 
Sbjct: 436  PNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILI 494

Query: 1140 EYCPNWI 1146
             Y  + +
Sbjct: 495  RYLKDRV 501

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 7/119 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            + +L+ ED+ V+ ++  + L   G   +++  DG  A   +++       YD++ MDI M
Sbjct: 424  YHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAF-----RYDLVLMDIVM 477

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMIL 1138
            P +DG  +T +I R+ + +  I+A+T   +D ++   ++ GM   L+KP  R  L  +L
Sbjct: 478  PNLDGATATSII-RNFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 67/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ +  ++  + L ++    +++  DG  A   ++        +D++ MDI M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T ++R   + +  I+A+T   +D ++   ++ GMN  L+KP  +  L  +L 
Sbjct: 356  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1140 EYCPNWIEM 1148
             Y  N + +
Sbjct: 415  RYLRNRVPL 423

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1020 FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQM 1079
            F +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        +D++ MDI M
Sbjct: 350  FNVLLVEDDEVSIQLCSKFLIKYGCT-VQVVTDGLAAISTLEKY-----RFDLVLMDIVM 403

Query: 1080 PKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILE 1139
            P +DG  +T +IR + + +  I+A+T   +  ++   ++ GMN  L+KP  R  L  +L 
Sbjct: 404  PNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLT 462

Query: 1140 EYCPNWIEM 1148
             Y  N + +
Sbjct: 463  RYLKNRVPL 471

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 30/159 (18%)

Query: 994  DRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDG 1053
            D PFL+S     ++ ++ T   V  +  +LV EDN +NQ ++   L    I+   +A +G
Sbjct: 394  DSPFLRSAMETFTTESI-TRDKVFPKISVLVVEDNMINQTILSSFLRKHKIS-YKVAKNG 451

Query: 1054 QDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRR--DLNYKGS----------- 1100
             +A D+ +          +I MD++MP + G+ + K IRR   LN  GS           
Sbjct: 452  IEAVDRWK-----EGGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPA 506

Query: 1101 ----------IVALTAFADDSNIKECIEAGMNGFLSKPI 1129
                      IVALTA    S+  E + AG N +L+KP+
Sbjct: 507  KRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPV 545

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 73/143 (51%), Gaps = 16/143 (11%)

Query: 1009 NVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQND 1068
            N  T A+V  +  +L+ EDN +NQ ++   L    I +  +A +G++A D     + +  
Sbjct: 506  NTSTSANVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVD-----IWKEG 559

Query: 1069 SYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGS--------IVALTAFADDSNIKECIEAG 1120
               +IFMD+Q+P + G+ + K I RD   K +        IVALTA     + ++ + +G
Sbjct: 560  GLHLIFMDLQLPVLSGIDAAKQI-RDCEKKRTASQNAPVIIVALTASNSIEDKRKALISG 618

Query: 1121 MNGFLSKPIKRPKL-KMILEEYC 1142
             N +L+KP+    L K I E  C
Sbjct: 619  CNDYLTKPVNLHWLSKKITEWGC 641

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 75/154 (48%), Gaps = 12/154 (7%)

Query: 995  RPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQ 1054
            RP   ST   T +    T   V  +  +L+ EDN +NQ ++   L    I+   +A +G+
Sbjct: 450  RPLRISTSGFTLTSATTTTEKVFPKINVLIVEDNVINQAILGGFLRKHKIS-YKVAKNGK 508

Query: 1055 DAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGS-----IVALTAFAD 1109
            +A +     + +N    +IFMD+Q+P + G+ + K IR     + S     IVALTA   
Sbjct: 509  EAVE-----MWKNGGLHLIFMDLQLPVLSGIDAAKQIRDFEKERPSCAPVIIVALTASNS 563

Query: 1110 DSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
              + +  + +G N +L+KP+    L K I E  C
Sbjct: 564  AEDKRNALVSGCNDYLTKPVNLHWLSKKITEWGC 597

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 70/146 (47%), Gaps = 34/146 (23%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+  ++A +G +A +K +          
Sbjct: 541  TRDKVFPKINVLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWR-----QGGIH 594

Query: 1072 MIFMDIQMPKVDGLLSTKMIR-------------------RD--LNYKGS-------IVA 1103
            +I MD+Q+P + GL +TK IR                   RD  L+   S       IVA
Sbjct: 595  LILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVA 654

Query: 1104 LTAFADDSNIKECIEAGMNGFLSKPI 1129
            LTAF+  ++ +E + AG N +L+KP+
Sbjct: 655  LTAFSSHADRREALVAGCNDYLTKPV 680

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 68/135 (50%), Gaps = 26/135 (19%)

Query: 1015 DVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIF 1074
            ++  +  +L+ EDN +NQ +++  L    I+   +A +GQ+A D+ +         D+IF
Sbjct: 496  EIFPKITVLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKE-----GGIDLIF 549

Query: 1075 MDIQMPKVDGLLSTKMIR---------------RDLNYKGS-----IVALTAFADDSNIK 1114
            MD+Q+P   G+ + K IR               ++ + K S     IVA TA    ++ +
Sbjct: 550  MDLQLPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKR 609

Query: 1115 ECIEAGMNGFLSKPI 1129
            E + +G N +L+KP+
Sbjct: 610  EALLSGCNDYLTKPV 624

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 34/159 (21%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   +A +G++A DK +       +  
Sbjct: 455  TSEKVFPKINVLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKE-----GNLH 508

Query: 1072 MIFMDIQMPKVDGLLSTKMIRR---------------------DLNYKGS------IVAL 1104
            +IFMD+Q+P + G+ + K IR                       +N  GS      IVAL
Sbjct: 509  LIFMDLQLPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVAL 568

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            TA     + +E + +G N +L+KP+    L K I E  C
Sbjct: 569  TASNSQEDKREALISGCNDYLTKPVNLLWLSKKITEWGC 607

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 71/171 (41%), Gaps = 42/171 (24%)

Query: 992  HLDRPFLQSTGTATSSRNVP-------TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGI 1044
             L R F    G   SSR  P       T   V  +  +L+ EDN +NQ ++   L    I
Sbjct: 533  RLSRSFAPKNG---SSREKPFPGEWSATSDKVFPKINVLIVEDNVINQTILSSFLRKHKI 589

Query: 1045 NNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRR----------- 1093
                +A +GQ+A D     V +     +IFMD+Q+P + G+ + K IR            
Sbjct: 590  F-YKVAKNGQEAID-----VWREGGIHLIFMDLQLPVLSGIDAAKKIRELEREHGIGIQK 643

Query: 1094 ---------------DLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPI 1129
                            +N    IVA TA    S+ KE + +G N +L+KP+
Sbjct: 644  SRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPV 694

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 73/159 (45%), Gaps = 34/159 (21%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   LA +GQ+A +     + +     
Sbjct: 496  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN-----IWKEGGLH 549

Query: 1072 MIFMDIQMPKVDGLLSTKMIR-----------RDLN------YKGS----------IVAL 1104
            +IFMD+Q+P + G+ + K IR           + LN       KG+          IVAL
Sbjct: 550  LIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVAL 609

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            TA     + ++ + +G N +L+KP+    L K I E  C
Sbjct: 610  TASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEWGC 648

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 72/156 (46%), Gaps = 29/156 (18%)

Query: 996  PFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQD 1055
            PF+ S   + ++ ++ T   V  +  +LV EDN +NQ ++   L    I+   +A +G +
Sbjct: 383  PFILSAMESVTTESI-TRDKVFPKISVLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVE 440

Query: 1056 AFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRR--------------------DL 1095
            A D+ +          +I MD++MP + G+ + K IR+                     L
Sbjct: 441  AVDRWK-----EGGMHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGL 495

Query: 1096 NYKGS--IVALTAFADDSNIKECIEAGMNGFLSKPI 1129
              K    IVALTA    ++  E + AG N +L+KP+
Sbjct: 496  TCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPV 531

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 34/139 (24%)

Query: 1019 RFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQ 1078
            +  +L+ EDN +NQ ++   L    I+  ++A +G +A +K +          +I MD+Q
Sbjct: 508  KINVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR-----KGGIHLILMDLQ 561

Query: 1079 MPKVDGLLSTKMIRR-----------------------DLN---YKGS--IVALTAFADD 1110
            +P + G+ + K IR                        +LN   ++    IVALTAF+  
Sbjct: 562  LPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSH 621

Query: 1111 SNIKECIEAGMNGFLSKPI 1129
            ++  E + AG N +L+KP+
Sbjct: 622  ADRNEALVAGCNDYLTKPV 640

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (54%), Gaps = 8/102 (7%)

Query: 992  HLDRPFLQSTGTATSSR-NVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLA 1050
             L RP  + T  +   + N+P    V  R  +L+ EDN +NQ ++   L   GI +  +A
Sbjct: 366  ELPRPLSRRTTPSLDKQGNLPKYK-VFPRINVLIVEDNAINQAILALFLRKNGI-SYKVA 423

Query: 1051 CDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIR 1092
             DG +A +K +    + DS+ +I MD+Q+P + GL +TK IR
Sbjct: 424  KDGVEAIEKWK----EGDSH-LILMDLQLPLLSGLEATKKIR 460

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 34/159 (21%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   LA +GQ+A +     + +     
Sbjct: 495  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN-----IWKEGGLH 548

Query: 1072 MIFMDIQMPKVDGLLSTKMIR----------------RDLNYKGS-----------IVAL 1104
            +IFMD+Q+P + G+ + K IR                   N++ S           IVAL
Sbjct: 549  LIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVAL 608

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            TA     + ++ + +G N +L+KP+    L K I E  C
Sbjct: 609  TASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEWGC 647

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 71/159 (44%), Gaps = 34/159 (21%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   LA +GQ+A +     + +     
Sbjct: 485  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN-----IWKEGGLH 538

Query: 1072 MIFMDIQMPKVDGLLSTKMIR-----------RDLNYKGS----------------IVAL 1104
            +IFMD+Q+P + G+ + K IR           + LN   S                IVAL
Sbjct: 539  LIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVAL 598

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            TA     + ++ + +G N +L+KP+    L K I E  C
Sbjct: 599  TASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEWGC 637

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 70/162 (43%), Gaps = 37/162 (22%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   +A +G++A DK +          
Sbjct: 503  TGEKVFPKINVLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWKE-----GGLH 556

Query: 1072 MIFMDIQMPKVDGLLSTKMIRRDLNYKG------------------------------SI 1101
            +IFMD+Q+P + G+ + K IR    +KG                               I
Sbjct: 557  LIFMDLQLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVII 616

Query: 1102 VALTAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            VA TA    ++ +E + +G N +L+KP+    L K I E  C
Sbjct: 617  VAFTASNSLTDKREALISGCNDYLTKPVNLHWLSKKITEWGC 658

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 71/159 (44%), Gaps = 34/159 (21%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   LA +GQ+A +     + +     
Sbjct: 478  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVN-----IWKEGGLH 531

Query: 1072 MIFMDIQMPKVDGLLSTKMIR-----------RDLN--YKGS--------------IVAL 1104
            +IFMD+Q+P + G+ + K IR           + LN  Y                 IVAL
Sbjct: 532  LIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVAL 591

Query: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            TA     + ++ + +G N +L+KP+    L K I E  C
Sbjct: 592  TASNSQMDKRKALVSGCNDYLTKPVNLHWLSKKITEWGC 630

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 67/151 (44%), Gaps = 26/151 (17%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   +A +G++A D     + +     
Sbjct: 537  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVD-----IWKEGGLH 590

Query: 1072 MIFMDIQMPKVDGLLSTKMIRRDLNYKG-------------------SIVALTAFADDSN 1112
            +IFMD+Q+P + G+ + + IR      G                    IVALTA     +
Sbjct: 591  LIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDD 650

Query: 1113 IKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
             +  + +G N +L+KP+    L K I E  C
Sbjct: 651  KRNALISGCNDYLTKPVNLHWLSKKITEWGC 681

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 75/176 (42%), Gaps = 37/176 (21%)

Query: 998  LQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAF 1057
            L+ST      +   T  ++  R  IL+ EDN +NQ ++   L    I    +A +G++A 
Sbjct: 543  LKSTTNPVKPKMRSTSENIFPRINILIVEDNVINQTILGSFLRKNKI-FYKVAKNGREAV 601

Query: 1058 DKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRR------------------------ 1093
            DK +          +IFMD+Q+P + G  + K IR+                        
Sbjct: 602  DKWKE-----GGIHLIFMDLQLPVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSES 656

Query: 1094 DLNYKGS------IVALTAFADDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
             LN K S      IVA TA    ++ +  + AG N +L+KP+    L K I E  C
Sbjct: 657  FLNTKSSACAPVIIVAFTASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEWGC 712

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 30/155 (19%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T   V  +  +L+ EDN +NQ ++   L    I+   +A +G++A D     + +     
Sbjct: 662  TSEKVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVD-----IWKEGGLH 715

Query: 1072 MIFMDIQMPKVDGLLSTKMIRRDLNYKG-----------------------SIVALTAFA 1108
            +IFMD+Q+P + G+ + + IR     KG                        IVALTA  
Sbjct: 716  LIFMDLQLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASN 775

Query: 1109 DDSNIKECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
               + ++ + +G N +L+KP+    L K I E  C
Sbjct: 776  SLDDKRKALLSGCNDYLTKPVNLHWLSKKITEWGC 810

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 66/150 (44%), Gaps = 35/150 (23%)

Query: 1022 ILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPK 1081
            +L+ EDN +NQ ++   L    I+   +A +G++A +K +          +IFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE-----GGIHLIFMDLQLPV 526

Query: 1082 VDGLLSTKMIRRDLNYKG----------------------------SIVALTAFADDSNI 1113
            + G+ + K IR     KG                             +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1114 KECIEAGMNGFLSKPIKRPKL-KMILEEYC 1142
            +E + +G N +L+KP+    L K I E  C
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEWGC 616

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 1012 TMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYD 1071
            T  +V  +  +L+ EDN +NQ ++   L    I +  +A +G++A DK +          
Sbjct: 454  TRENVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIH 507

Query: 1072 MIFMDIQMPKVDGLLSTKMIR 1092
            +I +D+Q+P + G+ +TK IR
Sbjct: 508  LILLDLQLPILSGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 804 FAIEVEDTGPGIDPKLHESVFEPFV------QGDQTLS---------RQYGGTGLGLSIC 848
             I + D G GIDP++ + VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 849 RQLATMMHGTMKLESKVGVGS 869
           +    + +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 1006 SSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVE 1065
            S R    + DV  R  ILV E   +++  + R L   G   + +      A D++ S   
Sbjct: 1528 SGRKSSGVNDVGYRMDILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRAN 1582

Query: 1066 QNDSYDMIFMDIQMPKVDGLLSTKMIRR--DLNYKGSIVALTAFADDSNIKECIEAGM-N 1122
                +D+I   +++PK+  +   K+I+    +N +  I+A+T F       E I A + +
Sbjct: 1583 SGVKFDLIVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNF-----YHEAISAKVFD 1637

Query: 1123 GFLSKPIKRPKLKMILEEYC 1142
              L KPI   +++ ++ +Y 
Sbjct: 1638 DVLEKPIMLDEIRHLVAKYA 1657

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 67/131 (51%), Gaps = 11/131 (8%)

Query: 1013 MADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDM 1072
            ++D+     +LV E   +++  + R L   G + + ++  G +   +  S V+    +D+
Sbjct: 1382 ISDIAYNMDVLVCEPIPIHRFKLTRDLESLGCSVVSVSM-GDEMVRRATSDVK----FDL 1436

Query: 1073 IFMDIQMPKVDGLLSTKMIR--RDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIK 1130
            IF  +++PK+  +   K++R    +N   SI+A+TA+  ++  + C     +  L +P+ 
Sbjct: 1437 IFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLERPVS 1492

Query: 1131 RPKLKMILEEY 1141
              +L+ +L +Y
Sbjct: 1493 VQQLRSLLLKY 1503

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 15/94 (15%)

Query: 806 IEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYG---------------GTGLGLSICRQ 850
           I + D G GI P++ + +FE      Q  ++  G               G G GL +C+ 
Sbjct: 319 IRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMCKA 378

Query: 851 LATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIK 884
              M  G++ ++S  G G+     +   + +++K
Sbjct: 379 YLEMFDGSLDIQSLYGWGTDVYIKLKGPENKLLK 412

>KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} similar to
            uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
            Folylpolyglutamate synthetase catalyzes extension of the
            glutamate chains of the folate coenzymes required for
            methionine synthesis and for maintenance of mitochondrial
            DNA present in both the cytoplasm and mitochondria
          Length = 493

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 1076 DIQMPK--VDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPK 1133
            D ++P+  VDGL S K   R    +    A+T   D ++ K+ IEA    F S+ IK P+
Sbjct: 312  DTELPQRFVDGLTSAKWNGRCQTVQDG--AITWLIDGAHTKDSIEAASGWFKSEVIKTPR 369

Query: 1134 LKMIL 1138
             K++L
Sbjct: 370  KKVLL 374

>Ecym_7048 Chr7 (95931..101768) [5838 bp, 1945 aa] {ON} similar to
            Ashbya gossypii AEL256C
          Length = 1945

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 1064 VEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNG 1123
            +EQ     MI  D+ +   D +  T++    L  K     L AF  +S +K   E  +  
Sbjct: 778  IEQVIDAPMIAGDVTLLGSDVIYKTRV----LGAKALGYTLAAF-QESTVKSFFETALLS 832

Query: 1124 FLSKPIKRPKL--KMILEEYCPNWIEM 1148
             L  P   P++   +I+ EYC +W+E+
Sbjct: 833  CLDLPYATPRMLVAIIVAEYCSHWMEL 859

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 63/127 (49%), Gaps = 13/127 (10%)

Query: 1015 DVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIF 1074
            DV     ILV E   +++  + + L   G + + ++  G +   +  S V+    +D+IF
Sbjct: 1381 DVLYNMDILVCEPIPIHRFKLTKDLESLGCSVVSVSM-GDEMVRRATSDVK----FDLIF 1435

Query: 1075 MDIQMPKVDGLLSTKMIR--RDLNYKGSIVALTAFADDSNIKECIEAGM-NGFLSKPIKR 1131
              +++PK+  +   K++R    +N   SI+A+TA+      +E  +AG+    L +P   
Sbjct: 1436 TALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAY-----YQEAQQAGVFEDVLERPATV 1490

Query: 1132 PKLKMIL 1138
             +L+ +L
Sbjct: 1491 QQLRSLL 1497

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,637,822
Number of extensions: 3993486
Number of successful extensions: 11195
Number of sequences better than 10.0: 77
Number of HSP's gapped: 11256
Number of HSP's successfully gapped: 140
Length of query: 1169
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1048
Effective length of database: 39,606,813
Effective search space: 41507940024
Effective search space used: 41507940024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)