Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0H03707g1.398ON34934913490.0
YNL007C (SIS1)1.398ON35235910961e-149
Suva_14.3411.398ON35935910831e-147
Smik_14.3211.398ON36636610801e-147
KNAG0H016801.398ON36336310151e-137
NCAS0G036101.398ON32734910051e-136
NDAI0C026101.398ON34035110061e-136
ZYRO0E04598g1.398ON35735710031e-135
AAL008W1.398ON3493539681e-130
Ecym_12921.398ON3473509641e-129
Kpol_457.151.398ON3573629501e-127
TDEL0B059601.398ON3691827672e-99
Skud_14.3201.398ON3681867672e-99
Kwal_0.2071.398ON3531817653e-99
KLTH0H12100g1.398ON3501787513e-97
SAKL0D08778g1.398ON3481827373e-95
TBLA0C014801.398ON3531827314e-94
KAFR0H031501.398ON3591857297e-94
TPHA0B037601.398ON3551817122e-91
NCAS0C048901.398ON3671846976e-89
KLLA0D04818g1.398ON3541826827e-87
NDAI0G042501.398ON3631756663e-84
TBLA0E038102.243ON410722716e-26
Kpol_1003.122.243ON408722707e-26
KLLA0F03333g2.243ON409722574e-24
TPHA0C031102.243ON407692565e-24
CAGL0J09966g2.243ON407722522e-23
SAKL0E08734g2.243ON411682461e-22
NCAS0G030002.243ON410682425e-22
KAFR0J009402.243ON411702401e-21
Smik_14.2632.243ON409722363e-21
ZYRO0A01496g2.243ON412722355e-21
Ecym_32812.243ON409682355e-21
ADL257C2.243ON410682355e-21
TDEL0C046002.243ON411692321e-20
Skud_14.2682.243ON410702311e-20
YNL064C (YDJ1)2.243ON409702302e-20
Suva_14.2772.243ON409702292e-20
NDAI0D010302.243ON411692284e-20
KNAG0I019002.243ON409722274e-20
Kwal_23.48302.243ON411682232e-19
KLTH0G09394g2.243ON411682187e-19
KLLA0E07899g2.218ON495712091e-17
TDEL0C043502.218ON462712038e-17
Ecym_53842.218ON503732031e-16
TPHA0L007907.157ON446732002e-16
TBLA0J018707.157ON470731985e-16
AGR084C8.264ON427681966e-16
CAGL0J10296g2.218ON479711967e-16
Kpol_1002.1222.218ON503711941e-15
NDAI0A028207.157ON482711932e-15
KLTH0G08756g2.218ON462711913e-15
KNAG0L013307.217ON396711904e-15
AER427W2.218ON470721904e-15
TDEL0H022907.217ON387711885e-15
KLTH0A03740g7.217ON395731886e-15
YNL077W (APJ1)2.218ON528711897e-15
Ecym_43727.217ON579721898e-15
KLTH0D12496g8.730ON375661869e-15
Smik_14.2492.218ON533711852e-14
Ecym_43068.264ON434681842e-14
KAFR0A041608.730ON378711833e-14
CAGL0J02750g7.217ON382711833e-14
NCAS0A132107.157ON414711833e-14
Kwal_47.181337.217ON393731833e-14
YER048C (CAJ1)7.217ON391731823e-14
Kwal_26.90248.730ON375731824e-14
Smik_5.1737.217ON391731824e-14
Skud_5.1587.217ON391731814e-14
Suva_14.2622.218ON536711834e-14
TBLA0E036602.218ON448711824e-14
NCAS0E029307.217ON387711815e-14
ZYRO0C15048g2.218ON491711816e-14
TPHA0C012607.217ON380711807e-14
ZYRO0C01606g8.264ON432681807e-14
Kwal_23.30612.218ON458661807e-14
Skud_14.2532.218ON532711817e-14
TDEL0B037908.730ON373641797e-14
Kpol_1064.408.730ON387641797e-14
SAKL0E09306g2.218ON461701808e-14
KAFR0L007407.217ON364711798e-14
AER346W8.730ON367661798e-14
SAKL0H16984g8.264ON435701808e-14
KNAG0M020202.218ON460671809e-14
SAKL0H05258g8.730ON368661789e-14
Smik_12.1498.264ON460691791e-13
NDAI0B020008.264ON433681791e-13
ZYRO0D16390g7.217ON398711781e-13
Kpol_1070.227.217ON380711771e-13
TBLA0D042407.217ON389711772e-13
YIR004W (DJP1)7.157ON432711772e-13
YLR090W (XDJ1)8.264ON459691772e-13
Suva_9.2137.157ON431711762e-13
Suva_10.1748.264ON456681762e-13
ADR015W7.157ON436731762e-13
Skud_9.1817.157ON421711763e-13
KLLA0F19184g8.264ON512671763e-13
Smik_9.2037.157ON432711753e-13
CAGL0L00957g7.217ON373731743e-13
TBLA0A011007.157ON434711744e-13
Suva_13.3978.730ON375661734e-13
SAKL0F04444g7.157ON429731744e-13
Suva_5.1507.217ON391731735e-13
NDAI0E045607.217ON394711735e-13
SAKL0F08052g7.217ON393711735e-13
Ecym_62368.730ON374661725e-13
NCAS0B005308.730ON375661726e-13
KLLA0E04423g7.217ON428731726e-13
Skud_12.1588.264ON455721736e-13
KAFR0B047807.157ON423711726e-13
TBLA0E024907.217ON366711727e-13
KNAG0G028808.730ON378661717e-13
CAGL0J01936g7.157ON425711728e-13
TPHA0C029802.218ON554711738e-13
KNAG0I007407.157ON425711719e-13
ZYRO0A06226g8.730ON377661701e-12
TDEL0H032107.157ON411731692e-12
KLLA0C07260g8.730ON368641682e-12
Kpol_499.307.157ON408731692e-12
TPHA0G006308.730ON393641692e-12
TDEL0F039108.264ON429701682e-12
CAGL0F03729g8.730ON361661673e-12
KAFR0C024507.217ON373731673e-12
Ecym_44697.157ON433711683e-12
Skud_13.3838.730ON375661673e-12
Kwal_56.237828.264ON414671673e-12
Smik_13.4228.730ON378661663e-12
YMR214W (SCJ1)8.730ON377661664e-12
NCAS0B050308.264ON433721664e-12
KLLA0D13464g7.157ON433741664e-12
KLTH0F13398g7.157ON419731655e-12
CAGL0H04499g2.350ON232651615e-12
KLTH0G13640g8.264ON414671647e-12
KLTH0F09944g2.350ON233641599e-12
ZYRO0G03850g7.157ON418731639e-12
KLLA0E01629g2.350ON231651599e-12
Ecym_56262.350ON243661599e-12
Kwal_55.209657.157ON421721631e-11
Smik_14.1062.15ON593641631e-11
SAKL0E06050g2.350ON232651571e-11
ZYRO0F15400g2.15ON525671621e-11
NCAS0D009602.350ON224651572e-11
YNL227C (JJJ1)2.15ON590671612e-11
Kpol_526.62.350ON228651562e-11
TDEL0G028002.350ON225651553e-11
Kwal_23.3578singletonOFF85631463e-11
KAFR0A079502.15ON551671594e-11
TBLA0G001702.15ON659671604e-11
NDAI0F038002.15ON638671594e-11
AFL190C2.350ON235671545e-11
CAGL0G07469g8.698ON668701595e-11
TPHA0C045902.350ON233651535e-11
SAKL0E14234g2.15ON678671577e-11
Suva_14.1162.15ON600671577e-11
ABL194C2.15ON552671577e-11
ZYRO0A07502g2.350ON238661528e-11
NDAI0H031802.350ON229651518e-11
TDEL0E005002.15ON581671569e-11
NDAI0F024502.218ON530671551e-10
CAGL0J07370g2.15ON623671542e-10
Skud_13.3232.350ON224651492e-10
NCAS0G013602.15ON616671542e-10
KAFR0B048902.350ON220651492e-10
Kpol_529.212.15ON622671542e-10
TBLA0B093802.350ON227651482e-10
KLTH0B08338g2.15ON590671523e-10
Kwal_23.44202.15ON592671523e-10
YMR161W (HLJ1)2.350ON224651464e-10
KNAG0I008602.350ON219671464e-10
Skud_14.1102.15ON596641514e-10
NDAI0E008708.730ON376661504e-10
KNAG0F008602.15ON626671497e-10
ADL111W7.217ON578721489e-10
TPHA0O019402.15ON598671481e-09
KLLA0D19602g2.15ON620671481e-09
Smik_13.3612.350ON224651421e-09
Kpol_543.408.264ON414651452e-09
KNAG0G011308.61ON500611443e-09
Suva_13.3402.350ON225661394e-09
Kpol_1072.48.698ON661701434e-09
TBLA0B037308.698ON693701434e-09
TPHA0A017908.264ON439701415e-09
CAGL0L12276g8.264ON452701407e-09
KAFR0H023108.698ON655701401e-08
NCAS0C012208.698ON669701382e-08
TPHA0G014808.698ON660701382e-08
AFR507W8.61ON474621372e-08
Smik_10.1681.297ON649661363e-08
TPHA0D005508.61ON486631353e-08
SAKL0C02904g1.92ON281731334e-08
TDEL0A064308.698ON666701354e-08
AFR639W1.113ON156591275e-08
ZYRO0D10934g8.698ON663701337e-08
YJL073W (JEM1)1.297ON645661338e-08
TBLA0B034908.730ON384651318e-08
KNAG0G020508.264ON432561319e-08
KNAG0A056502.350ON175631261e-07
TBLA0A055601.92ON312701301e-07
KNAG0J018408.698ON650701321e-07
TPHA0A028101.185ON492661292e-07
NDAI0B002001.185ON594671292e-07
TDEL0C036801.185ON556681292e-07
Ecym_10971.92ON270701262e-07
ZYRO0G18436g1.185ON503651292e-07
KLLA0C09823g8.698ON669701292e-07
Smik_15.4378.698ON663761292e-07
KAFR0G009101.113ON163651222e-07
Ecym_23748.698ON661701283e-07
Suva_12.1851.113ON168691214e-07
NCAS0I028301.185ON491641274e-07
Kwal_33.135331.113ON161691204e-07
Suva_8.3038.698ON664701274e-07
Skud_10.1691.297ON644661274e-07
YOR254C (SEC63)8.698ON663761274e-07
CAGL0H02827g1.297ON656671266e-07
KLTH0G18546gna 1ON283651236e-07
Skud_15.4208.698ON665761257e-07
TPHA0A056505.4ON433771247e-07
Kwal_33.138601.185ON578671257e-07
Suva_6.1481.297ON642661249e-07
KLTH0F04906g1.185ON590671241e-06
KLTH0D11770g8.698ON652701241e-06
Kwal_26.88798.698ON656701231e-06
KNAG0B018901.92ON370721221e-06
KLTH0H10032g1.297ON607661221e-06
KLTH0F02596g1.92ON282741202e-06
SAKL0D06226g1.297ON615661222e-06
TBLA0D026008.61ON5101341212e-06
ADR124C1.297ON611661212e-06
Kpol_1027.131.297ON641661212e-06
KAFR0F018101.185ON555631203e-06
Smik_10.3851.113ON172691143e-06
KLLA0D06402g1.297ON631661194e-06
Kwal_14.24521.297ON607661194e-06
KAFR0A016201.297ON665661194e-06
Kpol_2000.561.92ON290651164e-06
SAKL0C03476g1.113ON165661125e-06
NCAS0G028502.218ON494721176e-06
SAKL0H05984g8.698ON658701178e-06
KAFR0A015301.92ON277481148e-06
KNAG0C024501.185ON544671169e-06
TBLA0J009701.185ON586701161e-05
AFR659W1.92ON273711131e-05
NDAI0D005001.113ON190751111e-05
KNAG0B052401.297ON668661151e-05
Kwal_47.179578.61ON478631141e-05
ZYRO0G21230g1.297ON584661141e-05
TBLA0C071605.4ON430771141e-05
NDAI0C002001.92ON276721121e-05
TBLA0C027201.297ON715661142e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H03707g
         (349 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...   524   0.0  
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...   426   e-149
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...   421   e-147
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...   420   e-147
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...   395   e-137
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398     391   e-136
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}              392   e-136
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...   390   e-135
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...   377   e-130
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...   375   e-129
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...   370   e-127
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...   300   2e-99
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...   300   2e-99
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...   299   3e-99
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...   293   3e-97
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...   288   3e-95
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...   286   4e-94
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...   285   7e-94
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...   278   2e-91
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398    273   6e-89
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...   267   7e-87
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...   261   3e-84
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   108   6e-26
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   108   7e-26
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   103   4e-24
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   103   5e-24
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   101   2e-23
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    99   1e-22
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    98   5e-22
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    97   1e-21
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    96   3e-21
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    95   5e-21
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...    95   5e-21
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...    95   5e-21
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    94   1e-20
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...    94   1e-20
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    93   2e-20
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    93   2e-20
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...    92   4e-20
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    92   4e-20
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    91   2e-19
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    89   7e-19
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    85   1e-17
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    83   8e-17
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    83   1e-16
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    82   2e-16
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    81   5e-16
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...    80   6e-16
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    80   7e-16
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    79   1e-15
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    79   2e-15
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    78   3e-15
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    78   4e-15
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    78   4e-15
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    77   5e-15
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    77   6e-15
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    77   7e-15
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    77   8e-15
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    76   9e-15
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    76   2e-14
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...    75   2e-14
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    75   3e-14
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    75   3e-14
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    75   3e-14
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    75   3e-14
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    75   3e-14
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    75   4e-14
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    75   4e-14
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    74   4e-14
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    75   4e-14
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    75   4e-14
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     74   5e-14
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    74   6e-14
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    74   7e-14
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...    74   7e-14
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    74   7e-14
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    74   7e-14
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    74   7e-14
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    74   7e-14
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    74   8e-14
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    74   8e-14
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    74   8e-14
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...    74   8e-14
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    74   9e-14
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    73   9e-14
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...    74   1e-13
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264     74   1e-13
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    73   1e-13
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    73   1e-13
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    73   2e-13
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    73   2e-13
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...    73   2e-13
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    72   2e-13
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...    72   2e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    72   2e-13
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    72   3e-13
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...    72   3e-13
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    72   3e-13
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    72   3e-13
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    72   4e-13
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    71   4e-13
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    72   4e-13
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    71   5e-13
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             71   5e-13
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    71   5e-13
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    71   5e-13
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       71   6e-13
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    71   6e-13
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...    71   6e-13
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               71   6e-13
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    71   7e-13
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    70   7e-13
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    71   8e-13
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    71   8e-13
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    70   9e-13
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    70   1e-12
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    70   2e-12
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    69   2e-12
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    70   2e-12
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    70   2e-12
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...    69   2e-12
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    69   3e-12
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    69   3e-12
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    69   3e-12
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    69   3e-12
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...    69   3e-12
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    69   3e-12
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    69   4e-12
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264     69   4e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    69   4e-12
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    68   5e-12
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    67   5e-12
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...    68   7e-12
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    66   9e-12
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    67   9e-12
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    66   9e-12
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    66   9e-12
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    67   1e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    67   1e-11
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    65   1e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    67   1e-11
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    65   2e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    67   2e-11
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    65   2e-11
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    64   3e-11
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    61   3e-11
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    66   4e-11
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    66   4e-11
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      66   4e-11
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    64   5e-11
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    66   5e-11
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    64   5e-11
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    65   7e-11
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    65   7e-11
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    65   7e-11
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    63   8e-11
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      63   8e-11
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    65   9e-11
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    64   1e-10
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    64   2e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    62   2e-10
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    64   2e-10
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    62   2e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    64   2e-10
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    62   2e-10
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    63   3e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    63   3e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    61   4e-10
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    61   4e-10
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    63   4e-10
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    62   4e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    62   7e-10
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    62   9e-10
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    62   1e-09
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    62   1e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   1e-09
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...    60   2e-09
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    60   3e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    58   4e-09
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    60   4e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    60   4e-09
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...    59   5e-09
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...    59   7e-09
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    59   1e-08
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     58   2e-08
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    58   2e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    57   2e-08
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    57   3e-08
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    57   3e-08
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    56   4e-08
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    57   4e-08
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    54   5e-08
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    56   7e-08
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    56   8e-08
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    55   8e-08
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...    55   9e-08
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    53   1e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    55   1e-07
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    55   1e-07
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    54   2e-07
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       54   2e-07
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    54   2e-07
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    53   2e-07
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    54   2e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    54   2e-07
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    54   2e-07
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    52   2e-07
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    54   3e-07
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    51   4e-07
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    54   4e-07
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    51   4e-07
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    54   4e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    54   4e-07
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    54   4e-07
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    53   6e-07
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    52   6e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    53   7e-07
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    52   7e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    53   7e-07
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    52   9e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    52   1e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    52   1e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    52   1e-06
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    52   1e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    52   1e-06
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    51   2e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    52   2e-06
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    51   2e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    51   2e-06
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    51   2e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    51   3e-06
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    49   3e-06
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    50   4e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    50   4e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    50   4e-06
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    49   4e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    48   5e-06
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     50   6e-06
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    50   8e-06
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    49   8e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    49   9e-06
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    49   1e-05
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    48   1e-05
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    47   1e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    49   1e-05
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    49   1e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    49   1e-05
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    49   1e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         48   1e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    49   2e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    46   2e-05
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    48   2e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    48   2e-05
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    47   2e-05
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    48   2e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    48   2e-05
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    48   2e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    48   2e-05
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    47   3e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    47   3e-05
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    47   4e-05
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    47   4e-05
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    47   4e-05
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    47   4e-05
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    47   4e-05
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    47   4e-05
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    47   4e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    47   5e-05
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    47   5e-05
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    47   6e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    47   6e-05
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    47   6e-05
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    46   6e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    46   7e-05
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    46   8e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    44   8e-05
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    44   8e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    46   8e-05
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    46   9e-05
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    46   9e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    45   9e-05
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    46   1e-04
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    44   1e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    45   1e-04
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    45   1e-04
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    45   1e-04
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    45   1e-04
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    45   1e-04
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    45   2e-04
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    45   2e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   2e-04
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    45   2e-04
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    45   2e-04
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    45   2e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    44   2e-04
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    45   2e-04
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    45   2e-04
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    45   2e-04
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    45   2e-04
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    45   3e-04
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    43   3e-04
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    44   3e-04
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    44   3e-04
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    44   3e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    44   3e-04
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    42   4e-04
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    44   5e-04
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    44   5e-04
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    44   5e-04
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    43   5e-04
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    43   5e-04
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    42   6e-04
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    43   7e-04
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    43   8e-04
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    42   8e-04
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    42   0.001
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    41   0.001
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    43   0.001
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    42   0.001
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    42   0.001
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    42   0.001
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    42   0.001
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    42   0.001
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    42   0.002
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    42   0.002
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    42   0.002
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    42   0.002
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    40   0.004
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    40   0.005
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    40   0.005
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    40   0.005
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    40   0.008
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    39   0.008
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    39   0.009
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    38   0.009
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    38   0.010
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    39   0.013
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    38   0.016
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    39   0.017
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    38   0.020
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    38   0.023
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    38   0.024
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    38   0.025
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    38   0.026
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    37   0.040
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    37   0.060
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.073
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    36   0.075
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    36   0.087
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    35   0.21 
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    34   0.24 
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    35   0.25 
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    34   0.26 
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    35   0.28 
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    34   0.29 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    35   0.29 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    33   0.73 
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    33   0.77 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    33   0.82 
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    33   0.83 
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    33   0.91 
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    33   0.92 
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    32   2.4  
ZYRO0C03454g Chr3 (274135..274572) [438 bp, 145 aa] {ON} similar...    30   3.2  
KLTH0E05522g Chr5 (488343..488969) [627 bp, 208 aa] {ON} conserv...    30   8.1  

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P25294 Saccharomyces
           cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/349 (77%), Positives = 272/349 (77%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK
Sbjct: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXXXXA 120
           REVYDQYGLE                              NDDAFNI            A
Sbjct: 61  REVYDQYGLEAARNGGPAFGGAGGFRGGGFSSAGGAHAFSNDDAFNIFSQFFGGSSPFGA 120

Query: 121 ADDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSPQPEEEVVP 180
           ADDGFSYSSF                                   FRSASSPQPEEEVVP
Sbjct: 121 ADDGFSYSSFGGMPGGMGGMHGGMGGGMHGGMGGGMGGMGGMPGGFRSASSPQPEEEVVP 180

Query: 181 VNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPAT 240
           VNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPAT
Sbjct: 181 VNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPAT 240

Query: 241 GRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPI 300
           GRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPI
Sbjct: 241 GRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPI 300

Query: 301 QPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           QPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF
Sbjct: 301 QPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
           SIS1Type II HSP40 co-chaperone that interacts with the
           HSP70 protein Ssa1p; not functionally redundant with
           Ydj1p due to due to substrate specificity; shares
           similarity with bacterial DnaJ proteins
          Length = 352

 Score =  426 bits (1096), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 228/359 (63%), Positives = 251/359 (69%), Gaps = 17/359 (4%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SPSANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DPQK
Sbjct: 1   MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXXNDDAFNIXXXXXX 113
           RE+YDQYGLE                                     N+DAFNI      
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG 120

Query: 114 XXXXXXAADD-GFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSP 172
                  ADD GFS+SS+                                   FRSASS 
Sbjct: 121 GSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGG-------FRSASSS 173

Query: 173 --QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITY 230
              PEEE V VNL VSLEDL+ GKKK+F IGRKGP+GA EKTQ+DIQLKPGWKAGTKITY
Sbjct: 174 PTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITY 233

Query: 231 KNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGR 290
           KN GDYNP TGRRKTLQF+IQEK HP F RDG+DLIYTLPL+FKESLLGF+KTIQTIDGR
Sbjct: 234 KNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGR 293

Query: 291 TLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           TLP+SR+QP+QPS+ STYPGQGMP PK P QRG++IV YKVDYPISL D Q++AIDENF
Sbjct: 294 TLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 352

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {ON}
           YNL007C (REAL)
          Length = 359

 Score =  421 bits (1083), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/359 (61%), Positives = 248/359 (69%), Gaps = 10/359 (2%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYD+LG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DPQK
Sbjct: 1   MVKETKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXXNDDAFNIXXXXXX 113
           RE+YDQYG+E                                     N+DAFNI      
Sbjct: 61  REIYDQYGIEAARSGGPSFGAGGAGGPGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG 120

Query: 114 XXXXXXAADDG-FSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSP 172
                  ADDG FS+S +                                   FRSASS 
Sbjct: 121 GSSSFGGADDGGFSFSGYPSGGGASMGGMPGGMGGMPGGMGGMPGGMGGMPGGFRSASSS 180

Query: 173 --QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITY 230
              PEEE V VNL VSLEDL+ GKKK+F IGRKGP+G  EKTQ+DIQLKPGWKAGTKITY
Sbjct: 181 PSYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGTSEKTQIDIQLKPGWKAGTKITY 240

Query: 231 KNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGR 290
           KN GD+NP T RRKTLQF+IQEK HP F RDG+DLIYTLPL+FKESLLGF+KTIQTIDGR
Sbjct: 241 KNQGDFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGR 300

Query: 291 TLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           TLP+SR+QP+QPS+ STYPGQGMP PK P QRG++IV YKVDYPISL D Q++AIDENF
Sbjct: 301 TLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 359

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {ON}
           YNL007C (REAL)
          Length = 366

 Score =  420 bits (1080), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/366 (61%), Positives = 250/366 (68%), Gaps = 17/366 (4%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D QK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXXNDDAFNIXXXXXX 113
           RE+YDQYGLE                                     N+DAFNI      
Sbjct: 61  REIYDQYGLEAARSGGPSFGAGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG 120

Query: 114 XXXXXXAADD-GFSYSSF-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 165
                  ADD GFS+SS+                                          
Sbjct: 121 GSSPFGGADDSGFSFSSYPSGGGASMGGMPGGMGGMPGGMGGMPGGMGGMHGGMGGMPGG 180

Query: 166 FRSASSP--QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWK 223
           FRSASS    PEEE V VNL VSLEDL+ GKKK+F IGRKGP+GA EKTQ+DIQLKPGWK
Sbjct: 181 FRSASSSPTYPEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWK 240

Query: 224 AGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKT 283
           AGTKITYKN GDYNP TGRRKTLQF+IQEK HP F RDG+DLIYTLPL+FKESLLGF+KT
Sbjct: 241 AGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKT 300

Query: 284 IQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQ 343
           IQTIDGRTLP+SR+QP+QPS+ STYPGQGMP PK P QRG++IV YKVDYPISL D Q++
Sbjct: 301 IQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKR 360

Query: 344 AIDENF 349
           AIDENF
Sbjct: 361 AIDENF 366

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {ON}
           Anc_1.398 YNL007C
          Length = 363

 Score =  395 bits (1015), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 211/363 (58%), Positives = 242/363 (66%), Gaps = 14/363 (3%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SP+ANEQE+KKGYRK+ALKYHPDKPTGDTEKFKEISEAFEIL+D QK
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTEKFKEISEAFEILNDKQK 60

Query: 61  REVYDQYGLEXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXXXX 119
           RE+YDQYGLE                               N+DAFNI            
Sbjct: 61  REIYDQYGLEAARQGGPSFGAGGPGAGGAPGGGAGFAHSFSNEDAFNIFSQFFGGGAGGG 120

Query: 120 AA----DDGFSYSSFXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXXXXXXXFR 167
           A+    D G+S+ SF                                           FR
Sbjct: 121 ASPFGDDGGYSFQSFPSGGAGTSSYSSFGGMPGGMGGGMPGGMPGGMPGGMGGGMPGGFR 180

Query: 168 SAS-SPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGT 226
           S S SP P+EEVV V+L VSLEDL+ GKKK+F +GRKGP GA EK Q+DIQLK GWKAGT
Sbjct: 181 STSASPPPQEEVVQVHLPVSLEDLFEGKKKSFKVGRKGPGGAQEKVQIDIQLKAGWKAGT 240

Query: 227 KITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQT 286
           K+TYKN+GDYNP TG RKTLQF+IQEK HP + R+G+DL YTLPLTFKESLLGF+KTIQT
Sbjct: 241 KVTYKNHGDYNPRTGGRKTLQFVIQEKTHPLYKRNGDDLEYTLPLTFKESLLGFSKTIQT 300

Query: 287 IDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAID 346
           IDGRTLP+SR  P+QP+E S YPGQGMP+PK P QRGD++V +K+DYPISL D QRQAI 
Sbjct: 301 IDGRTLPLSRSSPVQPTETSRYPGQGMPMPKMPSQRGDLVVRFKIDYPISLNDAQRQAIA 360

Query: 347 ENF 349
            NF
Sbjct: 361 ANF 363

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score =  391 bits (1005), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 209/349 (59%), Positives = 235/349 (67%), Gaps = 22/349 (6%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DP  
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNT 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXXXXA 120
           REVYDQYGLE                              NDDAFN+            A
Sbjct: 61  REVYDQYGLEAARSGGPSFGGAGAGGFPGGAGGFSGHQFSNDDAFNMFSQFFGGS----A 116

Query: 121 ADDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSPQPEEEVVP 180
             D FS   F                                    RSA+    EEEVVP
Sbjct: 117 GGDPFSGGGFHGMGGMPGGMHGGMPGGF------------------RSAAPQYEEEEVVP 158

Query: 181 VNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPAT 240
           VNL VSLEDL+ GKKK+F IGRKGP G+ EKTQ+DIQL+PGWKAGTK+TYKN GDYNP +
Sbjct: 159 VNLPVSLEDLFIGKKKSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRS 218

Query: 241 GRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPI 300
           G RKTLQF+IQEK HP F RDG+DLIY L L+FKESLLGF+KTI TIDGR LP+SR QPI
Sbjct: 219 GGRKTLQFVIQEKAHPDFKRDGDDLIYILRLSFKESLLGFSKTINTIDGRKLPLSRSQPI 278

Query: 301 QPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           QP+E STYPGQGMP+ K P QRG++I+ YK+DYPISL D QR AI++NF
Sbjct: 279 QPTEISTYPGQGMPVSKNPSQRGNLIIKYKIDYPISLNDNQRIAIEQNF 327

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score =  392 bits (1006), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 207/351 (58%), Positives = 239/351 (68%), Gaps = 13/351 (3%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SPSAN+QEIKKGYRKAAL+YHPDKPTG+TEKFK+ISEA+EILSD  K
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEKFKQISEAYEILSDSNK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXXXXA 120
           REVYDQYGLE                              NDDAFNI            +
Sbjct: 61  REVYDQYGLEAARSGGPSFGGAGGAGGFPGGAHSFS----NDDAFNIFSQFF-------S 109

Query: 121 ADDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSA--SSPQPEEEV 178
             D F   S                                    FRSA  +S +PEEEV
Sbjct: 110 GGDPFGGHSAGGFGGMPGGMGGMGGMPGGMGGMPSMGGMGGMPGGFRSATGASQRPEEEV 169

Query: 179 VPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNP 238
           V VNL VSLEDL+TGKKK+F IGRKGP G+ EK Q+DIQLK GWKAGTKITYKN GD+NP
Sbjct: 170 VTVNLPVSLEDLFTGKKKSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNP 229

Query: 239 ATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQ 298
            TG RKTLQF++QEK HP F RDG +L+YT+PL+F+ESLLGF+KT+QTIDGR+L +SR Q
Sbjct: 230 RTGGRKTLQFVLQEKAHPLFKRDGENLLYTVPLSFQESLLGFSKTVQTIDGRSLSLSRTQ 289

Query: 299 PIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           PIQP+E +TYPGQGMP PK P QRGD+I+ YK+DYPISL+D QRQAI +NF
Sbjct: 290 PIQPTETTTYPGQGMPNPKNPNQRGDLIITYKIDYPISLSDAQRQAIQQNF 340

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {ON}
           some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 357

 Score =  390 bits (1003), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/357 (58%), Positives = 245/357 (68%), Gaps = 8/357 (2%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYD+LG+SPSANEQE+KKGY+KAALKYHPDKP GDTEKFKEISEA+EILSD  K
Sbjct: 1   MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEKFKEISEAYEILSDSSK 60

Query: 61  REVYDQYGLEXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXX 117
           RE+YDQYGLE                                 N+DAFNI          
Sbjct: 61  REIYDQYGLEAARNGGPAFGGASPGAGGFPAGGAGGFSSHAFSNEDAFNIFSQFFGGSSP 120

Query: 118 XXAA---DDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASS--P 172
             A+   DDGF +S F                                   FRS S+  P
Sbjct: 121 FGASSGMDDGFGFSGFPGGGSTRFASSNGFGGGGGMPGGMPGGMPGGMPGGFRSGSASPP 180

Query: 173 QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKN 232
             EEE+VPVNL VSLEDL+ G+KK+F IGRK   G+ EKTQ+DIQLKPGWKAGTKITYKN
Sbjct: 181 SAEEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFEKTQIDIQLKPGWKAGTKITYKN 240

Query: 233 YGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTL 292
            GDYNP TG RKTLQF++QEK HP + RDG++LIY+LPL+FKESLLGF+KTIQTIDGRTL
Sbjct: 241 EGDYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYSLPLSFKESLLGFSKTIQTIDGRTL 300

Query: 293 PVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           P+S+IQP+QP+E S+YPGQGMP+ K PGQRGD++V YK+DYP+SLT+ Q++AI ENF
Sbjct: 301 PISKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKIDYPLSLTEDQKRAIAENF 357

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score =  377 bits (968), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/353 (56%), Positives = 232/353 (65%), Gaps = 8/353 (2%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SPSA++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDP K
Sbjct: 1   MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN----DDAFNIXXXXXXXXX 116
           REVYD YGLE                              +    +DAFNI         
Sbjct: 61  REVYDTYGLEAARGNAPSGFGGAGPGGAGFGGFSTGGGGRHAFSQEDAFNI--FSQFFGN 118

Query: 117 XXXAADDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSPQPEE 176
               A   F +SS                                      S S  QPEE
Sbjct: 119 SAGGASSPFGFSSAGGDEFGFGGFPGGAGLHTSSGGMPGGFGGMPGSSGMHSHS--QPEE 176

Query: 177 EVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDY 236
           ++V VNL VSLEDL+ GK+K+F I RKG  G PEK Q+DIQL+PGWKAGTKITYKN GDY
Sbjct: 177 KLVQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDY 236

Query: 237 NPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSR 296
           NP+TG R+T+QFIIQEK H FF RDGNDLIYTLPLTFKESLLGF+KT++TIDGR + + +
Sbjct: 237 NPSTGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFDKTVRTIDGRQISIHK 296

Query: 297 IQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
            QP+QPSE+  YPGQGMP+ K P +RGD+IV YK DYPI+LT+KQR+AI ENF
Sbjct: 297 TQPVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYPITLTEKQRRAILENF 349

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
           similar to Ashbya gossypii AAL008W
          Length = 347

 Score =  375 bits (964), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 231/350 (66%), Gaps = 4/350 (1%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKETKLYDLLG+SP+ N+ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DP K
Sbjct: 1   MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN-DDAFNIXXXXXXXXXXXX 119
           REVYD+YGLE                              + +DAFNI            
Sbjct: 61  REVYDKYGLEAARGNGPAGFGGQAGAGGGFSGFGGGGHAFSQEDAFNIFSQFFGNSAGGA 120

Query: 120 AADDGFSYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFRSASSPQPEEEVV 179
           +    F +SS                                      S S  Q EE+VV
Sbjct: 121 SP---FGFSSGGDEFGFGGGFPGGASFHSTSTGMPGGFSGMPGASGMHSHSHAQQEEKVV 177

Query: 180 PVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPA 239
            VNL VSLEDLY GK+K+F I RKGP+G PEK Q+DIQL+PGWKAGTKITYKN GDYNP+
Sbjct: 178 QVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPS 237

Query: 240 TGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQP 299
           TG R+TLQFIIQEK H F  RDGNDL YTLPL+FKESLLGF+KT+ TIDGR + +S+ QP
Sbjct: 238 TGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIFISKTQP 297

Query: 300 IQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           +QPSE+S YPGQGMP+ K P +RGD+IV YK+DYPI+L+++Q+ AI  NF
Sbjct: 298 VQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
           (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score =  370 bits (950), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/362 (56%), Positives = 233/362 (64%), Gaps = 18/362 (4%)

Query: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
           MVKET LYDLL +SP+ANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD +K
Sbjct: 1   MVKETGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAEK 60

Query: 61  REVYDQYGLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDAFNIXXXXXXXXXXXXA 120
           REVYDQYGL+                              NDDAFNI             
Sbjct: 61  REVYDQYGLKAARGEAPQFANGGAGGFPGGGAHTFT----NDDAFNIFSQFFGGNAGGQN 116

Query: 121 ADDGF-------------SYSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFR 167
           A+  F             S SS+                                     
Sbjct: 117 ANFNFGGMPSGMGGMPRSSRSSYTNFGGMGGMPGGMPGGMPGGMGGGMGGMGGMPGGFGG 176

Query: 168 SASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTK 227
           S    QPEE VV V+L VSLEDL+ GKKKTF IGRKGPNG  EK Q++I LK GWKAGTK
Sbjct: 177 SPRESQPEE-VVQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTK 235

Query: 228 ITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTI 287
           ITYKN GDYNP+TG RKTLQFI++EK +  F RD ++LIYTLPLTFKESLLGF KTI+TI
Sbjct: 236 ITYKNQGDYNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTLPLTFKESLLGFQKTIKTI 295

Query: 288 DGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           DG+TLP+SR+QP+QPSE +TYPGQGMPI K+ GQRGDMIV +KV YP SLT+ Q++ I+E
Sbjct: 296 DGKTLPISRVQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPTSLTEDQKRVINE 355

Query: 348 NF 349
           NF
Sbjct: 356 NF 357

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
           {ON} Anc_1.398 YNL007C
          Length = 369

 Score =  300 bits (767), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 143/182 (78%), Positives = 157/182 (86%)

Query: 168 SASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTK 227
           SAS  Q EEEVV VNL VSLEDL  GKKK+F IGRKGPNG  EKTQ+DIQLK GWKAGTK
Sbjct: 188 SASPSQVEEEVVSVNLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTK 247

Query: 228 ITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTI 287
           ITYKN GDYNP TG RKTLQF++QEK HP F RDG++LIYTLPL+FKESLLGF+KTIQTI
Sbjct: 248 ITYKNEGDYNPRTGGRKTLQFVLQEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTIQTI 307

Query: 288 DGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           DGRTLP+SR+QPIQPSE S YPGQGMPI K PGQRGD+IV YK+DYPISL D Q+ AID+
Sbjct: 308 DGRTLPISRVQPIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYPISLNDAQKHAIDQ 367

Query: 348 NF 349
           NF
Sbjct: 368 NF 369

 Score =  136 bits (343), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (98%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D QK
Sbjct: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61 REVYDQYGLE 70
          RE+YDQYGLE
Sbjct: 61 REIYDQYGLE 70

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {ON}
           YNL007C (REAL)
          Length = 368

 Score =  300 bits (767), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 162/186 (87%), Gaps = 2/186 (1%)

Query: 166 FRSASSP--QPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWK 223
           FRSASS     EEE V VNL VSLEDL+ GKKK+F IGRKGP+GA EKTQ+DIQLKPGWK
Sbjct: 183 FRSASSSPTYAEEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWK 242

Query: 224 AGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKT 283
           AGTKITYKN GD+N  TGRRKTLQF+IQEK HP F RDG+DLIYTLPL+FKESLLGF+KT
Sbjct: 243 AGTKITYKNQGDFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKT 302

Query: 284 IQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQ 343
           IQTIDGRTLP+SR+QP+QPS+ STYPGQGMP PK P QRG++IV YKVDYPISL + Q++
Sbjct: 303 IQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKR 362

Query: 344 AIDENF 349
           AIDENF
Sbjct: 363 AIDENF 368

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 69/70 (98%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG+SP+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D QK
Sbjct: 1  MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60

Query: 61 REVYDQYGLE 70
          RE+YDQYGLE
Sbjct: 61 REIYDQYGLE 70

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
           YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
           82] FULL
          Length = 353

 Score =  299 bits (765), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 161/181 (88%)

Query: 169 ASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKI 228
           ASSP PEE+VV VNL VSLEDL++GKKK+F I RKGP GA EK QVDIQLKPGWKAGTKI
Sbjct: 173 ASSPPPEEKVVQVNLPVSLEDLFSGKKKSFKITRKGPGGASEKQQVDIQLKPGWKAGTKI 232

Query: 229 TYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTID 288
           TYKN GDYNP TGRR+TLQFI+QEK H  +TRDGNDLIY+LPLTFKESLLGF+KTIQTID
Sbjct: 233 TYKNEGDYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYSLPLTFKESLLGFSKTIQTID 292

Query: 289 GRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDEN 348
           GRTLP+SR+QP+QPS+ STYPGQGMPI KTP QRG++IV YK+DYP++L D QR+AI EN
Sbjct: 293 GRTLPISRVQPVQPSDSSTYPGQGMPIAKTPSQRGNLIVKYKIDYPVTLNDSQRRAILEN 352

Query: 349 F 349
           F
Sbjct: 353 F 353

 Score =  129 bits (325), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVK+TKLYDLLG+SPSA E E+KKGYRKAALKYHPDKP+GD EKFKEISEAFEIL+DPQK
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQK 60

Query: 61 REVYDQYGLE 70
          REVYD YGLE
Sbjct: 61 REVYDTYGLE 70

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 350

 Score =  293 bits (751), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 138/178 (77%), Positives = 156/178 (87%)

Query: 172 PQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYK 231
           P PEE+ V VNL VSLEDL++GKKK+F I RKGP GAPEK QVDIQL+PGWKAGTKITYK
Sbjct: 173 PLPEEKTVQVNLPVSLEDLFSGKKKSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYK 232

Query: 232 NYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRT 291
           N GDYNP TGRR+T+QFIIQEK H  +TRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRT
Sbjct: 233 NEGDYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRT 292

Query: 292 LPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           LP+SR+QP+QPS+ STYPGQGMP+ K P QRG++IV YK+DYP +L D QR+AI ENF
Sbjct: 293 LPISRVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYPATLNDSQRRAISENF 350

 Score =  130 bits (327), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVK+TKLYDLLG+SPSA E E+KKGYRKAALKYHPDKPTGD EKFKEISEAFEIL+DPQK
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEKFKEISEAFEILNDPQK 60

Query: 61 REVYDQYGLE 70
          RE+YD YGLE
Sbjct: 61 REIYDNYGLE 70

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
           to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score =  288 bits (737), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 134/182 (73%), Positives = 156/182 (85%)

Query: 168 SASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTK 227
           S ++PQ EEE V VNL VSLEDL+ G+KK+F I RKGP   PEK Q+DIQ+KPGWKAGTK
Sbjct: 167 SRAAPQREEETVQVNLPVSLEDLFAGRKKSFKITRKGPGSVPEKKQIDIQMKPGWKAGTK 226

Query: 228 ITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTI 287
           IT+KN GDYN  TG R+T+QF+IQEK HP F RDGN+LIYTLPL+FKESLLGF+KTIQTI
Sbjct: 227 ITFKNEGDYNQQTGGRQTMQFVIQEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTIQTI 286

Query: 288 DGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           DGRTLP+SR+QPIQPSE STYPGQGMP+PKTP QRGD+I+ YKVDYPI L + Q++AI E
Sbjct: 287 DGRTLPISRVQPIQPSETSTYPGQGMPLPKTPAQRGDLIIKYKVDYPIGLNEAQKRAIAE 346

Query: 348 NF 349
           NF
Sbjct: 347 NF 348

 Score =  132 bits (331), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 62/70 (88%), Positives = 68/70 (97%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVK+TKLYDLLG+SPSA+E E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DPQK
Sbjct: 1  MVKDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61 REVYDQYGLE 70
          RE+YD YGLE
Sbjct: 61 REIYDSYGLE 70

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score =  286 bits (731), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 132/182 (72%), Positives = 162/182 (89%), Gaps = 1/182 (0%)

Query: 168 SASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTK 227
           S++SP  EEEVV V++ VSLEDL+TGKKK+F IGRKG  G PEK Q+DI LKPGWK GTK
Sbjct: 173 SSASPH-EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTK 231

Query: 228 ITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTI 287
           +TYKN+GDYNP+TG RKTLQFII+EKKHP + RDG+++IYTLPLTFKESLLGF+KT+QT+
Sbjct: 232 LTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTL 291

Query: 288 DGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           DGRTLP+SR QP+QP+E++TYPGQGMPI K PGQRG++I+ YK++YPISLTD QR+AI +
Sbjct: 292 DGRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIAD 351

Query: 348 NF 349
           NF
Sbjct: 352 NF 353

 Score =  126 bits (317), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (92%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG+S SA++ EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD  K
Sbjct: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60

Query: 61 REVYDQYGLE 70
          R VYDQYGL+
Sbjct: 61 RSVYDQYGLD 70

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.398
           YNL007C
          Length = 359

 Score =  285 bits (729), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 138/185 (74%), Positives = 155/185 (83%), Gaps = 1/185 (0%)

Query: 166 FRSAS-SPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKA 224
           FRS S SP  +EE V V+L VSLEDL+ GKKK+F IGRKG  G PEKTQ+DIQLKPGWKA
Sbjct: 175 FRSTSNSPSAQEETVQVSLPVSLEDLFHGKKKSFKIGRKGQGGIPEKTQIDIQLKPGWKA 234

Query: 225 GTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTI 284
           GTKITYK+ GDYNP TG RKTLQF++QEK HP F R+G+DL  TLPLTFKESLLGFNK I
Sbjct: 235 GTKITYKSQGDYNPQTGGRKTLQFMLQEKNHPVFKREGDDLTCTLPLTFKESLLGFNKQI 294

Query: 285 QTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQA 344
           QTIDGRTLP+SR QPIQPSE S YPGQGMPIPKTP QRG++IV YK+DYPI+L D Q+ A
Sbjct: 295 QTIDGRTLPISRTQPIQPSETSVYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNA 354

Query: 345 IDENF 349
           I +NF
Sbjct: 355 ILQNF 359

 Score =  135 bits (340), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 65/70 (92%), Positives = 68/70 (97%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG+SPSAN+QEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD  K
Sbjct: 1  MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDKNK 60

Query: 61 REVYDQYGLE 70
          REVYDQYGL+
Sbjct: 61 REVYDQYGLQ 70

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.398
           YNL007C
          Length = 355

 Score =  278 bits (712), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 154/181 (85%), Gaps = 1/181 (0%)

Query: 169 ASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKI 228
            +SP  EEEVV V+L VSLEDL+ GKKKTF IGRKG NG  EK QVDIQLK GWKAGTKI
Sbjct: 176 GASP-AEEEVVTVDLPVSLEDLFQGKKKTFKIGRKGQNGVQEKVQVDIQLKAGWKAGTKI 234

Query: 229 TYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTID 288
           T+KNYGDYNP+TG RKTLQF+I+EK HP F R+ + L+Y LPLTFKESLLGF KTIQTID
Sbjct: 235 TFKNYGDYNPSTGGRKTLQFVIKEKVHPNFKREDDTLVYYLPLTFKESLLGFQKTIQTID 294

Query: 289 GRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDEN 348
           GRTLP+SR+QP+QP++ STYPGQGMP+ K PGQRGDMIV YK++YP +LTD QR+AIDE 
Sbjct: 295 GRTLPISRVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVKYKIEYPTTLTDDQRRAIDEL 354

Query: 349 F 349
           F
Sbjct: 355 F 355

 Score =  135 bits (339), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 65/70 (92%), Positives = 68/70 (97%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG+SPSAN+QEIKKGYRKAALKYHPDKPTG+TEKFKEISEAFEILSD  K
Sbjct: 1  MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEKFKEISEAFEILSDSNK 60

Query: 61 REVYDQYGLE 70
          REVYDQYGLE
Sbjct: 61 REVYDQYGLE 70

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398
          Length = 367

 Score =  273 bits (697), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 154/184 (83%)

Query: 166 FRSASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAG 225
           +RS S  Q EE+   V+L VSLEDL+ GKKK+F +GRKGP+G  EKTQ+DIQLKPGWKAG
Sbjct: 184 YRSPSPEQQEEKTDEVHLPVSLEDLFVGKKKSFKVGRKGPDGKHEKTQIDIQLKPGWKAG 243

Query: 226 TKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQ 285
           TKITYK+ GDYNP TG RKTLQFII EK HP F R+ ++LIYTLPLTFKESLLGF+KTIQ
Sbjct: 244 TKITYKSKGDYNPKTGGRKTLQFIISEKPHPHFKREDDNLIYTLPLTFKESLLGFSKTIQ 303

Query: 286 TIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAI 345
           TIDG+ LP+SR QP+QPSE +TYPGQGMPI K PGQRGD+++ YKVDYPI+LT  QR+AI
Sbjct: 304 TIDGKNLPLSRGQPVQPSETTTYPGQGMPITKKPGQRGDLLIKYKVDYPINLTPAQREAI 363

Query: 346 DENF 349
             NF
Sbjct: 364 SNNF 367

 Score =  134 bits (338), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLL + P+ANEQE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DPQK
Sbjct: 1  MVKETKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61 REVYDQYGLE 70
          RE+YDQYGLE
Sbjct: 61 REIYDQYGLE 70

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {ON}
           similar to gnl|GLV|CAGL0H03707g Candida glabrata
           CAGL0H03707g and some similarites with YNL007C
           uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score =  267 bits (682), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 125/182 (68%), Positives = 150/182 (82%)

Query: 168 SASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTK 227
           S    +PEEEVV VNL VSLEDL++GKKK+F I RKG  G  EK Q+DIQLKPGWKAGTK
Sbjct: 173 SRQQARPEEEVVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKNQIDIQLKPGWKAGTK 232

Query: 228 ITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTI 287
           IT+K  GDYNP TG R+TLQF++QEK H FFTR  NDLIYTLPL+FKESLLGF+K +QTI
Sbjct: 233 ITFKGEGDYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTLPLSFKESLLGFSKQVQTI 292

Query: 288 DGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           DG+T+P++R QPIQP++ STYPGQGM + K P QRGD+I+ +K+DYP SLT +QRQAI +
Sbjct: 293 DGKTIPITRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLIIKFKIDYPTSLTPQQRQAIMD 352

Query: 348 NF 349
           NF
Sbjct: 353 NF 354

 Score =  132 bits (333), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 65/70 (92%), Positives = 66/70 (94%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVK+TKLYDLLGISPSA E EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD QK
Sbjct: 1  MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQK 60

Query: 61 REVYDQYGLE 70
          REVYD YGLE
Sbjct: 61 REVYDTYGLE 70

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
           Anc_1.398
          Length = 363

 Score =  261 bits (666), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 144/175 (82%)

Query: 175 EEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYG 234
           EE V  V++SVSLEDL+ GKKK+F IGRKGP G  EKTQ+DIQLKPGWKAGTK+TYKN G
Sbjct: 187 EEGVDEVHISVSLEDLFAGKKKSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKLTYKNKG 246

Query: 235 DYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPV 294
           DYNP T  RKTLQFII EK HP F R+ ++L+ T+PLTFKESLLGF+KT+QTIDGR LP+
Sbjct: 247 DYNPRTHGRKTLQFIIDEKPHPTFQREDDNLVCTVPLTFKESLLGFSKTVQTIDGRNLPI 306

Query: 295 SRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
           SR QPIQP+E + YPGQGMPI K PGQRGD+IV YK+ YPI+LT  QR AI  NF
Sbjct: 307 SRSQPIQPTEITRYPGQGMPISKKPGQRGDLIVKYKIAYPITLTQAQRDAIKTNF 361

 Score =  134 bits (338), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60
          MVKETKLYDLLG++PSANEQEIKKGYRKAALKYHPDKPTGDTEKFK+ISEA+EILSD  K
Sbjct: 1  MVKETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKQISEAYEILSDSNK 60

Query: 61 REVYDQYGLE 70
          RE+YDQYGLE
Sbjct: 61 REIYDQYGLE 70

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa]
          {ON} Anc_2.243 YNL064C
          Length = 410

 Score =  108 bits (271), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 53/72 (73%), Positives = 63/72 (87%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVK+TK YD+LG+SP+A+E EIKKGYRKAALKYHPDK PT +  EKFKE S A+E+LSDP
Sbjct: 1  MVKDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAEKFKECSAAYEVLSDP 60

Query: 59 QKREVYDQYGLE 70
          +KR+VYDQYG E
Sbjct: 61 EKRDVYDQYGEE 72

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 67/129 (51%), Gaps = 4/129 (3%)

Query: 208 APEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIY 267
           A E+  ++++++PG K G +I +K   D  P       + F++ EK H  F R GNDL+Y
Sbjct: 211 ANERKILEVKIEPGMKDGQRIVFKGESDQAPDIIPGDVV-FVVNEKPHKHFQRSGNDLVY 269

Query: 268 TLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDM 325
              +    ++ G    ++ + G  L ++ +  + I P  K    G+GMPI K  G  G++
Sbjct: 270 LAEIDLLTAIAGGEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGGY-GNL 328

Query: 326 IVNYKVDYP 334
           I+ + + +P
Sbjct: 329 IIQFNIKFP 337

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa]
          {ON} complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  108 bits (270), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVKETK YDLLG+SP+A+E EIKKGYRKAALKYHPDK PT +  EKFKE S A+E+LSD 
Sbjct: 1  MVKETKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEKFKECSGAYEVLSDS 60

Query: 59 QKREVYDQYGLE 70
          QKRE+YDQYG E
Sbjct: 61 QKREIYDQYGEE 72

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 203 KGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDG 262
           KG   A E+  +++ ++PG + G K+T+K   D  P       + F++ EK H  F R G
Sbjct: 204 KGNKVANERKVLEVHVEPGMREGQKVTFKGEADQAPDIIPGDVI-FVVTEKPHKHFKRSG 262

Query: 263 NDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPG 320
           +DL+Y   +    ++ G +  I+ + G  L V+ +  + I P  +    G+GMP+ K  G
Sbjct: 263 DDLLYEAEVDLLTAIAGGDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG 322

Query: 321 QRGDMIVNYKVDYP 334
             G++I+ +K+ +P
Sbjct: 323 Y-GNLIITFKIKFP 335

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 409

 Score =  103 bits (257), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (84%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TKLYDLLG+SP A++ +IKK YRK+ALK+HPDK   +   EKFKEI+ A+EILSD 
Sbjct: 1  MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDS 60

Query: 59 QKREVYDQYGLE 70
          QKREVYDQ+GLE
Sbjct: 61 QKREVYDQFGLE 72

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G +I ++   D +P       + F++ E+ HP F RDGNDL Y  
Sbjct: 209 ERKVLEVNIEPGMKDGQRIVFQGEADQSPGIIPGDVV-FVVSEQPHPVFKRDGNDLHYDA 267

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P       G+GMPIPK  G  G++++
Sbjct: 268 EIDLLSAIAGGQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKY-GGYGNLLI 326

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 327 KFNIKFP 333

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa]
          {ON} Anc_2.243 YNL064C
          Length = 407

 Score =  103 bits (256), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 57/69 (82%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YDLLG+SP+A+E EIKKGYRK ALKYHPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVKETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAEKFKECSAAYEVLSDS 60

Query: 59 QKREVYDQY 67
          QKREVYDQY
Sbjct: 61 QKREVYDQY 69

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 203 KGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDG 262
           KG   A E+  +++ ++PG + G KI +K   D  P       + F++ EK H  F R G
Sbjct: 204 KGKKIANERKVLEVHVEPGMREGQKIVFKGEADQAPDVIPGDVI-FVVVEKPHKHFKRAG 262

Query: 263 NDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPG 320
           +DL+Y   +    ++ G    IQ + G  L VS +  + I    K    G+GMP+PK  G
Sbjct: 263 DDLLYEAEIDLLTAIAGGEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG 322

Query: 321 QRGDMIVNYKVDYP 334
             G++IV +K+ +P
Sbjct: 323 Y-GNLIVTFKIKFP 335

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064c YDJ1
          Length = 407

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (81%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TKLYD LG+SP A++ EIKK YRK+ALKYHPDK   +   EKFKE+S A+EILSD 
Sbjct: 1  MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDS 60

Query: 59 QKREVYDQYGLE 70
          QKREVYDQ+G E
Sbjct: 61 QKREVYDQFGEE 72

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  ++++++PG K G KI +K   D  P       + F+I EK H  F R G+DLIY  
Sbjct: 210 ERKILEVRIEPGMKDGQKIVFKGEADQAPDVIPGDVV-FVISEKPHKHFQRAGDDLIYEA 268

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    +L G    ++ + G  L V  +  + I P  +    G+GMPI K  G  G++++
Sbjct: 269 EIDLLTALAGGQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGY-GNLLI 327

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 328 KFNIKFP 334

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
          to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 411

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/68 (73%), Positives = 59/68 (86%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVK+TKLYDL+G+SP A++ +IKK YRKAALKYHPDK PT +  EKFKEIS A+EILSD 
Sbjct: 1  MVKDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEKFKEISSAYEILSDS 60

Query: 59 QKREVYDQ 66
          QKRE+YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 7/137 (5%)

Query: 203 KGPNG---APEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFT 259
           K  NG   A E+  +++ ++PG K G KI ++   D  P       + F++ E+ H  F 
Sbjct: 203 KACNGKKIANERKILEVHIEPGMKDGQKIVFQGEADQAPDV-VPGDVVFVVSERPHERFN 261

Query: 260 RDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPK 317
           R G+DL Y   +    ++ G    +Q + G  L V  +  + I P       G+GMP+ K
Sbjct: 262 RKGDDLYYEAEVDLLTAIAGGEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQK 321

Query: 318 TPGQRGDMIVNYKVDYP 334
             G  G++IV +K+ +P
Sbjct: 322 YGG-FGNLIVKFKIKFP 337

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa]
          {ON} Anc_2.243
          Length = 410

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/68 (70%), Positives = 59/68 (86%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVK+TKLYD+LG+SP+A + EIKK YRK+ALKYHPDK PT +  EKFKE+S A+EILSD 
Sbjct: 1  MVKDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDS 60

Query: 59 QKREVYDQ 66
          +KRE+YDQ
Sbjct: 61 EKREIYDQ 68

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G  I +K   D  P       + F++ +K H  F R G+DL+Y  
Sbjct: 215 ERKILEVHIEPGMKDGQNIVFKGEADQAPDVIPGDVI-FVVAQKPHKHFQRSGDDLVYEA 273

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L VS +  + I P  K    G+GMPIPK  G  G++IV
Sbjct: 274 EIDLLTAIAGGEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGH-GNLIV 332

Query: 328 NYKVDYP 334
           ++ V +P
Sbjct: 333 HFTVKFP 339

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 58/70 (82%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MV+ETKLYD+LG+SP+A++ EIKK YRK ALKYHPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVRETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 QKREVYDQYG 68
          +KR++YDQ+G
Sbjct: 61 EKRDIYDQFG 70

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 208 APEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIY 267
           A E+  + + + PG K G K+ +K   D  P       + F+I EK H  F R G+DLIY
Sbjct: 209 ANERKILQVNVDPGMKNGQKVVFKGEADQAPDIIPGDVI-FVISEKPHKHFQRVGDDLIY 267

Query: 268 TLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDM 325
              +    ++ G    ++ + G  L VS +  + I P+ +    G+GMPI K  G  G++
Sbjct: 268 EAEIDLLTAVAGGEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGY-GNL 326

Query: 326 IVNYKVDYP 334
           I+ + + +P
Sbjct: 327 IIKFSIKFP 335

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YD+LG+S +A + EIKK YRK ALKYHPDK   +   EKFKE S A+EILSD 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 QKREVYDQYGLE 70
          +KREVYDQ+G E
Sbjct: 61 EKREVYDQFGEE 72

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G +I +K   D  P       + FI+ E+ H  F RDG+DL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKNFKRDGDDLVYEA 270

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P  +    G+GMPIPK  G  G++++
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGY-GNLVI 329

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 330 KFTIKFP 336

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa]
          {ON} highly similar to gnl|GLV|CAGL0J09966g Candida
          glabrata CAGL0J09966g and similar to YNL064C
          uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 412

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YDLLG+S +A+E EIKK YRK ALKYHPDK   +   EKFKE S A+E+L D 
Sbjct: 1  MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEKFKEASSAYEVLMDA 60

Query: 59 QKREVYDQYGLE 70
          +KRE YDQ+G E
Sbjct: 61 EKREAYDQFGEE 72

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 4/133 (3%)

Query: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263
           G   A E+  +++ + PG K G KI +K   D  P       + F++ E+ H  F RD +
Sbjct: 208 GKKVANERKILEVHVDPGMKDGQKIVFKGEADQAPDIIPGDVI-FVVSERPHKHFRRDSD 266

Query: 264 DLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQ 321
           DL+Y   +    ++ G    I+ + G  L V  +  + I P  +    G+GMP+ K  G 
Sbjct: 267 DLVYEADIDLLTAIAGGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG- 325

Query: 322 RGDMIVNYKVDYP 334
            G+++V + + +P
Sbjct: 326 FGNLLVKFNIVFP 338

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
          similar to Ashbya gossypii ADL257C
          Length = 409

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVK+TKLYDLLG+S  AN+ +IKK YRKAALKYHPDK P+ +  +KFK+++ A+EILSD 
Sbjct: 1  MVKDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAADKFKQMTAAYEILSDS 60

Query: 59 QKREVYDQ 66
          QKREVYDQ
Sbjct: 61 QKREVYDQ 68

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 4/129 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G K+ ++   D  P       + F++ E++HP F R+G++L Y  
Sbjct: 212 ERKILEVNIEPGMKNGQKVVFQGEADQQPGQIPGDVV-FVVNEQEHPKFVRNGDNLHYEA 270

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P       G+GMPI K  G  G++++
Sbjct: 271 QIDLLTAVAGGQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKY-GSYGNLLI 329

Query: 328 NYKVDYPIS 336
            + V +P S
Sbjct: 330 KFNVKFPKS 338

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL064C
          (YDJ1)
          Length = 410

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 57/68 (83%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TKLYDLLG+SP AN+ +IKK YRK+ALKYHPDK   +   +KFK+I+ A+EILSD 
Sbjct: 1  MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDS 60

Query: 59 QKREVYDQ 66
          QKRE+YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 67/131 (51%), Gaps = 4/131 (3%)

Query: 208 APEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIY 267
           A E+  +++ ++PG K G KI ++   D  P       + F++ E++HP F R+G++L Y
Sbjct: 211 ASERKILEVNIQPGMKHGQKIVFQGEADQQPGQIPGDVV-FVVNEQEHPRFVRNGDNLHY 269

Query: 268 TLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDM 325
              +    ++ G    ++ + G  L +  +  + I P       G+GMPI K  G  GD+
Sbjct: 270 EAEIDLLTAIAGGQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKY-GSYGDL 328

Query: 326 IVNYKVDYPIS 336
           ++ + V +P S
Sbjct: 329 LIKFNVKFPKS 339

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 58/69 (84%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVK++K YDLLG+S SA E EIKK YRK+ALKYHPDK P+ +  EKFKE+S A+E+LSD 
Sbjct: 1  MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAEKFKEVSSAYEVLSDS 60

Query: 59 QKREVYDQY 67
          +KR+VYDQ+
Sbjct: 61 EKRQVYDQF 69

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 4/133 (3%)

Query: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263
           G   A E+  +++ + PG K G KI +K   D  P       + F++ EK H  F R G+
Sbjct: 207 GKKVANERKILEVHVDPGMKDGQKIVFKGEADQAPDVIPGDVI-FVVSEKPHKNFQRVGD 265

Query: 264 DLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQ 321
           DL+Y   +    ++ G   +++ + G  L V+ +  + I P  +    G+GMPI K  G 
Sbjct: 266 DLVYEAEIDLLTAVAGGEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGY 325

Query: 322 RGDMIVNYKVDYP 334
            G+++V +K+++P
Sbjct: 326 -GNLLVTFKINFP 337

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa]
          {ON} YNL064C (REAL)
          Length = 410

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 55/70 (78%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YD+LG+S +A + EIKK YRK ALKYHPDK   +   EKFKE S A+EILSD 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 QKREVYDQYG 68
          +KR+VYDQ+G
Sbjct: 61 EKRDVYDQFG 70

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G +I +K   D  P       + F++ E+ H  F RDG+DL+Y  
Sbjct: 213 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FLVSERPHKSFKRDGDDLVYEA 271

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P  +    G+GMP+PK  G  G++I+
Sbjct: 272 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGY-GNLII 330

Query: 328 NYKVDYP 334
            + V +P
Sbjct: 331 KFTVKFP 337

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
          YDJ1Type I HSP40 co-chaperone involved in regulation of
          the HSP90 and HSP70 functions; involved in protein
          translocation across membranes; member of the DnaJ
          family
          Length = 409

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (78%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YD+LG+  +A + EIKK YRK ALKYHPDK   +   EKFKE S A+EILSDP
Sbjct: 1  MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDP 60

Query: 59 QKREVYDQYG 68
          +KR++YDQ+G
Sbjct: 61 EKRDIYDQFG 70

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G +I +K   D  P       + FI+ E+ H  F RDG+DL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKSFKRDGDDLVYEA 270

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P  +    G+GMPIPK  G  G++I+
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKY-GGYGNLII 329

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 330 KFTIKFP 336

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (78%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVKETK YD+LG+S +A + EIKK YRK ALK+HPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 QKREVYDQYG 68
          +KREVYDQ+G
Sbjct: 61 EKREVYDQFG 70

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G KI +K   D  P       + F++ E+ H  F RDG+DL+Y  
Sbjct: 212 ERKILEVHVEPGMKDGQKIVFKGEADQAPDVIPGDVV-FLVSERPHKHFKRDGDDLVYEA 270

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    ++ + G  L V  +  + I P  +    G+GMP+PK  G  G++IV
Sbjct: 271 EIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGY-GNLIV 329

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 330 KFTIKFP 336

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa]
          {ON} Anc_2.243
          Length = 411

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (79%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TK YD+LG+SPSA+  EIKK YRK ALKYHPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEKFKEASAAYEVLSDD 60

Query: 59 QKREVYDQY 67
          +KRE+YDQ+
Sbjct: 61 EKREMYDQF 69

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G K+ +K   D  P       + F++ +K H  F R G+DL+Y  
Sbjct: 214 ERKILEVHIEPGMKDGQKVVFKGEADQAPDIIPGDVI-FVVSQKPHEHFQRAGDDLVYEA 272

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    I+ + G  L V+ +  + I P  +     +GMPIPK  G  G++IV
Sbjct: 273 EIDLLTAIAGGEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKY-GGYGNLIV 331

Query: 328 NYKVDYP 334
            + + +P
Sbjct: 332 KFNIKFP 338

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON}
          Anc_2.243 YNL064C
          Length = 409

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TKLYD+LG+S +A + EIKK YRK ALK+HPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVKDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEKFKEASSAYEVLSDA 60

Query: 59 QKREVYDQYGLE 70
           KR+ YDQ+GLE
Sbjct: 61 DKRDTYDQFGLE 72

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263
           G   A E+  +++ + PG K G K+ +K   D  P       + F+I EK H  F R G+
Sbjct: 205 GKKVASERKILEVHVDPGMKNGQKVVFKGEADQAPDVIPGDVV-FVINEKPHKHFQRSGD 263

Query: 264 DLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQ 321
           +L+Y   +    ++ G    I+ + G  L V+ +  + I P  +    G+GMP+ K  G 
Sbjct: 264 NLVYEAEVDLLTAIAGGEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGGY 323

Query: 322 RGDMIVNYKVDYP 334
            G++I+ + V +P
Sbjct: 324 -GNLIIKFTVKFP 335

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa]
          {ON} YNL064C (YDJ1) - yeast dnaJ homolog (nuclear
          envelope protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 55/68 (80%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          MVK+TK YDLLG+SP AN+ +IKK YRK ALK+HPDK   +   +KFKE++ A+EILSD 
Sbjct: 1  MVKDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDS 60

Query: 59 QKREVYDQ 66
          QKR++YDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G KI ++   D  P       + F+I ++ H  F R G+DL+Y  
Sbjct: 213 ERKILEVHIEPGMKDGQKIVFQGEADQAPGIIPGDVV-FVISQRPHKHFERKGDDLLYQA 271

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    I+ + G  L VS +  + I P       G+GMPI K  G  G++IV
Sbjct: 272 EVDLLSAIAGGEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIV 330

Query: 328 NYKVDYP 334
            +K+++P
Sbjct: 331 TFKINFP 337

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 411

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 56/68 (82%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDP 58
          MVKETK YDLLG+   AN+ +IKKGYRK ALK+HPDK P+ +  +KFKE++ A+E+LSD 
Sbjct: 1  MVKETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAADKFKELTVAYEVLSDS 60

Query: 59 QKREVYDQ 66
          QKR++YDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 4/127 (3%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTL 269
           E+  +++ ++PG K G KI ++   D  P       + F+I ++ H  F R G++L Y  
Sbjct: 212 ERKILEVHIEPGMKDGQKIVFQGEADQAPGVIPGDVI-FVISQRPHKHFERKGDNLYYQA 270

Query: 270 PLTFKESLLGFNKTIQTIDGRTLPVSRI--QPIQPSEKSTYPGQGMPIPKTPGQRGDMIV 327
            +    ++ G    I+ + G  L V  +  + I P       G+GMP+ K  G  GD+IV
Sbjct: 271 EVDLLSAIAGGEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIV 329

Query: 328 NYKVDYP 334
            +KV++P
Sbjct: 330 TFKVNFP 336

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and weakly similar to YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 495

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          M K TKLYD+L ++ +A EQEIKK YRK ALK+HPDK     E    F++IS A+E LS+
Sbjct: 1  MAKNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSN 60

Query: 58 PQKREVYDQYG 68
            KRE+YDQYG
Sbjct: 61 SNKRELYDQYG 71

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON}
          Anc_2.218 YNL077W
          Length = 462

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+LYD+L +SP A+  EI+K YR  ALK+HPDK     E   KF E++EA+EIL D
Sbjct: 1  MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEESKSKFLEVNEAYEILID 60

Query: 58 PQKREVYDQYG 68
           +KR +YDQYG
Sbjct: 61 EKKRSLYDQYG 71

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
          Ashbya gossypii AER427W
          Length = 503

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 5/73 (6%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILS 56
          MVK+T+ YDLL +SP+ + QE+KK Y+ AAL+YHPDK  G +E     F++I+EA+ ILS
Sbjct: 1  MVKDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK-NGHSESAKQAFQQITEAYGILS 59

Query: 57 DPQKREVYDQYGL 69
          D +KR++YD+YG+
Sbjct: 60 DERKRKIYDRYGV 72

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 53/73 (72%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV ET+ YDLLGIS +A + EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVLETEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
           Q R  YD+YG E
Sbjct: 61 KQLRSNYDKYGKE 73

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (72%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YD+LGI+P+A + EIKK YRK ++K HPDK   D   TE+F++ISEA+++LSD
Sbjct: 1  MVVDTTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATERFQQISEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
             R  YDQ+G E
Sbjct: 61 EHLRNNYDQFGKE 73

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR090W
          (XDJ1)
          Length = 427

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQK 60
          LY++LGI+ SA+EQE+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD QK
Sbjct: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 61 REVYDQYG 68
          R  YDQ+G
Sbjct: 65 RAEYDQFG 72

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 13/133 (9%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPA--TGRRKTLQFIIQEKK--HPFFTRDGNDL 265
           E++ + + +  G + G ++ Y    D  P   TG    L F+I E+        R G DL
Sbjct: 222 EESIISVYVPRGSQHGDRLRYPGQSDMEPGKETG---DLVFVIDEQTDVSSSLERKGTDL 278

Query: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVS--RIQPIQPSEKSTYPGQGMPIPKTPGQR 322
             T+ ++  E+L GF + + +T D R L ++  R + ++P     +  +G PI    G R
Sbjct: 279 YCTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIED--GAR 336

Query: 323 -GDMIVNYKVDYP 334
            GDM V   +++P
Sbjct: 337 FGDMYVQVLIEFP 349

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077w
          Length = 479

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+LYDLL +   A++  IKK +  AAL+ HPDK     E   +F+EIS+A+E+LSD
Sbjct: 1  MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSD 60

Query: 58 PQKREVYDQYG 68
          P+ RE+YD+YG
Sbjct: 61 PKSREMYDRYG 71

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
          (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          MV  ++LYD+L IS +A+ ++IKK YR  ALKYHPDK     E    F++ISEA+E+L D
Sbjct: 1  MVMSSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLID 60

Query: 58 PQKREVYDQYG 68
           +KR++YDQYG
Sbjct: 61 VEKRKLYDQYG 71

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGI PSA + EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R  YD+YG
Sbjct: 61 ESLRLKYDKYG 71

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 462

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 54/71 (76%), Gaps = 5/71 (7%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILSD 57
          V  ++LYD+LG+S SA+ Q+IKK YR  ALK+HPDK  G +E    KF++I +A+EIL D
Sbjct: 4  VSNSELYDILGVSASASRQDIKKAYRVNALKHHPDK-NGHSEESKLKFQQICKAYEILKD 62

Query: 58 PQKREVYDQYG 68
           +KRE+YD++G
Sbjct: 63 ERKREMYDRFG 73

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 53/71 (74%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LGI P+A   EIKK YR+ A++ HPDK   D   +E+F+++ EA+++LSD
Sbjct: 1  MVKETEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASERFQQVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R+ YD++G
Sbjct: 61 PDLRKQYDEFG 71

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 54/72 (75%), Gaps = 5/72 (6%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILS 56
          MVK+T+LYD+LG+ P  +  E+KK Y+ AAL+YHPDK  G +E    +F++I++A+ +L 
Sbjct: 1  MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK-NGHSEASKQRFQQIADAYRVLG 59

Query: 57 DPQKREVYDQYG 68
          D + R++YD+YG
Sbjct: 60 DERLRKIYDRYG 71

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 66/153 (43%), Gaps = 14/153 (9%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGD--YNPATGRRKTL---QFIIQEKKHPFFTR---- 260
           E+   +++++PG +AG+++ +    D   N   G+ + L     I  E+  P  TR    
Sbjct: 227 ERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPA-TRYQCR 285

Query: 261 -DGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQP---IQPSEKSTYPGQGMPIP 316
            D N L+  L +  + SL G    I+      L    I P   ++P         GMP P
Sbjct: 286 GDANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHP 345

Query: 317 KTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349
             P Q G + + + VD+P +L D    AI +  
Sbjct: 346 DDPSQYGHLFIKFHVDFPKTLADSTITAIAQAL 378

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG+SP+A   EIKK YRK A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAETKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
           + R  YDQ+G
Sbjct: 61 TELRSRYDQFG 71

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YDLLGI P A+  EIKK YRK A+  HPDK   D E   KF+ I +A+++LSD
Sbjct: 1  MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGQAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
          P+ R  YD++G E
Sbjct: 61 PELRSRYDEFGKE 73

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}
          APJ1Putative chaperone of the HSP40 (DNAJ) family;
          overexpression interferes with propagation of the
          [Psi+] prion; the authentic, non-tagged protein is
          detected in highly purified mitochondria in
          high-throughput studies
          Length = 528

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M + T LYD L ++ +A+  EIKK YR AALKYHPDK     E   KF+EI +A+EIL D
Sbjct: 1  MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKD 60

Query: 58 PQKREVYDQYG 68
           + R +YDQYG
Sbjct: 61 NRLRALYDQYG 71

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+TK YD+LG+ P A  ++IKK YRK A++ HPDK   D E   KF+E+S+A+++LSD
Sbjct: 1  MVKDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQAKFQEVSKAYKVLSD 60

Query: 58 PQKREVYDQYGL 69
           + R  YD+ GL
Sbjct: 61 GELRSRYDEVGL 72

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDPQKREVY 64
          Y +LG+S  A+E+EIK  YR+ + KYHPDK  GD     KF E+ EA+E+LSD QKR++Y
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDETAHHKFIEVGEAYEVLSDDQKRQIY 85

Query: 65 DQYGLE 70
          +QYG E
Sbjct: 86 NQYGAE 91

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
          (REAL)
          Length = 533

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L ++ +A+  EIKK YR AALKYHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 PQKREVYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
          similar to Ashbya gossypii AGR084C
          Length = 434

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQK 60
          LY +LGI  +A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD QK
Sbjct: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 61 REVYDQYG 68
          R  YD YG
Sbjct: 65 RSEYDHYG 72

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 260 RDGNDLIYTLPLTFKESLLGFNKTI-QTIDGR----TLPVSRIQPIQPSEKSTYPGQGMP 314
           R G DL  ++ ++  E+L GF + + +T D R    T+P  ++  ++P     +  +G P
Sbjct: 277 RKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV--LRPGNYLKFTNEGWP 334

Query: 315 IPKTPGQR-GDMIVNYKVDYP 334
           I    G R GD+ V   +++P
Sbjct: 335 I--NNGSRFGDLYVKVNIEFP 353

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          ++     Y +LG++  AN++EIK  YR+ + KYHPDK  GD E   KF E+ EA+++LSD
Sbjct: 17 LINAQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHNKFIEVGEAYDVLSD 76

Query: 58 PQKREVYDQYG 68
           +KR +YDQYG
Sbjct: 77 SEKRNIYDQYG 87

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LGISP A   EIKK YRK A+  HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLND 60

Query: 58 PQKREVYDQYG 68
          P  R+ YD++G
Sbjct: 61 PALRKQYDEFG 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  Y+LLGISPSA   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R  YD+YG
Sbjct: 61 DTLRLKYDKYG 71

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YDLLG+ P A+  +IKK YRK A+  HPDK   D E   KF+ I EA+++LSD
Sbjct: 1  MVKDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
          P  R  YD++G E
Sbjct: 61 PDLRSRYDEFGKE 73

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LGI P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
          P  R  YDQ+G E
Sbjct: 61 PGLRSKYDQFGKE 73

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON}
          YMR214W (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          +V     Y +LG+S  A+++EIK  YR+ + K+HPDK  GD +   KF E+ EA+E+LSD
Sbjct: 20 LVAAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSD 79

Query: 58 PQKREVYDQYGLE 70
           QKR++YDQ+G E
Sbjct: 80 DQKRQIYDQHGAE 92

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LGI P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
          P  R  YD++G E
Sbjct: 61 PGLRSKYDEFGKE 73

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LGI P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
          P  R  YD++G E
Sbjct: 61 PGLRSKYDEFGKE 73

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
          (REAL)
          Length = 536

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L ++ +A+  EIKK YR AAL+YHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 PQKREVYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON}
          Anc_2.218 YNL077W
          Length = 448

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+ +LY+ L I P+A++ +IKK YR  AL+YHPDK     E   KF++ISEA+ IL D
Sbjct: 1  MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEESKKKFQDISEAYSILRD 60

Query: 58 PQKREVYDQYG 68
            +R++YD+YG
Sbjct: 61 ENQRKMYDKYG 71

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 14/157 (8%)

Query: 203 KGPNGA---PEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTL----QFIIQEKKH 255
           +G NG     E    D+++ PG K GT+I + N GD      +R+ +       I E + 
Sbjct: 244 QGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGD--EIVNKRRVIPGNVIIHINEIED 301

Query: 256 PFFTR--DGNDLIY-TLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPIQPSEKSTYPG-Q 311
             F R  DG DL Y    +    SL G    I+      L    I P +  E  +  G +
Sbjct: 302 NKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVE 361

Query: 312 GMPIPKTPGQR-GDMIVNYKVDYPISLTDKQRQAIDE 347
            + +PK  G   G + + ++V YP  L  +  +AI++
Sbjct: 362 SLGMPKNKGNEYGILYIQFQVKYPEKLNMESIKAIEK 398

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T  YD+LG+ P+A   EIKK YR+ A++ HPDK   D E   KF+E+ EA+++LSD
Sbjct: 1  MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and some similarites with YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 491

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M ++T+LYD L +SP A   EIK+ Y+  ALKYHPDK     +   KF+E+ +A+EIL+D
Sbjct: 1  MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKNKFQEVCKAYEILAD 60

Query: 58 PQKREVYDQYG 68
            KR +YD+YG
Sbjct: 61 EDKRVMYDRYG 71

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 250 IQEKKHPFFTRDGNDLIY-TLPLTFKESLLGFNKTIQTI-DGRTLPVSRI--QPIQPSEK 305
           +++ K     R G DL+  +  +    SL G +  I     G+ L VS +  + I P+  
Sbjct: 308 VKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCL 367

Query: 306 STYPGQGMPIPKTPGQRGDMIVNYKVDYPISL 337
            +  G GMP     G +G++ + ++++YP+ L
Sbjct: 368 KSIEGMGMPKYGHDGGKGNLYIQFQLEYPVGL 399

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG++P A   +IKK YRK A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R  YDQ+G
Sbjct: 61 PGLRSKYDQFG 71

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 432

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDPQK 60
          LYD LG+S  A + EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD +K
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 61 REVYDQYG 68
          R  YD YG
Sbjct: 63 RSKYDTYG 70

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa]
          {ON} YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 50/66 (75%), Gaps = 5/66 (7%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILSDPQKRE 62
          LYD LG++ +A+ QEIKK YR  ALK+HPDK  G +E    KF++I +A+EIL D +KRE
Sbjct: 9  LYDTLGVAANASRQEIKKAYRLKALKHHPDK-NGHSEQSKLKFQQICKAYEILGDDKKRE 67

Query: 63 VYDQYG 68
          +YD++G
Sbjct: 68 MYDRFG 73

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
          (REAL)
          Length = 532

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L ++ +A+  EIKK YR AALKYHPDK     E   KF+EI +A+E L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYETLKD 60

Query: 58 PQKREVYDQYG 68
             R +YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 49/64 (76%), Gaps = 3/64 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG++  A+++EIK  YR+ + K+HPDK  GD E   KF EI EA+E+LSDP+KR+++
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEAHHKFIEIGEAYEVLSDPEKRKIF 82

Query: 65 DQYG 68
          DQYG
Sbjct: 83 DQYG 86

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
          (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 3/64 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG+S + NE+EIK  YR+ + K+HPDK   D +   KF EI EA+E+LSDP+KR +Y
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHNKFIEIGEAYEVLSDPEKRRMY 84

Query: 65 DQYG 68
          DQ+G
Sbjct: 85 DQFG 88

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 258 FTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSR--IQPIQPSEKSTYPGQGM 313
           + R G DL  T  LT +E++ G +++ IQ +D  + L + R  +  +   E    PG GM
Sbjct: 295 YRRRGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGM 354

Query: 314 PIPKTPGQRGDMIVNYKVDYP 334
           PI  + G+ GD+ ++Y V  P
Sbjct: 355 PILGSKGKFGDLYIDYVVIKP 375

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 461

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDP 58
          VK T+LYD L IS  A  QEIKK YR AALK HPDK     +   KF+EI +A+EIL D 
Sbjct: 4  VKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDKNNHSEDSKRKFQEICKAYEILGDA 63

Query: 59 QKREVYDQYG 68
          +K+ +YD+YG
Sbjct: 64 KKKLLYDRYG 73

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVK+T+ YD+LGI PSA   EIKK YRK A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQSKFQSVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R+ YD++G
Sbjct: 61 DDLRKRYDEFG 71

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDPQKREVY 64
          Y +LG+   A E++IK  YR+ + KYHPDK  GDT     F E+ EA+E LSDP+KR +Y
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEKRRIY 82

Query: 65 DQYGLE 70
          DQYG E
Sbjct: 83 DQYGAE 88

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 258 FTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSRI--QPIQPSEKSTYPGQGM 313
           + R G +L  T  L+ KE+L G + + ++ +D  + +P SR   Q +Q  E    PG GM
Sbjct: 277 YRRQGANLFRTEVLSLKEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGM 336

Query: 314 PIPKTPGQRGDMIVNYKVDYP 334
           P+P + G  GD+ V+Y V  P
Sbjct: 337 PLPDSAG-FGDLYVDYVVILP 356

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 435

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 49/70 (70%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58
          TKLY++LG++P A++ EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61

Query: 59 QKREVYDQYG 68
            R+ YD YG
Sbjct: 62 DSRKKYDVYG 71

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNP--ATGRRKTLQFIIQE--KKHPFFTRDGNDL 265
           E+  + + +  G + G  +  +   D  P   TG    L F+I+E  +      R G+DL
Sbjct: 228 EEKTLTVYIPRGSRNGDIVKLEGEADQEPDKVTG---DLLFVIEENPETSTNLERRGDDL 284

Query: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQ--PIQPSEKSTYPGQGMPIPKTPGQR 322
              L ++  E++ GF K +  T+D R L +   Q   I+P        +G P+  +  + 
Sbjct: 285 HTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKF 344

Query: 323 GDMIVNYKVDYP 334
           GDM V   +++P
Sbjct: 345 GDMYVQVHIEFP 356

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa]
          {ON} Anc_2.218 YNL077W
          Length = 460

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDPQKREV 63
          LYD+LG++  A++ EIKK YRK AL+YHPDK  GD    E F++IS A+ +L D  +R+ 
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEAFQKISHAYGVLGDVAQRQR 63

Query: 64 YDQYGLE 70
          YDQ G E
Sbjct: 64 YDQSGDE 70

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 73.2 bits (178), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGDT--EKFKEISEAFEILSDPQKREVY 64
          Y +LG+S  A +++IK  YR+ + KYHPDK P  D+   KF E+ EA+E+LSDP+KR++Y
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHNKFIEVGEAYEVLSDPEKRKIY 81

Query: 65 DQYGLE 70
          DQYG E
Sbjct: 82 DQYGAE 87

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
          (REAL)
          Length = 460

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQ 59
          +LYD+LG++  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILSDP+
Sbjct: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREVYDQYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 66/154 (42%), Gaps = 16/154 (10%)

Query: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKH 255
           K F     G     +K  + + + PG      IT K   D          L+F + EK+ 
Sbjct: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284

Query: 256 PF-----FTRD-----GNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQP---IQ 301
                  F ++       DL  +  ++  E+L GF K + +T D R L +S I+P   I+
Sbjct: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLS-IKPGRVIR 343

Query: 302 PSEKSTYPGQGMPIPKTP-GQRGDMIVNYKVDYP 334
           P +      +G PI   P GQRGD+ V   +++P
Sbjct: 344 PGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDPQK 60
          LY +LG++ SA + EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD +K
Sbjct: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 61 REVYDQYG 68
          R  YD YG
Sbjct: 64 RAHYDLYG 71

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 18/138 (13%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEK----KHPFFTRDGNDL 265
           E  Q+ + +  G +    I  +N  D      +   +  +I+E         F R G D 
Sbjct: 218 ENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDF 277

Query: 266 IYTLPLTFKESLLGFNKTI--QTIDGRTLPVSRIQPIQPSEKSTYPG-------QGMPIP 316
           +  L L+  E+L GF      +++DGR L +S      PS K   PG       +G P+ 
Sbjct: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLS-----VPSGKVIRPGNIIKIKQEGWPVN 332

Query: 317 KTPGQRGDMIVNYKVDYP 334
               + GD+ V  K+++P
Sbjct: 333 PQASKFGDLYVIIKIEFP 350

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD LGISP+A   EIKK YR+ A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R  YD+YG
Sbjct: 61 ESLRARYDEYG 71

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG+ P A   EIKK YR+ A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVK+ + YD+LGI P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQSKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          PQ +  YDQ+G
Sbjct: 61 PQLKSRYDQFG 71

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLG+S +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGD 60

Query: 58 PQKREVYDQYG 68
             R  YD+YG
Sbjct: 61 DDLRAKYDKYG 71

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}
          XDJ1Putative chaperone, homolog of E. coli DnaJ,
          closely related to Ydj1p; the authentic, non-tagged
          protein is detected in highly purified mitochondria in
          high-throughput studies
          Length = 459

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQ 59
          +LYD+LG++  A  QEIK  YRK ALK+HPDK            KFKEI+ A+EILSDP+
Sbjct: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KREVYDQYG 68
          K+  YD YG
Sbjct: 69 KKSHYDLYG 77

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 16/154 (10%)

Query: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKH 255
           K F     G     +K  + + + PG      IT K   D          L+F + EK+ 
Sbjct: 225 KNFCPDCAGLGLLSKKEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQE 284

Query: 256 PF-----FTRD-----GNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQP---IQ 301
                  F ++     G DL  ++ ++  E+L GF K + +T D R L +S ++P   ++
Sbjct: 285 NLEQKQIFLKNFDDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLS-VKPGRVVR 343

Query: 302 PSEKSTYPGQGMPIPKTP-GQRGDMIVNYKVDYP 334
           P +      +G PI   P G+ GD+ V   +++P
Sbjct: 344 PGDTIKIANEGWPILDNPHGRCGDLYVFVHIEFP 377

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLG+S +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 PQKREVYDQYG 68
           + R  YD+YG
Sbjct: 61 NELRVKYDKYG 71

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
          (REAL)
          Length = 456

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDPQ 59
          +LYD+LG++  A+ QEIK  YRK ALK+HPDK         +  KFKEI+ A+EILSDP+
Sbjct: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68

Query: 60 KREVYDQY 67
          K+  YD Y
Sbjct: 69 KKSHYDLY 76

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG+SP A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS 
Sbjct: 1  MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSS 60

Query: 58 PQKREVYDQYGLE 70
           + R  YD++G E
Sbjct: 61 DELRAKYDKFGKE 73

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLG+S +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATERFQAISEAYQVLGD 60

Query: 58 PQKREVYDQYG 68
           + R  YD++G
Sbjct: 61 DELRAKYDKFG 71

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDPQKR 61
           YD+LG+   A E EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSDP+ +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 62  EVYDQYG 68
             YD YG
Sbjct: 134 SRYDMYG 140

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 6/103 (5%)

Query: 235 DYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLP 293
           +Y   TG    +  I ++       R  NDL  TL ++  ++L GF+  + +T D R L 
Sbjct: 326 EYGKETG--DVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383

Query: 294 VS--RIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYP 334
           V+    + I+P     + G+G P+       GDM V   +++P
Sbjct: 384 VNVPAGKVIRPGNYFKFKGEGWPLSNGDS-FGDMYVQINIEFP 425

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +++ YDLLG+S +A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDSEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 PQKREVYDQYG 68
           + R  YD+YG
Sbjct: 61 DELRAKYDKYG 71

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVK+T+ YD+LG+ P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
           + R+ YDQ G E
Sbjct: 61 DELRKRYDQLGKE 73

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV  T+ YDLLG+ P++ + EIKK YRK ++K HPDK   +   T+KF+ ISEA+++LSD
Sbjct: 1  MVVNTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATKKFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R  YD++G
Sbjct: 61 KNLRSNYDKFG 71

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +L I   A+E+EIK  YR+ + KYHPDK  G  E   KF EI EA+E+LSDP+K+++Y
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHHKFIEIGEAYEVLSDPEKKKIY 84

Query: 65 DQYGLE 70
          DQ+G +
Sbjct: 85 DQFGAD 90

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 258 FTRDGNDLIYTLPLTFKESLLG-FNKTIQTIDGRTLPVSRIQP----IQPSEKSTYPGQG 312
           + R G++L  T  L+  E+L G + +TI+ +D    PV   +P    +   E     G G
Sbjct: 283 YRRRGHNLYRTEVLSAAEALYGGWERTIEFLD-ENKPVKLSRPAHAVVSTGEIEVVKGFG 341

Query: 313 MPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           MP  K     GD+ ++Y V  P +L+ +     DE
Sbjct: 342 MP--KGSRDHGDLYIDYVVVMPKALSHEHTMLKDE 374

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG+SP+A   EIKK YRK +++ HPDK   D   TE+F+ IS+A+++LS+
Sbjct: 1  MVVDTTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSN 60

Query: 58 PQKREVYDQYGLE 70
           + R  YD++G E
Sbjct: 61 EELRTKYDKFGKE 73

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LGI P A   EIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
             R  YD++G E
Sbjct: 61 QGLRSKYDEFGKE 73

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG+ P A   EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD LGISP A   EIKK YRK A+  HPDK   D +   KF+ + +A+++LSD
Sbjct: 1  MVKDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSD 60

Query: 58 PQKREVYDQYG 68
          P  R  YD++G
Sbjct: 61 PGLRSRYDEFG 71

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG+   A++++IK  YR+ + KYHPDK  GD +   +F E+ EA+E LSDP+KR++Y
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHNRFIEVGEAYEALSDPEKRKIY 82

Query: 65 DQYGLE 70
          DQ+G E
Sbjct: 83 DQFGAE 88

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDPQKREVY 64
          Y +LGI+  A ++EIK  YR+ + K+HPDK  G+    +KF E+ EA+E+LSDPQKR+ +
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

Query: 65 DQYGLE 70
          DQ+G +
Sbjct: 83 DQFGAD 88

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T  YD+L +S  A+ QEIKK YRK A+K HPDK   D +   KF+E+++A+++L D
Sbjct: 1  MVKDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLID 60

Query: 58 PQKREVYDQYGLE 70
             R+ YDQ+GL+
Sbjct: 61 DDLRKKYDQFGLD 73

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
          (REAL)
          Length = 455

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 47/72 (65%), Gaps = 6/72 (8%)

Query: 3  KETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56
          +  +LY +LG++  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65

Query: 57 DPQKREVYDQYG 68
          DP+K+  YD YG
Sbjct: 66 DPEKKSHYDLYG 77

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGI+P+A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS+
Sbjct: 1  MVVDTAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATERFQAISEAYQVLSN 60

Query: 58 PQKREVYDQYG 68
           + R  YD+ G
Sbjct: 61 DELRAKYDRLG 71

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVK+ + YD+LG+SP A+  EIKK YRK A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQAKFQRVGEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
           + R+ YD++G
Sbjct: 61 EELRKRYDEFG 71

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG++  A+E++IK  YR+ + K+HPDK  GD E   KF EI EA+E+LSD +KR  Y
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEAHHKFIEIGEAYEVLSDSEKRATY 80

Query: 65 DQYGLE 70
          D++G +
Sbjct: 81 DRFGAD 86

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV ++  YDLLGI P+A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS 
Sbjct: 1  MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSS 60

Query: 58 PQKREVYDQYG 68
           + R  YD++G
Sbjct: 61 EELRAKYDKFG 71

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON}
          Anc_2.218 YNL077W
          Length = 554

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          MV  T+LYD+L +   ++E  IKK YR  ALKYHPDK     E    F++ISEA+ +LS+
Sbjct: 1  MVASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQMFQKISEAYVVLSN 60

Query: 58 PQKREVYDQYG 68
            KR++YD+YG
Sbjct: 61 KDKRQMYDKYG 71

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  Y++LG++P+A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYG 68
             R  YD++G
Sbjct: 61 EDLRGKYDRFG 71

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 49/66 (74%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDPQKREVY 64
          Y +LG++  A+++++K  YR+ + KYHPDK  GD    ++F E+ EA+E+LSDP+KR ++
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIF 80

Query: 65 DQYGLE 70
          DQYG +
Sbjct: 81 DQYGAD 86

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 246 LQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSRIQP--IQ 301
           ++F   +K +  + R G+ L  T  L+ +E+L G +++ I+ +D  + + + R +   + 
Sbjct: 271 VEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVH 330

Query: 302 PSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
             E    PG GMP   +    GD+ V Y V  P       +   DE
Sbjct: 331 HGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMPAQFKQTNQWIRDE 376

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ Y+LLGI  +A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
             R  YD++G E
Sbjct: 61 SDLRANYDKFGKE 73

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 3/64 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG+   A+E+EIK  YR+ + KYHPDK  G+ E    F E+ EA+++LSDP+KR++Y
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

Query: 65 DQYG 68
          D++G
Sbjct: 82 DRHG 85

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 4/87 (4%)

Query: 252 EKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTIDG-RTLPVSR--IQPIQPSEKST 307
           EK    + R GN L  T  L+FKE+L G + + I+  D  ++L +SR     +Q  E   
Sbjct: 268 EKDSMGYRRRGNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEV 327

Query: 308 YPGQGMPIPKTPGQRGDMIVNYKVDYP 334
               GMPIP    + GD+I++Y +  P
Sbjct: 328 IKSFGMPIPSATDKFGDLIIDYVILLP 354

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLL I  +A   EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTEYYDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 PQKREVYDQYGLE 70
             R  YD++G E
Sbjct: 61 KNLRANYDKFGKE 73

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa]
          {ON} Anc_8.730 YMR214W
          Length = 393

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 3/64 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LGI   A+E+ IK  YR+ + KYHPDK   D E    F EI EA+E+LSDP+KR  Y
Sbjct: 31 YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNHFIEIGEAYEVLSDPEKRRTY 90

Query: 65 DQYG 68
          DQ+G
Sbjct: 91 DQFG 94

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 258 FTRDGNDLIYTLPLTFKESLL-GFNKTIQTID-GRTLPVSRI--QPIQPSEKSTYPGQGM 313
           + R GNDL  T  L FK+++  G+N+TI   D  R + +SR    P+   E     G GM
Sbjct: 300 YRRRGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGM 359

Query: 314 PIPKTPGQRGDMIVNYKVDYP 334
           PI  +  + GD+ ++Y +  P
Sbjct: 360 PIQGSD-RFGDLYIDYVIIVP 379

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON}
          Anc_8.264 YLR090W
          Length = 429

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDP 58
          + LY++LG+   A + EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61

Query: 59 QKREVYDQYG 68
          +KR  YD+YG
Sbjct: 62 EKRARYDKYG 71

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 11/133 (8%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHP----FFTRDGNDL 265
           E   + + L  G +   +I  K   D      +   L F I+E           R G DL
Sbjct: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286

Query: 266 IYTLPLTFKESLLGFNKTI-QTIDGRTLPVSRIQP---IQPSEKSTYPGQGMPIPKTPGQ 321
           I  L L+  E++ GF+KT+ +T+DGR L + +I P   I+P      P +G PI  T   
Sbjct: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQL-QIPPGKVIRPGNIIQIPHEGWPIDTT--T 343

Query: 322 RGDMIVNYKVDYP 334
            GD+ V   +++P
Sbjct: 344 SGDLYVVVHIEFP 356

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +LG+S  A+++EIK  YR+ + KYHPDK  GD E   KF E+ EA++IL DP+KR+ Y
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

Query: 65 DQYGLE 70
          D +G +
Sbjct: 82 DVHGAD 87

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKP---TGDTEKFKEISEAFEILSD 57
          MVKET  Y+LLG+ P A   EIKK YRK AL   P+K     G  EKF+ I+EA+++L  
Sbjct: 1  MVKETAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANEKFQAIAEAYQVLHS 60

Query: 58 PQKREVYDQYGLE 70
           + RE YD+ G E
Sbjct: 61 KELREKYDKLGKE 73

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG+SP A + +IKK YRK +++ HPDK   D   TE+F+ ISEA+++L  
Sbjct: 1  MVFDTTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLGS 60

Query: 58 PQKREVYDQYG 68
           + R  YD++G
Sbjct: 61 DELRAKYDKFG 71

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +L I   A+E+EIK  YR+ + K+HPDK  G  E   KF E+ EA+++LSDP+K+++Y
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLE 70
          DQ+G E
Sbjct: 85 DQFGAE 90

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 54/105 (51%), Gaps = 2/105 (1%)

Query: 245 TLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSRIQPIQP 302
            ++F  ++ ++  + R G++L  T  L+ +E+L G + +TI+ +D  + + +SR   +  
Sbjct: 270 VIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWERTIEFLDENKPVKLSRPAYVGV 329

Query: 303 SEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           S       +G  +PK     GD+ ++Y V  P +L  +Q    DE
Sbjct: 330 SNGEIEVMKGFGMPKGGKGYGDLYIDYVVIMPKTLKREQTLLKDE 374

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa]
          {ON} YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig
          173] FULL
          Length = 414

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61
          YD LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EVYDQYG 68
            YD YG
Sbjct: 64 RNYDTYG 70

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263
           G    PE   +++ +  G +   +I  +   D  P       +  I ++       R G+
Sbjct: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGS 268

Query: 264 DLIYTLPLTFKESLLGFNKTI-QTIDGR--TLPVSRIQPIQPSEKSTYPGQGMPIPKTPG 320
           DL   + ++  ++L GF K +  T+DGR   L +   Q I+P        +G P+     
Sbjct: 269 DLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGK 328

Query: 321 QRGDMIVNYKVDYP 334
           + G+M V   +++P
Sbjct: 329 KFGNMYVQINIEFP 342

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
          (REAL)
          Length = 378

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +L +   A+E+EIK  YR+ + KYHPDK +G  E   KF E+ EA+++LSDP+K+++Y
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEAHHKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLE 70
          DQ+G +
Sbjct: 85 DQFGAD 90

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 245 TLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSRIQPIQP 302
            ++F  ++ ++  + R G++L  T  L+ +E+L G + +TI+  D  + + +SR   +  
Sbjct: 273 VIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVV 332

Query: 303 SEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISL 337
           S       +G  +PK+    GD+ ++Y V  P  L
Sbjct: 333 SNGEIEVLKGFGMPKSGKGHGDLYIDYVVIMPNKL 367

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +L I   A E+EIK  YR+ + KYHPDK  G  E   KF E+ EA+++LSDP+K+++Y
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLE 70
          DQ+G +
Sbjct: 85 DQFGAD 90

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 2/105 (1%)

Query: 245 TLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTID-GRTLPVSRIQPIQP 302
            ++F  ++ ++  + R G++L  T  L+  E+L G + +TI+ +D  + + +SR   +  
Sbjct: 272 VIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVV 331

Query: 303 SEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
           S       +G  +PK     GD+ ++Y V  P +    Q    DE
Sbjct: 332 SNGEVEVVKGFGMPKGSKGYGDLYIDYVVVMPKTFKSGQNMLKDE 376

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (62%), Gaps = 8/72 (11%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILS 56
          T LY +LG++ +A + +IKK YRK AL++HPDK              KFKEIS A+EILS
Sbjct: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61

Query: 57 DPQKREVYDQYG 68
          D  KR  YD YG
Sbjct: 62 DEDKRAHYDLYG 73

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILS 56
          MV +T  YDLLG++  A + +IKK YRK ++K HPDK    PT  TE+F+ ISEA+++LS
Sbjct: 1  MVVDTTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTA-TERFQAISEAYQVLS 59

Query: 57 DPQKREVYDQYGLE 70
            + R  YD++G E
Sbjct: 60 SEELRMKYDKFGKE 73

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG+SP A   +IKK YRK +++ HPDK   D   TE+F+ IS+A+++LS 
Sbjct: 1  MVVDTTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSK 60

Query: 58 PQKREVYDQYGLE 70
             R  YD++G E
Sbjct: 61 DDLRAKYDKFGKE 73

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           YD+L +  S+++ +IKK YRK A+K HPDK   P    E FK I+ AFE+LSD QKR++
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKA-HEAFKLINRAFEVLSDSQKRQI 80

Query: 64 YDQYG 68
          YDQ G
Sbjct: 81 YDQIG 85

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 414

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 6/67 (8%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61
          Y+ LG++P A + EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+ +KR
Sbjct: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 62 EVYDQYG 68
          + YD YG
Sbjct: 64 QNYDTYG 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 204 GPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGN 263
           G    PE   +++ +  G + G ++  K   D  P       +  I +        R G+
Sbjct: 209 GKRVTPESKNLNVYIPRGSRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGS 268

Query: 264 DLIYTLPLTFKESLLGFNKTI-QTIDGRTLP--VSRIQPIQPSEKSTYPGQGMPIPKTPG 320
           DL   + ++  ++L GF K +  T+DGR L   V   Q ++P        +G P+     
Sbjct: 269 DLYAKITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGS 328

Query: 321 QRGDMIVNYKVDYP 334
           + GDM V   +++P
Sbjct: 329 KFGDMYVQIDIEFP 342

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREVY 64
           Y++L I   A++ EIKK YRK A+K HPDK      +E FK I+ AFE+LSD QKR ++
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEAFKRINRAFEVLSDEQKRRIF 82

Query: 65 DQYG 68
          DQ G
Sbjct: 83 DQVG 86

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLG+  +A + EIKK YRK ++  HPDK   D   TE+F+ ISEA+++LS+
Sbjct: 1  MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATERFQSISEAYQVLSN 60

Query: 58 PQKREVYDQYGLE 70
             R  YD+ G E
Sbjct: 61 KDLRANYDKSGKE 73

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREV 63
          + Y++L +  SA+E +IKK YRK A+K HPDK      +E FK+I+ AFE+LSD  KR +
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEAFKKINRAFEVLSDDSKRRI 81

Query: 64 YDQYG 68
          +DQ G
Sbjct: 82 FDQLG 86

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREVY 64
           Y+LL I   A++ ++KK YRK A+K HPDK       E FK+I+ AFE+LSD  KR+VY
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEAFKKINRAFEVLSDENKRKVY 84

Query: 65 DQYGLE 70
          DQ G +
Sbjct: 85 DQIGCD 90

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDP 58
          V +T  YDLLG+ PSA   +IKK YRK +++ HPDK   D   TE+F+ IS+A+++LS  
Sbjct: 3  VIDTTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKE 62

Query: 59 QKREVYDQYGLE 70
            R  YD+YG E
Sbjct: 63 DLRAKYDKYGKE 74

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQKREV 63
          Y+LLG+   A++ E+KK YRK AL+YHPDK   +    TEKF  I  A+E+LSDPQ+R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATEKFAIIRAAYEVLSDPQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREV 63
          + Y+LL +   A++ EIKK YRK A++ HPDK T    +E FK I+ AFE+LSD  KR +
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEAFKRINRAFEVLSDVGKRRM 83

Query: 64 YDQYG 68
          +DQ G
Sbjct: 84 FDQLG 88

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+S +A++ E+KK +R+ AL+YHPDK   +    TE F +I  A+E+L+DPQ+
Sbjct: 3  TCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATETFAQIRAAYEVLNDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y++L +  +AN+ EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD +KR++
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKA-SEAFKIINRAFEVLSDVEKRQL 81

Query: 64 YDQYG 68
          YD+ G
Sbjct: 82 YDRIG 86

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+   A++ E+KK YRK AL+YHPDK   +    T+KF  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y++L +  S++E EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD +KRE+
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKA-SEAFKVINRAFEVLSDNEKREI 81

Query: 64 YDQYG 68
          +D+ G
Sbjct: 82 FDRIG 86

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y++L I  SA++ EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD +KR +
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRA-SEAFKVINRAFEVLSDEEKRRL 83

Query: 64 YDQYG 68
          YD+ G
Sbjct: 84 YDRLG 88

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 60.8 bits (146), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREVY 64
           Y++L +   A++ EIKK YRK A+K HPDK      +E FK I+ AFE+LSD QKR + 
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEAFKRINRAFEVLSDEQKRRIL 82

Query: 65 DQY 67
           ++
Sbjct: 83 TRW 85

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDK-PTG---DTEKFKEISEAFEILSDPQK 60
          T  Y+LLG+   A++ E+KK YRK AL+YHPDK PT     TE F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEIFATIRTAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILSDPQK 60
          T  Y+LL +S  A++ E+KK YRK AL+YHPDK    P   T  F EI  A+E+LSDPQ+
Sbjct: 3  TCYYELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEATAIFSEIRAAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+  +A++ E+KK YRK AL++HPDK   +    TE F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATENFATIRAAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y+LL +   A++ +IKK YRK A+K HPDK   P    E FK+++ AFE+LSD +KR V
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRA-AEAFKKVNRAFEVLSDEKKRRV 83

Query: 64 YDQYGLE 70
          YDQ G +
Sbjct: 84 YDQLGYD 90

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILSDP 58
           YDLLGISPSA++++IK  YR+ +LK+HPDK          T   E + +IS+A E L+DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 59  QKREVYDQYG 68
             RE Y +YG
Sbjct: 187 IVRENYLKYG 196

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           YD+L +  SA+  EIKK YRK A+K HPDK   P    E FK I+ AFE+LSD +KR V
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKA-GEAFKVINRAFEVLSDDEKRSV 83

Query: 64 YDQYG 68
          +D+ G
Sbjct: 84 FDRIG 88

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDPQK 60
          T  Y+LLG+   A++ E+KK YRK ALKYHPDK   + E+    F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+   A++ E+KK YRK AL+YHPDK   +    TEKF  I  A+E+LSD Q+
Sbjct: 3  TCYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATEKFAIIRAAYEVLSDSQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+   A++ ++KK YR+ AL+YHPDK  G+    TE F  I  A+E+LSD Q+
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKRE 62
          + Y++L +  +AN+ EIKK YRK A++ HPDK   P   +E FK I+ AFE+L D +KR 
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRA-SEAFKLINRAFEVLGDSEKRS 80

Query: 63 VYDQYG 68
          +YD+ G
Sbjct: 81 LYDRLG 86

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y++L +  ++ E EIKK YRK A++ HPDK   P   +E FK I+ AFE+LSD +KR +
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKA-SEAFKIINRAFEVLSDNEKRRI 80

Query: 64 YDQYG 68
          +DQ G
Sbjct: 81 FDQLG 85

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LL + P A++ E+KK YR+ AL+YHPDK   +    TE F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATEIFASIRAAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa]
          {ON} Anc_2.218
          Length = 530

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKR 61
          T+LY +L +  +A   EIK  Y+K ALKYHPDK     E   KF+EI +A+E+L D  K+
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 62 EVYDQYG 68
           +YD YG
Sbjct: 72 LLYDTYG 78

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDPQK 60
          T  YDLL +   A++ ++KK YR+ AL+YHPDK   + E+    F EI  A+E+LSDPQ+
Sbjct: 3  TCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREV 63
          + Y++L +   A + EIKK YRK A+K HPDK +    +E FK I+ AFE+LS+ +KR +
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+  +A + E+KK YRK AL++HPDK   +    TE F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           Y++L ++ +AN+ EIKK YRK A+K HPDK   P    E FK I+ AFE+L + +KRE+
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKA-AEAFKLINRAFEVLGNSEKREI 81

Query: 64 YDQYG 68
          +++ G
Sbjct: 82 FNRIG 86

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LLG+  +A + E+KK YRK AL++HPDK   +    TE F  I  A+E+LSDPQ+
Sbjct: 3  TCYYELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATEIFATIRSAYEVLSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKREV 63
           YD+L +  +A + EIKK YRK A+K HPDK   P   +E FK I+ AFE+L D +KR +
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKA-SEAFKRINRAFEVLGDEKKRVL 83

Query: 64 YDQYG 68
          +D+ G
Sbjct: 84 FDRIG 88

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDPQK 60
          T  Y+LLG+  +A++ ++KK YR+ AL+YHPDK   + E+    F  I  A+E+L+DPQ+
Sbjct: 3  TCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATTVFATIRSAYEVLADPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDPQK 60
          T  Y+LLG+  +A++ ++KK YRK AL YHPDK   + E+    F  I  A+E+L+DPQ+
Sbjct: 3  TCYYELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDSH 69

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREV 63
          + Y++L +   A + EIKK YRK A+K HPDK +     E FK I+ AFE+LS+ +KR +
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%), Gaps = 2/67 (2%)

Query: 4  ETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKR 61
          +++ Y++L +  +A++ EIKK YR+ A+K HPDK       E FK I+ AFE+L D  KR
Sbjct: 21 KSEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEAFKVINRAFEVLGDEDKR 80

Query: 62 EVYDQYG 68
           ++DQ G
Sbjct: 81 RLFDQLG 87

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQKREV 63
          Y+LLG+   A++ E+KK YRK AL+YHPDK   +    T+KF  I  A+E+LSD Q+R  
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAIIRAAYEVLSDSQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa]
          {ON} Anc_8.730
          Length = 376

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKREVY 64
          Y +L +   A +++I+  YR+ + KYHPDK   D +   KF E+ +A+EILSDP+KR+ Y
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHHKFIEVGQAYEILSDPEKRQRY 83

Query: 65 DQYGLE 70
          DQ+G E
Sbjct: 84 DQFGPE 89

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 246 LQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLG-FNKTIQTIDGRTLPVSRIQP---IQ 301
           ++F   +K +  + R G  L  T  L   E+L G + + +  +D   +   + +P   IQ
Sbjct: 270 IEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQ 329

Query: 302 PSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDE 347
             E     G GMP+       GD+ ++Y V  P SL+ ++ +  DE
Sbjct: 330 NGETERIAGFGMPLGNGRKGFGDLFIDYVVVMPESLSGEELRMRDE 375

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDPQK 60
          T  Y+LLG+  +A + E+KK YR+ AL++HPDK   + E+    F  +  A+E+L+DPQ+
Sbjct: 3  TCYYELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETTAIFASVRAAYEVLADPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDDH 69

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPD-KPTG--DTEKFKEISEAFEILSD 57
          MV +T  YD+LG++PSA  ++  K YR  A++ HPD  PT      KF+E+S+A+++LSD
Sbjct: 1  MVLDTTYYDILGVTPSAFAEQNNKAYRMKAIQTHPDMNPTHPYAHAKFQEVSKAYKVLSD 60

Query: 58 PQKREVYDQYGL 69
          P  +  Y ++GL
Sbjct: 61 PDLKNRYTEFGL 72

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  Y+LL +  +A++ ++KK YR+ AL+YHPDK   +    T+ F  I  A+EILSDPQ+
Sbjct: 3  TCYYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATDIFANIRTAYEILSDPQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RVWYDSH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDPQK 60
          T  YDLL +   A + ++K+ YRK AL YHPDK   +    TE F +I  A+E+LSD Q+
Sbjct: 3  TCYYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 61 REVYDQY 67
          R  YD +
Sbjct: 63 RAWYDAH 69

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDPQKREV 63
          + Y++L +   A + +IKK YRK A+K HPDK +     E FK I+ AFE+LS+ +KR +
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYG 68
          YD+ G
Sbjct: 81 YDRIG 85

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
          (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 6/65 (9%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61
          Y++LG++  A  +EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD  KR
Sbjct: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 62 EVYDQ 66
            YD 
Sbjct: 74 NEYDN 78

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 258 FTRDGNDLIYTLPLTFKESLLGF-NK-TIQTIDGRTLPVS--RIQPIQPSEKSTYPGQGM 313
             R GN LI    ++  E++ GF NK  ++T D R L +S  + + I+P +      +G 
Sbjct: 268 LERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGW 327

Query: 314 PIPKTPGQRGDMIVNYKVDYP 334
           P+ K     G++ V  ++++P
Sbjct: 328 PMDKYGASFGNLYVILEIEFP 348

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 2/61 (3%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQKREVYD 65
          Y +LG+  SA++ EIKK Y K A +YHPD  K  G  +KF ++  A+EILSD  KR+ +D
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGAEKKFHDLQNAYEILSDESKRKQFD 96

Query: 66 Q 66
          Q
Sbjct: 97 Q 97

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 250 IQEKKHPFFT-RDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPIQPSEKSTY 308
           ++ ++ P FT RD +D+ YT+ +    + LG    + T+DG  + +      Q  +  T 
Sbjct: 331 VRVEEDPTFTIRDKSDIWYTMEIPITTAALGGTVQVPTVDGSHIRLKVAPGTQSGDVITV 390

Query: 309 PGQGMPIPKTPGQRGDMIVNYKV 331
           P  G+P       RG M V Y++
Sbjct: 391 PNMGVPRSNLTRSRGAMKVQYRI 413

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDPQKRE 62
          + Y +L +   A + EIKK YRK A+K HPDK   P   +E FK I+ AFE+LS+ +KR 
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKA-SEAFKIINRAFEVLSNEEKRG 79

Query: 63 VYDQYG 68
          +YD+ G
Sbjct: 80 LYDRIG 85

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           YDLLG+S +A+++EIK  YRK +LK+HPDK   D          E + +IS+A+E L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 59  QKREVYDQYG 68
             ++ Y  YG
Sbjct: 182 LVKQNYLMYG 191

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y+LLGIS SA+E++IK  YRK ++K+HPDK + D          E + +I++A+E L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 59  QKREVYDQYG 68
             RE + +YG
Sbjct: 191 AMRENFLKYG 200

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa]
          {ON} Anc_8.264 YLR090W
          Length = 439

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55
          LY +L +  +  + E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 56 SDPQKREVYD 65
          SD +KR+ YD
Sbjct: 72 SDEEKRKQYD 81

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 65/148 (43%), Gaps = 11/148 (7%)

Query: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQE--K 253
           K F +   G         + + +  G      I   N  D      +   L F+++E   
Sbjct: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265

Query: 254 KHPFFTRDGN-DLIYTLPLTFKESLLGFNK--TIQTIDGRTL----PVSRIQPIQPSEKS 306
           +     R G+ DLI  L ++  +++ GF +   ++T+DGR L    PV ++  I+  +  
Sbjct: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323

Query: 307 TYPGQGMPIPKTPGQRGDMIVNYKVDYP 334
              G+G P+ K   + GD+ + + +++P
Sbjct: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
          similar to uniprot|Q12014 Saccharomyces cerevisiae
          YLR090w
          Length = 452

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE-----------KFKEISEAFEILS 56
          Y LLG+   A++ EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 57 DPQKREVYDQ 66
          D   R  YDQ
Sbjct: 64 DASLRAEYDQ 73

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 6/111 (5%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFF--TRDGNDLIY 267
           E   V I +K G   G KI  K   D +  +     L   IQE K P +   R+G DLI 
Sbjct: 235 ENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLII 294

Query: 268 TLPLTFKESLLGFNK--TIQTIDGRTLPVS--RIQPIQPSEKSTYPGQGMP 314
              +   +++ GF++   ++T DGR L  S  R + I+P++      +G P
Sbjct: 295 KKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWP 345

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILSDP 58
           YD+LGIS SA+E+EIK  YRK ++K+HPDK          T   E + +I++A+E L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 59  QKREVYDQYG 68
             R+ + +YG
Sbjct: 181 LTRQNFLKYG 190

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y+LLGIS SA++++IK  YRK ++K+HPDK + D          EK+ +I++A+E L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 59  QKREVYDQYG 68
             +E + +YG
Sbjct: 183 VIKENFLKYG 192

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y++LG++ S+ E+EIKK YR  +LK+HPDK   +          E F +IS+A+E L++P
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 59  QKREVYDQYG 68
             +E Y  YG
Sbjct: 183 ATKENYLLYG 192

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (64%), Gaps = 2/62 (3%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQKREVYD 65
           Y+ LG++  A+  +IKK Y K A ++HPD  K  G  +KF ++  A+EILSD  KR  YD
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQYD 102

Query: 66  QY 67
           Q+
Sbjct: 103 QF 104

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 242 RRKTLQFIIQEKKHPFFTRDGN-DLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPI 300
           RR  L   +Q ++ P F    N D+ Y   +    + LG   +I T+DG  + +  I   
Sbjct: 312 RRGDLLVQVQVERDPRFQIKNNYDIWYVQEIPITTAALGGTVSIPTVDGDQIRLKVIPGT 371

Query: 301 QPSEKSTYPGQGMPIPKTPGQRGDMIVNYKV 331
           QP +  + P +G+P     G RGDM V Y++
Sbjct: 372 QPDQVVSIPNKGVP-RGLSGARGDMKVQYRI 401

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDPQ 59
           Y +LG+SP+AN +EI+K Y     KYHPDK   +         E   +I+EA+E LSD  
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 604 KRKEYD 609

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQKREVYD 65
           Y  LG+S  A+  +IK+ Y K A KYHPD  K  G  + F  +  A+EILSD +K+  YD
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKTFHNLQNAYEILSDEKKKLQYD 109

Query: 66  QYG 68
           QYG
Sbjct: 110 QYG 112

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 15/133 (11%)

Query: 211 KTQVDIQLKPGWKAGTKITYKNYGDY-NPATGR--------RKTLQFIIQEKKHP-FFTR 260
           K  +++    G   G  I     G Y N A G         R  L   I+ K  P FF +
Sbjct: 283 KKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSDPKFFVK 342

Query: 261 DGNDL--IYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKT 318
           +  D+  I  +P+T   + LG    I+T+DG+ + +  I   Q  + ++ P  G+P    
Sbjct: 343 NKYDIWTIKEIPIT--TAALGGTVEIETVDGKNIRLKVISGTQHDQVTSIPNMGIPYRNG 400

Query: 319 PGQRGDMIVNYKV 331
            G RG+M V YK+
Sbjct: 401 TG-RGNMNVQYKI 412

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 10/73 (13%)

Query: 5  TKLYDLLGISP-------SANEQEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEI 54
            LY +LG SP       + +  +++K YRK AL+YHPDK   DT    KF ++S A +I
Sbjct: 13 VNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKNPHDTSLIHKFHQVSVATKI 72

Query: 55 LSDPQKREVYDQY 67
          LSD + R +YD +
Sbjct: 73 LSDSRLRSLYDSW 85

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y LLG+SPSA +++IK  YRK ++K+HPDK + D          E + +IS+A+E L+D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 59  QKREVYDQYG 68
             +  Y  YG
Sbjct: 185 ITKANYLTYG 194

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILSDPQKREVYD 65
          YD+LGI+  A   E+++ YR+  L+ HPDK  G D      I +A+ +LSDP +R  YD
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAYD 64

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y++LG+S SA ++EIK  YRK ++K+HPDK   D          E + +I++A+E L+D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 59  QKREVYDQYG 68
             +E Y +YG
Sbjct: 184 NVKENYLRYG 193

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDPQ 59
           Y +LG+SPSA+ +EI+K Y     KYHPDK   +         E   +I+EA+E LSD  
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa]
          {ON} Anc_8.730 YMR214W
          Length = 384

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 8  YDLLGISPSAN-EQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDPQKREV 63
          Y +LGI+ +   E+EIK  YRK + KYHPDK   D    + F ++ EA+++L DP K+  
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIKVGEAYDVLGDPDKKRQ 85

Query: 64 YDQYG 68
          YDQ G
Sbjct: 86 YDQMG 90

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 258 FTRDGNDLIYTLPLTFKESLLG-FNKTIQTIDGRTLPVSRIQPIQPSEKSTYPGQ----- 311
           + R GN+L  T  ++  E+L G + +T+  +D    P  RI   +    + Y G+     
Sbjct: 294 YRRRGNNLFRTEYISLNEALYGNWERTLDFLD----PKKRINLKRSPNVTIYDGEIEILK 349

Query: 312 --GMPIPKTPGQRGDMIVNYKVDYP 334
             GMPIP    + GD+ ++YKV  P
Sbjct: 350 GFGMPIPNKKNKFGDLYIDYKVIIP 374

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON}
          Anc_8.264 YLR090W
          Length = 432

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 6/56 (10%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57
          YD+LG+   + + EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 59/136 (43%), Gaps = 11/136 (8%)

Query: 210 EKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHP-------FFTRDG 262
           EK Q+ + +  G +    I +K  GD +  T R   + F ++    P         T++G
Sbjct: 223 EKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG 282

Query: 263 NDLIYTLPLTFKESLLGFNKTI--QTIDGRTLPVSRIQP--IQPSEKSTYPGQGMPIPKT 318
            DL   + +   E++ G       +T D R L ++  Q   ++P +     G+G P    
Sbjct: 283 TDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPN 342

Query: 319 PGQRGDMIVNYKVDYP 334
             + GDM V+  V++P
Sbjct: 343 GTEFGDMFVHVNVEFP 358

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILSDPQKREVYD 65
          YD++G+    +++++K  Y++   K HPDK +  G  E F  + +A++ LS+ QKR +YD
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEAFALVHKAYKTLSNKQKRAMYD 84

Query: 66 QYG 68
          +YG
Sbjct: 85 KYG 87

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 4  ETKLYDLLGI---SPSANEQEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          +  LYD+LG    + +    EIKK YR  ALKYHPDK   D    EKF +I+ A  IL++
Sbjct: 12 KVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVEKFHKITIALNILTN 71

Query: 58 PQKREVYDQY 67
           Q +  YD++
Sbjct: 72 NQLKTEYDKW 81

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK-PTGDTE--------KFKEISEAFEILSDP 58
           Y+LLGIS SA++++IK  YRK +LK+HPDK P G +E        ++ +I++A+E L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 59  QKREVYDQYG 68
             R  Y  YG
Sbjct: 183 LIRFNYLTYG 192

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDPQ 59
          + +T  Y +LG++P+A+  +IKK Y+K A + HPDK   +  +E FK + +A+ ILSD +
Sbjct: 3  IDKTTHYSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSELFKIVVDAYSILSDVK 62

Query: 60 KREVYD 65
          +RE Y+
Sbjct: 63 EREEYN 68

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDPQ 59
          + ET  Y +LG+ P A + EI+K Y K A K HPDK   DT  E FK +  A  IL+D +
Sbjct: 14 LDETTYYSILGLHPQATDNEIRKSYMKFARKLHPDKSKSDTCAELFKLVVHAHSILTDKE 73

Query: 60 KREVYDQ 66
           +  YD+
Sbjct: 74 LKLEYDR 80

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDP 58
          ++ ET  Y  LG+S +ANE EI K Y   A + HPDK   +   E+FK IS A  +L D 
Sbjct: 8  ILDETTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQFKLISHAHSVLMDE 67

Query: 59 QKREVYDQ 66
           KR  YD+
Sbjct: 68 AKRLKYDE 75

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 7  LYDLLGISPSANE-------QEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSD 57
          LYD L I+  + E        +++K YR+ ALKYHPDK T     EKF +I  AF++LSD
Sbjct: 14 LYDELQIAILSKEDLNNVSISQLRKQYRQMALKYHPDKSTAPNAQEKFLKIKLAFDVLSD 73

Query: 58 PQKREVYDQY 67
             R+ Y+Q+
Sbjct: 74 SDSRKRYNQW 83

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 2/65 (3%)

Query: 4  ETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDPQKR 61
          ET  Y  LG+S +A+++EI K Y K A + HPDK   D   E FK IS A  +L D +K+
Sbjct: 11 ETTYYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAELFKLISHAHSVLMDKEKK 70

Query: 62 EVYDQ 66
          + YD+
Sbjct: 71 DAYDK 75

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y+LLG++ S+ ++EIK  YRK ++K+HPDK + D          E+F  I++A++ L+D 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 59  QKREVYDQYG 68
             +E Y +YG
Sbjct: 173 ITKENYRKYG 182

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGISPSANEQEIKKGYRKAALKYHPDKP----TGD-----TEKFKEISEAF 52
           TKL+D   +LGIS SA++++IK  YRK ++K+HPDK     T D      E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAY 180

Query: 53  EILSDPQKREVYDQYG 68
           E L+D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFK--EISEAFEILSDPQKREVYD 65
          Y++L +       E+KK YR   L  HPDK    T K+   +I EA+ ILSDP  R+ YD
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTTSKYSIDQIKEAYRILSDPVSRKTYD 66

Query: 66 QYGLE 70
           + LE
Sbjct: 67 AHLLE 71

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y+LLGI  SA E+E++  YRK ++K+HPDK + D          E++  I++A++ L++ 
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 59  QKREVYDQYG 68
             RE Y +YG
Sbjct: 177 VTRENYLKYG 186

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDPQKR 61
          Y++L I   A ++EIKK YR   L  HPDK T +T          +I +A++ILS+ QKR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 62 EVYDQYGLE 70
            YD+  LE
Sbjct: 70 GEYDKTILE 78

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 4  ETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDPQKR 61
          ET  Y +LG++P A + EI+K Y K A + HPDK   D+  E FK +  A  IL+D + +
Sbjct: 5  ETTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEETK 64

Query: 62 EVYD 65
            YD
Sbjct: 65 RKYD 68

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPD---KPTGDTEKFKEISEAFEILSD 57
          MV     Y++LG+    NE +IKK Y+   L  HPD   K  G+    +EI EA+ +L +
Sbjct: 1  MVNNRSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDVGNKVLIEEIKEAYRVLIE 60

Query: 58 PQKREVYDQ 66
             RE YD+
Sbjct: 61 SPSREKYDK 69

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK----PTGD-----TEKFKEISEAFEILSDP 58
           Y++LGIS SA++++IK  YRK ++K+HPDK     T D      E + +I++A+E L+D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 59  QKREVYDQYG 68
             R+ Y +YG
Sbjct: 187 LVRQNYLKYG 196

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDPQ 59
           Y  LG++PSA  +EI+K Y     KYHPDK   +         E   +I+EA+E LSD  
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 600 KRKEYD 605

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGISPSANEQEIKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LGIS SA++++IK  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAY 180

Query: 53  EILSDPQKREVYDQYG 68
           E L+D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 9/67 (13%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILSDP 58
           Y +LGI P A+++EI+K Y     KYHPDK            + EK  EI+EA+E+L+D 
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 59  QKREVYD 65
           +KR+ YD
Sbjct: 603 EKRKEYD 609

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT----EKFKEISEAFEILSDPQKREV 63
          Y++LG++ S  E+E+KK YRK  L+ HPDK    T    EKF +I  AFE+L   + +E 
Sbjct: 16 YEVLGVNKSVTEKELKKCYRKLMLRCHPDKTKDWTPEAKEKFHKIQFAFEVLD--KFKET 73

Query: 64 YDQYG 68
          YD+ G
Sbjct: 74 YDKTG 78

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGISPSANEQEIKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LG+S SA++++IK  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAY 180

Query: 53  EILSDPQKREVYDQYG 68
           E L+D   R+ Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 3   KETKLYDLLGISP---SANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A E +I K +RK  LKYHPDK +           FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGASLDQDGFFKIIQKAFE 153

Query: 54  ILSDPQKREVYDQYGLE 70
            L+DP KR  YD    E
Sbjct: 154 TLTDPTKRSQYDSCDFE 170

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQ 59
          + +T  Y +LG++  A E +IKK YRK A+  HPD  K     E FK +S A  +L D +
Sbjct: 8  IDQTTHYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKE 67

Query: 60 KREVYDQ 66
          +R+ Y++
Sbjct: 68 QRQSYNR 74

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDPQ 59
           Y +LG++P A  +EI+K Y     KYHPDK   +         E   +I+EA+E LSD  
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 597 KRKEYD 602

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQ 59
          V ET  Y +LG+   A+E +IKK YR+ A+  HPD  K     E FK +S A  +L D +
Sbjct: 8  VDETTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAEMFKLVSHAQSVLIDKE 67

Query: 60 KREVYDQ 66
           R  Y++
Sbjct: 68 LRRTYNR 74

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y LL IS S+ ++EI+  YRK ++K+HPDK + D          E++  I++A++ L+D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 59  QKREVYDQYG 68
             RE Y +YG
Sbjct: 177 ITRENYLRYG 186

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y LL +S S+ ++EI+  YRK ++K+HPDK + D          E++  I++A++ L+D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 59  QKREVYDQYG 68
             RE Y +YG
Sbjct: 179 VTRENYLKYG 188

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 7   LYDLLGI-SPSANE---QEIKKGYRKAALKYHPDKPTGDTE-------KFKEISEAFEIL 55
           LYD+LG+ S   +E   +E+K+ Y+K  L+YHPDK     E       +F  +  AF+IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 56  SDPQKREVYDQY 67
            D   R  YDQ+
Sbjct: 143 CDSSLRTQYDQW 154

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +L ++P A  ++I+K Y     KYHPDK           + E+  EI+EA+EILSD  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 565 KRKEYD 570

>KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 282

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 42/74 (56%), Gaps = 10/74 (13%)

Query: 4  ETKLYDLLGISPSANEQ-------EIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFE 53
             LY+LLGI     E        +I++ +R+ ALK+HPDK    +   +KF ++  A +
Sbjct: 10 HVNLYELLGIVVEGPEDLAKLSPLQIRRNFRQQALKHHPDKNRQVSDSRQKFHQLDIAAK 69

Query: 54 ILSDPQKREVYDQY 67
          ILSDP+ R  YDQ+
Sbjct: 70 ILSDPKLRSAYDQW 83

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +L +  +AN ++I+K Y +   KYHPDK           + EK   I+EA+EILSD  
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 569 KRKEYD 574

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 60/134 (44%), Gaps = 11/134 (8%)

Query: 209 PEKTQVDIQLKPGWKAGTKITYKNYGDY-NPATG---------RRKTLQFIIQEKKHPFF 258
           P +  V ++L PG   G  I     G Y N A            R  L   I+ K+   F
Sbjct: 292 PVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLVRIRVKQDKVF 351

Query: 259 T-RDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPK 317
           + R+GN+L  T  +    ++LG N  I T+DG  L +      +  E  + PGQG+P  +
Sbjct: 352 SIRNGNELWQTREIPVTTAVLGGNVVIPTLDGNQLRLRVRSGTRDGETVSVPGQGVPRGR 411

Query: 318 TPGQRGDMIVNYKV 331
               RGDM V ++V
Sbjct: 412 GGLSRGDMKVQWRV 425

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQKREVYD 65
           Y +LG++  A   EIKK Y K A KYHPD  K  G  +KF +I+ A+EILSD +K+  YD
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGSDKKFHDITNAYEILSDEKKKMQYD 108

Query: 66  QYG 68
           Q+G
Sbjct: 109 QFG 111

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT--------EKFKEISEAFEILSDPQ 59
           Y +LGI   AN ++I++ Y     KYHPDK    +        EK   I+EA+E+LSD  
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 571 KRKEYD 576

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKE--------ISEAFEILSDPQ 59
           Y +LGIS +A+ +EI+K Y     KYHPDK    +EK +E        ++EA+EILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 60  KREVYD 65
           K+  YD
Sbjct: 584 KKRDYD 589

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 5  TKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDPQKRE 62
          T  Y +LG++P+A + EI+K Y   A K HPDK   +   E FK +  A  IL+D +K+ 
Sbjct: 12 TTHYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGELFKLVVHAHSILTDVEKKR 71

Query: 63 VYD 65
           YD
Sbjct: 72 AYD 74

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQKR 61
          Y++L I   A ++EIK+ YR   L  HPDK T +T          +I +A+ ILSD + R
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 62 EVYDQYGLE 70
            YD+  LE
Sbjct: 70 CEYDRLILE 78

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTG--------DTEKFKEISEAFEILSDPQ 59
           Y +LG+  SA  +++++ Y +   K+HPDK           + EK  EI+EA+EILSD  
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 60  KREVYD 65
           KR  YD
Sbjct: 590 KRTKYD 595

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +LG+   A  ++I+K Y     KYHPDK           + EK  EI+EA+EILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 567 KRKEYD 572

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +LGIS  A  ++I+K Y +   +YHPDK           + EK  EI+EA+E LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 60  KREVYD 65
           K+  YD
Sbjct: 621 KKSEYD 626

>Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON}
          (110867..111739) [873 nt, 291 aa]
          Length = 290

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 6/65 (9%)

Query: 9  DLLGISPSANE---QEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDPQKRE 62
          DL+G     NE    EI+K YR+ ALKYHPDK   + +    F +IS A +IL D   RE
Sbjct: 23 DLVGNRRQPNEITLTEIRKEYRRLALKYHPDKNISNVDIDSIFHDISLANQILCDSSLRE 82

Query: 63 VYDQY 67
           YD++
Sbjct: 83 QYDKW 87

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK--------FKEISEAFEILSDPQ 59
          Y++L +   A+  +IK+ YR+  L  HPDK  G   +         ++I +A+ +L+DP 
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 60 KREVYD 65
          +RE YD
Sbjct: 66 RREQYD 71

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON}
          Anc_2.218
          Length = 494

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MV++TKLY+ L +  +A   +IKK Y+K ALKYHPDK     +   KF+ + +A+EIL+D
Sbjct: 1  MVRDTKLYETLNVPITATTLDIKKAYKKLALKYHPDKNNHSEDSKTKFQAVCQAYEILND 60

Query: 58 PQKREVYDQYGL 69
           Q R +YD  G+
Sbjct: 61 KQSRAIYDALGI 72

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDP 58
           Y LLG++ SA ++E++  YRK ++K+HPDK   D          E++  I++A++ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 59  QKREVYDQYG 68
             +E Y ++G
Sbjct: 178 ITKENYLKFG 187

>KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92
          YGL128C
          Length = 277

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 21 EIKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILSDPQKREVYDQY 67
          ++K+ YRK +LKYHPDK T  + E+F  +S A +IL +   R VYD++
Sbjct: 34 DLKRQYRKLSLKYHPDKTTDQNAERFHAVSMAMQILGEDHLRSVYDKW 81

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDPQ 59
          + +T  Y LLG+   A  +EI K YRK A+K HPDK   D   E FK +  A  +L++ +
Sbjct: 5  LDKTTHYSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEELFKLVVHAHSVLTNGE 64

Query: 60 KREVYDQ 66
          +R  Y++
Sbjct: 65 ERAKYNK 71

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 2  VKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDPQ 59
          + ET  Y +LG++  A+  EI+K Y K A   HPDK   +   E FK +S A  IL DP+
Sbjct: 10 IDETTYYSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSNASEELFKIVSNAHSILIDPE 69

Query: 60 KREVYDQYGL 69
           +  YD   L
Sbjct: 70 LKLDYDNTLL 79

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 10/71 (14%)

Query: 7  LYDLLGISPSANEQ-------EIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILS 56
          LY LL +S S+ E+       +++  +R+ AL+YHPDK   DT+   KF  + +A++ILS
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 57 DPQKREVYDQY 67
          +   R  Y+++
Sbjct: 76 NSSLRATYNRW 86

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 12/75 (16%)

Query: 8  YDLLGISPSANEQEIKKGYRKAALKYHPDKP----------TGD--TEKFKEISEAFEIL 55
          Y++L I+  A  QEIKK Y++  L  HPDK           T D  +    +I +A++IL
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 56 SDPQKREVYDQYGLE 70
          S+   RE YD+  LE
Sbjct: 71 SNESTREQYDEELLE 85

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +LG++ +++ + I+K Y     KYHPDK           + EK  EI+EA+EIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 60  KREVYD 65
           K++ YD
Sbjct: 616 KKKEYD 621

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDPQKREVYD 65
           Y  LG+S SA   EIKK Y K A KYHPD  K     +KF ++  A+EILSD  KR+ +D
Sbjct: 41  YSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAADAQKKFHDLQNAYEILSDDCKRQQWD 100

Query: 66  QYG 68
           QYG
Sbjct: 101 QYG 103

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 243 RKTLQFIIQEKKHPFF-TRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQPIQ 301
           R  L   I+  K P F  ++  D+ +T  +    + LG   TI T+DG  + +      Q
Sbjct: 320 RGDLLLRIRVDKDPRFQIKNKYDIWFTQDIPITTAALGGVVTIPTVDGEQVRLKVSPGTQ 379

Query: 302 PSEKSTYPGQGMPIPKTPGQRGDMIVNYKV 331
             +  + P +G+P   + G RGDM V Y+V
Sbjct: 380 HHDVVSIPQKGVP-RGSFGTRGDMKVQYRV 408

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDPQ 59
           Y +L I  +AN +EI+K Y      YHPDK           + EK  EI+EA+E LSD  
Sbjct: 477 YKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSDEG 536

Query: 60  KREVYD 65
           KR  YD
Sbjct: 537 KRREYD 542

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 3   KETKLYDLLGISP---SANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     AN+ ++ K +RK  LKYHPDK + +         FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGIFKIIQKAFE 153

Query: 54  ILSDPQKREVYDQYGLE 70
            L+D  KR  YD    +
Sbjct: 154 TLTDSTKRAQYDSCDFQ 170

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 1  MVKETK-LYDLLGISPSANE----QEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAF 52
          ++KE K LY+ L I+ +       QEIK+ YR  ALKYHPDK   D+    KF EIS A 
Sbjct: 8  IIKEGKDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDKHPNDSNLIHKFHEISIAT 67

Query: 53 EILSDPQKREVY 64
           IL+D +  E Y
Sbjct: 68 NILTDEKLSEEY 79

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILSDPQ 59
           Y +LG+  ++  +EI+K Y     KYHPDK    +E        K ++I+EA+E LSD  
Sbjct: 606 YKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSDES 665

Query: 60  KREVYD 65
           KR+ YD
Sbjct: 666 KRKEYD 671

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,193,070
Number of extensions: 1301941
Number of successful extensions: 3223
Number of sequences better than 10.0: 370
Number of HSP's gapped: 2952
Number of HSP's successfully gapped: 459
Length of query: 349
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 239
Effective length of database: 40,868,139
Effective search space: 9767485221
Effective search space used: 9767485221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)