Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H06545g5.699ON49249220090.0
YIL146C (ATG32)5.699ON5292134401e-47
Smik_9.235.699ON5272154182e-44
ZYRO0G06666g5.699ON5032144092e-43
Skud_9.225.699ON5372154093e-43
Suva_9.435.699ON5132503846e-40
TDEL0B022205.699ON4892223792e-39
KAFR0D022505.699ON5562333152e-30
KNAG0L021005.699ON4442192592e-23
SAKL0E14850g5.699ON4702072565e-23
TBLA0E020905.699ON7491412588e-23
NCAS0G002605.699ON5102362471e-21
KLTH0E01122g5.699ON4721972381e-20
Kwal_55.197165.699ON4672072362e-20
Ecym_40215.699ON4592082327e-20
AFR283W5.699ON4522102051e-16
KLLA0A00660g5.699ON5242061856e-14
Kpol_2001.735.699ON41136860.056
TPHA0D045805.699ON470135697.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06545g
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   778   0.0  
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   174   1e-47
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   165   2e-44
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   162   2e-43
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   162   3e-43
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   152   6e-40
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   150   2e-39
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   125   2e-30
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   104   2e-23
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   103   5e-23
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   103   8e-23
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   100   1e-21
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    96   1e-20
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    96   2e-20
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...    94   7e-20
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...    84   1e-16
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    76   6e-14
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    38   0.056
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             31   7.0  

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/492 (79%), Positives = 391/492 (79%)

Query: 1   MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQMEGSEVPSESGVLGESW 60
           MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQMEGSEVPSESGVLGESW
Sbjct: 1   MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQMEGSEVPSESGVLGESW 60

Query: 61  QQIRESDVGDGGDSNFDQQSNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKNFHMTXXX 120
           QQIRESDVGDGGDSNFDQQSNT                            YKNFHMT   
Sbjct: 61  QQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQLLGGQQEYKNFHMTAEE 120

Query: 121 XXXXXXXXXXFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFTXX 180
                     FGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFT  
Sbjct: 121 QLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFTSD 180

Query: 181 XXXXXXXXXXXXXXFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS 240
                         FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS
Sbjct: 181 SMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS 240

Query: 241 DPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKND 300
           DPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKND
Sbjct: 241 DPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKND 300

Query: 301 AITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXX 360
           AITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDV               GY      
Sbjct: 301 AITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRR 360

Query: 361 XXHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAESHHANEAKGFXXXXX 420
             HGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAESHHANEAKGF     
Sbjct: 361 KKHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAESHHANEAKGFSITNG 420

Query: 421 XXXXXXXXXXXXXXXXTISQKGLLRNTIVFIKRTIHNLNGKVGTFFASITQVIKQTPVRE 480
                           TISQKGLLRNTIVFIKRTIHNLNGKVGTFFASITQVIKQTPVRE
Sbjct: 421 NSGSSSISHSTEYYESTISQKGLLRNTIVFIKRTIHNLNGKVGTFFASITQVIKQTPVRE 480

Query: 481 DNQFYTLGYMLS 492
           DNQFYTLGYMLS
Sbjct: 481 DNQFYTLGYMLS 492

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  174 bits (440), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 124/213 (58%), Gaps = 14/213 (6%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           FVMPKLSLT K +   +LL++GR    F+Q IP+EY+  F + +  D + F  Y GIVI+
Sbjct: 203 FVMPKLSLTQK-NPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDSATFPQYTGIVII 261

Query: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314
           FQEL+E V++LNRIVQY+  KP+IPICQPGQ I+VKN+LKSFL+N  + L +PPV + N+
Sbjct: 262 FQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVTNK 321

Query: 315 KSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTN---- 370
           + ++K+F+    L   LE  EDV                Y           K   +    
Sbjct: 322 RDLKKMFQRLQDL--SLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKP 379

Query: 371 -------YSKWITWGISLTIGVSIGYYATYMIT 396
                  ++ W TWGIS+TIG+S G   TY +T
Sbjct: 380 KRKKQKFFTSWFTWGISITIGISFGCCVTYFVT 412

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 120/215 (55%), Gaps = 16/215 (7%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           FVMPKLSL+ K +   +LL++GR    F+Q IP+EY+  F + +  D + F  Y GI+I+
Sbjct: 203 FVMPKLSLSQK-NPVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATFPQYTGIIII 261

Query: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314
           FQEL+E V++LNRIVQY+  KPIIPICQPGQ I+VKN+LKSFL+N  I L +PPV + N 
Sbjct: 262 FQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNR 321

Query: 315 KSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTN---- 370
           K ++K+F+     +  L  E                   Y           K   +    
Sbjct: 322 KDLKKMFQR----LQDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKP 377

Query: 371 -------YSKWITWGISLTIGVSIGYYATYMITTT 398
                  ++ W TWGIS+TIG+S G   TY +T  
Sbjct: 378 KKKKQRFFTSWFTWGISITIGISFGCCVTYFVTAA 412

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 127/214 (59%), Gaps = 11/214 (5%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           F+MPKLSL+ K +Q  ++LV+GR   +F+  IP++Y+  F + +S DP+EF+ Y GI++V
Sbjct: 191 FIMPKLSLSQK-TQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVV 249

Query: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314
           FQELKE V++LNR+ Q    +P+IP+CQ GQR +V+N+L+S LKN  ++L YPPV + N+
Sbjct: 250 FQELKEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQ 309

Query: 315 KSMEKLFKHTVKLVNKLENEEDVXXXX----XXXXXXXXXXXGYXXXXXXXXHGGKP--- 367
             +  +F+   +L   + +  D+                               G+P   
Sbjct: 310 PDLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKK 369

Query: 368 ---STNYSKWITWGISLTIGVSIGYYATYMITTT 398
              +   ++W+ WG+SLT+GV +GY  ++++++T
Sbjct: 370 RHNNEKVNRWVLWGVSLTLGVGVGYCISHLVSST 403

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  162 bits (409), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/215 (39%), Positives = 120/215 (55%), Gaps = 12/215 (5%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           FVMPKLSL+ K +   +LL++GR    F+Q IP+E++  F + +  D + F  Y GI+I+
Sbjct: 209 FVMPKLSLSQK-NPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIII 267

Query: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314
           FQEL+E V++LNRIVQY+  KPIIPICQPGQ I+VKN+LKSFL+N  I L YPPV + N 
Sbjct: 268 FQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNR 327

Query: 315 KSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPST----- 369
           + ++K+F+    L  +   + D                 Y           K        
Sbjct: 328 RDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSKKKSFKSNKKP 387

Query: 370 ------NYSKWITWGISLTIGVSIGYYATYMITTT 398
                 + ++W TWG+S+TIG+S G   TY  T  
Sbjct: 388 KKKKQRSLTRWFTWGVSITIGISFGCCVTYFATAA 422

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  152 bits (384), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 124/250 (49%), Gaps = 24/250 (9%)

Query: 167 SLDEHELNSIFTXXXXXXXXXXXXXXXXFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDI 226
            +D  + N ++                 FVMPKLSL+ K +   +LL++GR    F+Q  
Sbjct: 180 CIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKLSLSRK-NPVFRLLILGRTGTNFYQST 238

Query: 227 PREYRQYFHISQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQR 286
           P+EY+  F + +S D + F  Y GIVIVFQEL+E V++LNRIV+Y   KPIIPICQPGQ 
Sbjct: 239 PKEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQT 298

Query: 287 IRVKNILKSFLKNDAITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXX 346
           I+VKN+LKSFLKN  I L YPPV   N K ++K+F+    L   LE  ED          
Sbjct: 299 IQVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDL--SLEYVEDEKNEDEDEDN 356

Query: 347 XXXXXXGYXXX------------------XXXXXHGGKPSTNYSKWITWGISLTIGVSIG 388
                  Y                             + ST +  W   G+S+TIG+S G
Sbjct: 357 DDEIIQPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTW---GVSITIGISFG 413

Query: 389 YYATYMITTT 398
              TY +T  
Sbjct: 414 CCVTYFVTAA 423

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  150 bits (379), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 125/222 (56%), Gaps = 11/222 (4%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           FVMPKLSL+ K S   ++L++GR   +F+Q IP+ Y+ +F +S+  DPSEF+ + GI+IV
Sbjct: 178 FVMPKLSLSQK-SHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIV 236

Query: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314
           FQELKE V++LNR+ Q    +P+IP+CQ GQ  +V+N+L+S LK+  I+L YPPV I+N 
Sbjct: 237 FQELKEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNH 296

Query: 315 KSMEKLFKHTVKLVNKLENEE----------DVXXXXXXXXXXXXXXXGYXXXXXXXXHG 364
             +  +++  + L   + +             +               G           
Sbjct: 297 SDLNNMYRFLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKR 356

Query: 365 GKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAES 406
               T  +KWI WGISLT+GV +GY  +Y  ++ L+   A+S
Sbjct: 357 RSKETKINKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKS 398

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 20/77 (25%)

Query: 12 SSSAKLASTSRNGPES----------SILDPHHSVMELLQRQME----------GSEVPS 51
          +S +K+A   R G  S          S+LDPH SV+ELL+R  +            ++ +
Sbjct: 4  ASESKIAKQDRVGEVSGVETTAFEKKSLLDPHLSVLELLERTGDTQRVGRGVEKADDMAN 63

Query: 52 ESGVLGESWQQIRESDV 68
           +  +  SWQ I  +D 
Sbjct: 64 TTNSISSSWQAIHRNDA 80

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  125 bits (315), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 121/233 (51%), Gaps = 34/233 (14%)

Query: 195 FVMPKLSLTYKPSQAK-----KLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYI 249
           F+MP+LSLT K  Q       ++L+VGRLS +  + IP +++  F + +S D +E+Q + 
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283

Query: 250 GIVIVFQELKEFVAMLNRIVQYTD-KKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPP 308
            I++V QE +E +++LNRI +    K+P+I IC+    ++ KN+LKS+L+ND ITL Y P
Sbjct: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343

Query: 309 VTIANEKSMEKL---------------FKHTVKLVNKLENE--------EDVXXXXXXXX 345
             I+N + ++++               +   +++  K+ N+         D+        
Sbjct: 344 FVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVK 403

Query: 346 XXX---XXXXGYXXXXXXXXHGGKPSTN--YSKWITWGISLTIGVSIGYYATY 393
                     G         H  KP  N  Y+KWI WGISL+IGV IGY  +Y
Sbjct: 404 NDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISY 456

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 117/219 (53%), Gaps = 17/219 (7%)

Query: 195 FVMPKLSLTYK--PS--------QAKKLLVVGRLSKRFHQD-IPREYRQYFHISQS-SDP 242
           F+MPKL  T    PS        +  K+ V+GR + +F Q+ +P ++R  F ++    D 
Sbjct: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196

Query: 243 SEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAI 302
           ++  +  GI+IV QE++E +++LNR+     + P++ +    ++++VKN+L++F +   +
Sbjct: 197 AQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLV 256

Query: 303 TLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXX 362
           +L +PPV ++N ++++K+F      V+ L  +++                          
Sbjct: 257 SLLHPPVPLSNNEALDKMFH----FVDNLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHR 312

Query: 363 HGGKPSTNYSKWITWGISLTIGVSIGYYA-TYMITTTLL 400
              KP   + +W+ WG+S+++G+  GYY  +Y++++++ 
Sbjct: 313 GPSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVSSSMC 351

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 23 NGPESSILDPHHSVMELLQRQME---GSEVPSES---GV----LGESWQQIRESDVGDGG 72
          +G  +S+LDPH SV+ELL++  E    +E P  S   G     L ESW  + E D     
Sbjct: 2  SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTV-ERDELSAM 60

Query: 73 DSNFDQQSN 81
          + +  QQ+N
Sbjct: 61 ERSASQQTN 69

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 110/207 (53%), Gaps = 23/207 (11%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHIS--QSSDPSEFQNYIGIV 252
           FVMP+LSL+ + S   ++LVVG+ +++F  ++P+ Y++ F I   +S    +  +Y  ++
Sbjct: 186 FVMPQLSLSQR-SHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSHYTAVM 244

Query: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312
           I+FQ+ KE   +L+ +V   D K IIPICQ GQ+ ++ ++L+ F+K   I L + P  ++
Sbjct: 245 IIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMS 304

Query: 313 NEKSMEKLFKHTVKLVNKL----ENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPS 368
           N + + KL ++  +L  ++    E +E                 G               
Sbjct: 305 NHQEIHKLLRYLHRLSTEIDSGYETDETHLKVRKRKKTHKKKSKG--------------- 349

Query: 369 TNYSKWITWGISLTIGVSIGYYATYMI 395
              ++W+ WG+SLT+GV IG   ++++
Sbjct: 350 -TSNRWVIWGLSLTVGVGIGCCISFIL 375

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  103 bits (258), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (59%), Gaps = 1/141 (0%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254
           F+MPKLS T    + + L++    +  F+Q+IP  Y+  F +  ++    F++Y GI IV
Sbjct: 336 FIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDYNFKHYAGIAIV 395

Query: 255 FQELKEFVAMLNRIVQYT-DKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIAN 313
             +L +F ++LN+I +Y+ +KKPIIPIC+ GQ   VKNILK ++K   ++L YPP+   N
Sbjct: 396 IHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDLSLLYPPIVGTN 455

Query: 314 EKSMEKLFKHTVKLVNKLENE 334
              M  L+ H   L   +E E
Sbjct: 456 RDGMNTLYLHLNDLSKNVELE 476

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 115/236 (48%), Gaps = 35/236 (14%)

Query: 195 FVMPKLSLTYKPSQAKK--LLVVGRLSKRFHQDIPREYRQYFHISQSSDP---SEFQNYI 249
           FVMP LSL+   SQ +K  +L+ GRL   F++ IP++Y+  FH+    +    +E  N+ 
Sbjct: 168 FVMPTLSLSSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFT 227

Query: 250 GIVIVFQELKEFVAMLNRIVQYTDKKPIIPI----CQPGQRIRVKNILKSFLKNDAITLW 305
             +I+F+ELKE V++LNRI +    K + P     CQPGQ+I+VK+ILK FLKN+ +TL 
Sbjct: 228 AFLIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLL 287

Query: 306 YPPVTIANE-------KSMEKLFKHTV-------------------KLVNKLENEEDVXX 339
            P + I +E       K+M+ + K  +                    + +K+ + + +  
Sbjct: 288 SPIIIINDERALLKMFKTMQSISKTVISASSSTTSSDNEEEESSDPSMNDKVIDVKTIKE 347

Query: 340 XXXXXXXXXXXXXGYXXXXXXXXHGGKPSTNYSKWITWGISLTIGVSIGYYATYMI 395
                         +             S   +KW+ W ISLT+G  +GY  +Y +
Sbjct: 348 SMMSSQKKKNKKKHHNNRRKEHVRSSSTSFFKNKWVVWSISLTVGAGMGYIISYCV 403

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 28 SILDPHHSVMELLQRQMEGSEVPSESGVLGESWQQI 63
          S+LDPH SV+E+L+R+ +   V   S  +  SWQ I
Sbjct: 37 SLLDPHLSVLEMLERK-DNDTVMEASSRISRSWQNI 71

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 97/197 (49%), Gaps = 16/197 (8%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS--DPSEFQNYIGIV 252
           FVMPKLSL  + SQ   +L+VG+ ++RF++DIPR Y + F +       P E   Y  ++
Sbjct: 189 FVMPKLSLIQQ-SQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVM 247

Query: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312
           ++F E KE   +L ++  +     II +CQ GQ+ ++ NIL  + K++ I L Y    ++
Sbjct: 248 VIFGEPKEGKELLEKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMS 305

Query: 313 NEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTNYS 372
           + + + +L ++    +N L  E D                              P    +
Sbjct: 306 DHQDVHRLLRY----LNTLSTEVD-------SGYETEVGSRKIRKRRKSSKKRSPQITVN 354

Query: 373 KWITWGISLTIGVSIGY 389
           +W+ W ISLT+GV +GY
Sbjct: 355 RWVIWSISLTVGVGLGY 371

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 22/70 (31%)

Query: 27  SSILDPHHSVMELLQRQMEGSEV-------------PSESGV------LGESWQQIRESD 67
           +SILDPH SV++LL R    SE+             P  SG       + ESWQ I+ +D
Sbjct: 38  NSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD 97

Query: 68  ---VGDGGDS 74
              V   GD+
Sbjct: 98  CSMVNTQGDA 107

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 107/207 (51%), Gaps = 16/207 (7%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHI--SQSSDPSEFQNYIGIV 252
           FVMPKLSL  +P +   +L+VG+ ++RF++DIPR Y++ F +  ++S    +   +  I+
Sbjct: 182 FVMPKLSLA-QPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQFSAIM 240

Query: 253 IVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIA 312
           ++F + K   ++L  +   +    II +CQ GQ+ ++ N+L  F K   + L Y    ++
Sbjct: 241 VIFTDPKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMS 298

Query: 313 NEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTNYS 372
           + + + +L ++   L N++++E D                             +     +
Sbjct: 299 DHQDVHRLLRYLYTLSNEIDSEYDTEVGPRKVRKRRKSYK-----------KRETPAAVN 347

Query: 373 KWITWGISLTIGVSIGYYATYMITTTL 399
           +W+ W ISLT+GV IGY  + ++++T+
Sbjct: 348 RWVIWSISLTVGVGIGYCISCLLSSTM 374

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 19/71 (26%)

Query: 16 KLASTSRNGPESSILDPHHSVMELLQR--------QMEGSEVPSESGV-----------L 56
          + +++ R    +SILDPH SV++LL+R        +   S++PS   +           +
Sbjct: 18 RFSTSERLNNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSI 77

Query: 57 GESWQQIRESD 67
           +SWQ IR +D
Sbjct: 78 SDSWQSIRHTD 88

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 105/208 (50%), Gaps = 18/208 (8%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS---DPSEFQNYIGI 251
            VMPKLSL+ +  ++K +L+VG+ +++F   IP+ Y++ F I   S   D    + Y  I
Sbjct: 173 LVMPKLSLSDRIIESK-VLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTI 231

Query: 252 VIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTI 311
           +++F ++     +L+RI     +  IIPICQ GQ+  + ++LK ++  + I L+  P+ +
Sbjct: 232 MVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVM 291

Query: 312 ANEKSMEKLFKHTVKLVNKLEN--EEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPST 369
           +N     +L KH  +L +  ++  E +V                            KPST
Sbjct: 292 SNHHEKHRLLKHLHQLSSGSDSGYETEVTVEPVK-----------KLPRKAKKRPSKPST 340

Query: 370 NYSKWITWGISLTIGVSIGYYATYMITT 397
            +  W+ W  S+TIG+ IG   + M++T
Sbjct: 341 -FRDWVVWTASITIGIGIGCCVSLMVST 367

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 36/79 (45%), Gaps = 26/79 (32%)

Query: 26  ESSILDPHHSVMELLQ---------------------RQMEGSEVPSESGVLGESWQQIR 64
           + SILDPH SV+E+L+                     +Q EG  V   S  + ESWQ I+
Sbjct: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHS--ISESWQSIK 81

Query: 65  ESD---VGDGGDSNFDQQS 80
            +D   +    D++  QQS
Sbjct: 82  STDYLFLSRANDTSLQQQS 100

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 96/210 (45%), Gaps = 15/210 (7%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEF---QNYIGI 251
            VMPKLSL+ +  + + LL+VG+ +++F   IP+ Y++ F +      + +   Q Y+ +
Sbjct: 166 LVMPKLSLSQRLGEPQ-LLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAV 224

Query: 252 VIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTI 311
           ++VF ++ +   +L+ + +      +IP+CQ GQ+  +  +LK +     I ++  P+ +
Sbjct: 225 MVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIM 284

Query: 312 ANEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTNY 371
           +N     +L KH   L N+ E+  +                            G  +  +
Sbjct: 285 SNHHEKHRLLKHLHNLCNESESGYETELTVKSKK---------QHRRPRKKDAGPVALRH 335

Query: 372 SKWITWGISLTIGVSIGYYATYMITTTLLY 401
             W  W  S TIG+ IG   + M TT   +
Sbjct: 336 --WAIWTASFTIGIGIGCCISLMATTRFTF 363

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 16/61 (26%)

Query: 23 NGPESSILDPHHSVMELLQRQ-MEGSEVPSESGVL---------------GESWQQIRES 66
          N     ILDPH SV+E+L RQ  +G+    E  V+                ESWQ I+ S
Sbjct: 25 NNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRS 84

Query: 67 D 67
          D
Sbjct: 85 D 85

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 96/206 (46%), Gaps = 18/206 (8%)

Query: 195 FVMPKLSLTYKPSQAKKLLVV-GRLSKRFHQDIPREYRQYFHISQSSDPS--EFQNYIGI 251
           FVMPKLSL+    + K L++  G  +  F+  + R +R  F + + ++ S  E   Y   
Sbjct: 226 FVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAF 285

Query: 252 VIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTI 311
           +I+F + K+   +LNR+ +      +IPICQ GQ+  V   +K+F  ++ I L   PV I
Sbjct: 286 MIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVI 345

Query: 312 ANEKSMEKLFKHTVKLVNKLENEEDVXXXXXXXXXXXXXXXGYXXXXXXXXHGGKPSTNY 371
           ++   +  L +H   L  +++++ +                             KP+ + 
Sbjct: 346 SDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKPRKGAKK--------------KPAPHL 391

Query: 372 SK-WITWGISLTIGVSIGYYATYMIT 396
           +K W  W IS+ +GV IG   T+  +
Sbjct: 392 AKRWWFWPISIALGVGIGCCVTFYFS 417

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
          (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 26 ESSILDPHHSVMELLQRQMEGSEVPSESGVLGESWQ 61
          E  +LDPH+SV++LL+        P++S  L ESWQ
Sbjct: 2  EKHLLDPHYSVLKLLENNFNN---PNDSMNLSESWQ 34

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 25/135 (18%)

Query: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQY------FHISQSSDPS----E 244
           FVMP+LS + K    K + VVG  +  F+Q    EY Q       F +  S+D S     
Sbjct: 120 FVMPRLSYSKKEGSLKAISVVGSHADSFYQ----EYLQVSTGEYCFMLDVSTDNSVSLLV 175

Query: 245 FQNYIGIVIVFQELKEFVA---MLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDA 301
            QN++ ++ + +  ++      +L+   +  D   II  C          +L S  +   
Sbjct: 176 VQNHLELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCNK--------VLSSMKERKW 227

Query: 302 ITLWYPPVTIANEKS 316
             L+YP + I +E++
Sbjct: 228 PMLYYPNLIIIHERA 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,448,752
Number of extensions: 1413665
Number of successful extensions: 4253
Number of sequences better than 10.0: 19
Number of HSP's gapped: 4320
Number of HSP's successfully gapped: 35
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)